F305113

General Info

Members Datasets Scaffolds Average Seq Length
198 123 396 266

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0035635|Ga0501084_0035635_349_1281
Length 310
Sequence MSDLPPLSIGADDACDPRLIVATRRRRLGSLRRMTADPTSPGPASPSAPTRAHLRVDRRDDGVVLLTLDNPAQRNAMSEEMTDSWVAAVDELAGDPTVRAVVVTGEGSAFCSGGDTSWIAGEPDATVDRLRTRMMAFYRAWLSVRRLEVPTIAAVNGHAIGAGLCLALACDIRYAAQGARLGVPFVKLGMHPGMAATHLLPDVVGPAHARDLLLTGRLVDAGEALGLGLVSRVLPSETFLDDVLAVAGEVAAAAPIPSRLTKVALRQGHADFEAALEWEALAQPVTLATEDLQEGIAAARAKRAPRFTGR

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
50 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
109 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
112 2643221561 Nocardioides sp. Root151 Isolate Unclassified
113 2643221576 Nocardioides sp. Root614 Isolate Unclassified
114 2643221590 Nocardioides sp. Root682 Isolate Unclassified
115 2643221641 Nocardioides sp. Root122 Isolate Unclassified
116 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
117 2643221696 Nocardioides sp. Root140 Isolate Unclassified
118 2739367898 Nocardioides sp. CF479 Isolate Unclassified
119 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
120 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
121 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
122 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
123 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 1.01
Bulb 0
Endosphere 8.08
Nodule 0
Rhizoplane 13.13
Rhizosphere 72.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0035635 3300054114 Bacteria 4160
2 Ga0070683_100214722 3300005329 Bacteria 1828
3 Ga0070660_100048371 3300005339 Bacteria 3266
4 Ga0070659_100000246 3300005366 Bacteria 42640
5 Ga0070659_100010923 3300005366 Bacteria 6700
6 Ga0070667_100107740 3300005367 Bacteria 2413
7 Ga0070662_100167931 3300005457 Bacteria 1721
8 Ga0070685_10083255 3300005466 Bacteria 1922
9 Ga0070698_100006223 3300005471 Bacteria 12991
10 Ga0070672_100151975 3300005543 Bacteria 1916
11 Ga0068855_100382173 3300005563 Bacteria 1546
12 Ga0081539_10009448 3300005985 Bacteria 8147
13 Ga0081539_10107364 3300005985 Bacteria 1412
14 Ga0075365_10007606 3300006038 Bacteria 6086
15 Ga0075365_10011162 3300006038 Bacteria 5271
16 Ga0075365_10078351 3300006038 Bacteria 2234
17 Ga0075365_10196497 3300006038 Bacteria 1412
18 Ga0075368_10094301 3300006042 Bacteria 1226
19 Ga0075363_100013178 3300006048 Bacteria 4000
20 Ga0075363_100244097 3300006048 Bacteria 1033
21 Ga0075367_10033531 3300006178 Bacteria 2960
22 Ga0111539_10201826 3300009094 Bacteria 2319
23 Ga0111539_10330830 3300009094 Bacteria 1773
24 Ga0105245_10880632 3300009098 Bacteria 936
25 Ga0114129_10938591 3300009147 Bacteria 1094
26 Ga0105243_10075861 3300009148 Bacteria 2730
27 Ga0105243_10078267 3300009148 Bacteria 2691
28 Ga0105243_10440769 3300009148 Bacteria 1220
29 Ga0105239_10018791 3300010375 Bacteria 7635
30 Ga0163161_10030471 3300017792 Bacteria 3840
31 Ga0213876_10000165 3300021384 Bacteria 69795
32 Ga0207662_10077263 3300025918 Bacteria 2025
33 Ga0207662_10152619 3300025918 Bacteria 1470
34 Ga0207657_10006115 3300025919 Bacteria 12512
35 Ga0207687_10147009 3300025927 Bacteria 1794
36 Ga0207644_10102803 3300025931 Bacteria 2150
37 Ga0207690_10000065 3300025932 Bacteria 94536
38 Ga0207706_10184721 3300025933 Bacteria 1831
39 Ga0207691_10076309 3300025940 Bacteria 3020
40 Ga0207679_10033790 3300025945 Bacteria 3602
41 Ga0207658_10222357 3300025986 Bacteria 1589
42 Ga0207677_10078362 3300026023 Bacteria 2359
43 Ga0207708_10011445 3300026075 Bacteria 6609
44 Ga0207698_10509927 3300026142 Bacteria 1172
45 Ga0307405_10256082 3300031731 Bacteria 1305
46 Ga0307406_10378157 3300031901 Bacteria 1116
47 Ga0307407_10436656 3300031903 Bacteria 947
48 Ga0307409_100046367 3300031995 Bacteria 3290
49 Ga0307409_100242160 3300031995 Bacteria 1643
50 Ga0307416_100460724 3300032002 Bacteria 1326
51 Ga0307414_10103689 3300032004 Bacteria 2147
52 Ga0307411_10239104 3300032005 Bacteria 1420
53 Ga0307415_100274984 3300032126 Bacteria 1382
54 Ga0373928_0009920 3300035084 Bacteria 1865
55 Ga0395905_0221389 3300037471 Bacteria 1771
56 Ga0436364_0700534 3300037853 Bacteria 5544
57 Ga0395901_0058147 3300038443 Bacteria 4022
58 Ga0439461_0014839 3300041410 Bacteria 1487
59 Ga0439465_0022900 3300041413 Bacteria 1964
60 Ga0439431_0002326 3300041997 Bacteria 4201
61 Ga0439445_0013100 3300042004 Bacteria 2004
62 Ga0466965_0009523 3300044683 Bacteria 4514
63 Ga0466965_0065730 3300044683 Bacteria 1817
64 Ga0466965_0132875 3300044683 Bacteria 1291
65 Ga0466965_0151425 3300044683 Bacteria 1212
66 Ga0466966_0050639 3300044684 Bacteria 2641
67 Ga0466961_0046556 3300044693 Bacteria 2773
68 Ga0466961_0065712 3300044693 Bacteria 2305
69 Ga0466961_0092190 3300044693 Bacteria 1912
70 Ga0466961_0184376 3300044693 Bacteria 1295
71 Ga0466961_0304918 3300044693 Bacteria 972
72 Ga0466961_0349231 3300044693 Bacteria 900
73 Ga0466963_0017586 3300044694 Bacteria 4459
74 Ga0466963_0059414 3300044694 Bacteria 2552
75 Ga0466964_0008419 3300044706 Bacteria 3876
76 Ga0466964_0044649 3300044706 Bacteria 1801
77 Ga0466971_0021122 3300044719 Bacteria 2896
78 Ga0466971_0024579 3300044719 Bacteria 2688
79 Ga0466970_0019448 3300044765 Bacteria 3521
80 Ga0466970_0022298 3300044765 Bacteria 3305
81 Ga0466970_0052246 3300044765 Bacteria 2181
82 Ga0466957_0033723 3300044842 Bacteria 3071
83 Ga0466957_0035280 3300044842 Bacteria 3001
84 Ga0466957_0064122 3300044842 Bacteria 2260
85 Ga0466960_0003270 3300044901 Bacteria 6209
86 Ga0466960_0017194 3300044901 Bacteria 3148
87 Ga0466960_0311388 3300044901 Bacteria 889
88 Ga0466959_0173959 3300045049 Bacteria 1509
89 Ga0466958_0027694 3300045836 Bacteria 3355
90 Ga0466967_0030813 3300045976 Bacteria 4505
91 Ga0466967_0031810 3300045976 Bacteria 4448
92 Ga0466967_0096919 3300045976 Bacteria 2691
93 Ga0466967_0155670 3300045976 Bacteria 2140
94 Ga0466967_0428336 3300045976 Bacteria 1290
95 Ga0466967_0431960 3300045976 Bacteria 1285
96 Ga0495664_0119520 3300046477 Bacteria 1594
97 Ga0495596_0057203 3300046500 Bacteria 1522
98 Ga0496101_0173392 3300048904 Bacteria 1658
99 Ga0496102_0036529 3300048905 Bacteria 4426
100 Ga0496102_0259134 3300048905 Bacteria 1640
101 Ga0496103_0065815 3300048906 Bacteria 2261
102 Ga0496106_0072037 3300048909 Bacteria 2642
103 Ga0496106_0239896 3300048909 Bacteria 1448
104 Ga0496107_0013409 3300048910 Bacteria 5728
105 Ga0496107_0114277 3300048910 Bacteria 1986
106 Ga0496108_0022397 3300048911 Bacteria 5193
107 Ga0496108_0034881 3300048911 Bacteria 4180
108 Ga0496108_0115396 3300048911 Bacteria 2300
109 Ga0496108_0305903 3300048911 Bacteria 1385
110 Ga0496109_0017358 3300048912 Bacteria 6306
111 Ga0496109_0027268 3300048912 Bacteria 5099
112 Ga0496109_0426477 3300048912 Bacteria 1253
113 Ga0496110_0031830 3300048913 Bacteria 4553
114 Ga0496110_0199120 3300048913 Bacteria 1819
115 Ga0496110_0228181 3300048913 Bacteria 1693
116 Ga0496111_0178093 3300048914 Bacteria 1580
117 Ga0496113_0024292 3300048916 Bacteria 4306
118 Ga0496113_0093496 3300048916 Bacteria 2321
119 Ga0496113_0252645 3300048916 Bacteria 1408
120 Ga0496113_0408000 3300048916 Bacteria 1091
121 Ga0496114_0020147 3300048917 Bacteria 5411
122 Ga0496114_0391985 3300048917 Bacteria 1230
123 Ga0496115_0421224 3300048918 Bacteria 1082
124 Ga0501032_0153425 3300049569 Bacteria 1514
125 Ga0501034_0271377 3300049571 Bacteria 1637
126 Ga0501034_0504788 3300049571 Bacteria 1123
127 Ga0501039_0076073 3300049575 Bacteria 2610
128 Ga0501039_0304972 3300049575 Bacteria 1252
129 Ga0501039_0395345 3300049575 Bacteria 1086
130 Ga0501039_0413774 3300049575 Bacteria 1059
131 Ga0501040_0170470 3300049576 Bacteria 1541
132 Ga0501040_0396675 3300049576 Bacteria 991
133 Ga0501041_0171436 3300049577 Bacteria 1358
134 Ga0501041_0239168 3300049577 Bacteria 1141
135 Ga0501042_0003748 3300049578 Bacteria 9606
136 Ga0501042_0043513 3300049578 Bacteria 3198
137 Ga0501043_0200584 3300049579 Bacteria 1549
138 Ga0501046_0477293 3300049580 Bacteria 895
139 Ga0501048_0034032 3300049582 Bacteria 3679
140 Ga0501048_0044707 3300049582 Bacteria 3165
141 Ga0501067_0025099 3300049583 Bacteria 3305
142 Ga0501068_0092788 3300049584 Bacteria 1864
143 Ga0501069_0008361 3300049585 Bacteria 5436
144 Ga0501069_0009274 3300049585 Bacteria 5194
145 Ga0501069_0137316 3300049585 Bacteria 1402
146 Ga0501069_0176862 3300049585 Bacteria 1233
147 Ga0501070_0005980 3300049586 Bacteria 10366
148 Ga0501070_0040833 3300049586 Bacteria 3867
149 Ga0501070_0048023 3300049586 Bacteria 3546
150 Ga0501070_0164174 3300049586 Bacteria 1830
151 Ga0501071_0192518 3300049587 Bacteria 1530
152 Ga0501071_0196453 3300049587 Bacteria 1514
153 Ga0501072_0147561 3300049588 Bacteria 1875
154 Ga0501073_0008996 3300049589 Bacteria 7375
155 Ga0501074_0008308 3300049590 Bacteria 7527
156 Ga0501074_0200559 3300049590 Bacteria 1422
157 Ga0501076_0212014 3300049592 Bacteria 1583
158 Ga0501076_0317997 3300049592 Bacteria 1277
159 Ga0501209_061844 3300049656 Bacteria 1047
160 Ga0501079_0005186 3300049741 Bacteria 9686
161 Ga0501079_0100781 3300049741 Bacteria 2239
162 Ga0501079_0377153 3300049741 Bacteria 1112
163 Ga0501080_0011713 3300049742 Bacteria 8037
164 Ga0501080_0062213 3300049742 Bacteria 3474
165 Ga0501080_0369378 3300049742 Bacteria 1294
166 Ga0501080_0441769 3300049742 Bacteria 1167
167 Ga0501044_0009173 3300049823 Bacteria 10807
168 Ga0501044_0236818 3300049823 Bacteria 1771
169 Ga0501044_0416372 3300049823 Bacteria 1254
170 Ga0501045_0200368 3300049824 Bacteria 1487
171 Ga0501045_0458378 3300049824 Bacteria 947
172 nmdc:mga03n38_61975_c1 3300050490 Bacteria 1704
173 nmdc:mga00v17_36122_c1 3300050491 Bacteria 2943
174 nmdc:mga00v17_51598_c1 3300050491 Bacteria 2501
175 nmdc:mga0yw44_688_c1 3300050492 Bacteria 12373
176 nmdc:mga06z11_206250_c1 3300050494 Bacteria 1144
177 nmdc:mga08y16_223524_c1 3300050511 Bacteria 1948
178 Ga0495601_0131717 3300053077 Bacteria 1629
179 Ga0495655_0073850 3300053083 Bacteria 960
180 Ga0500556_0000318 3300053104 Bacteria 36317
181 Ga0500593_000397 3300053117 Bacteria 17350
182 Ga0500573_0004462 3300053140 Bacteria 7381
183 Ga0466962_0042602 3300061719 Bacteria 2173
184 Ga0466962_0059730 3300061719 Bacteria 1820
185 Ga0466962_0081228 3300061719 Bacteria 1550
186 Ga0530510_0289831 3300061734 Bacteria 1224
187 2643823763 2643221561 Bacteria 4984412
188 2643889690 2643221576 Bacteria 5214352
189 2643958746 2643221590 Bacteria 5214697
190 2644230871 2643221641 Bacteria 4490190
191 2644323267 2643221657 Bacteria 5490246
192 2644535441 2643221696 Bacteria 5431823
193 2740167518 2739367898 Bacteria 4367674
194 2812331965 2811994874 Bacteria 5367947
195 2819745468 2818991472 Bacteria 10089953
196 2855389278 2855386786 Bacteria 4752232
197 2984576932 2984576629 Bacteria 4248407
198 2990258679 2990256926 Bacteria 4252839
199 Ga0501084_0035635
200 Ga0070683_100214722
201 Ga0070660_100048371
202 Ga0070659_100000246
203 Ga0070659_100010923
204 Ga0070667_100107740
205 Ga0070662_100167931
206 Ga0070685_10083255
207 Ga0070698_100006223
208 Ga0070672_100151975
209 Ga0068855_100382173
210 Ga0081539_10009448
211 Ga0081539_10107364
212 Ga0075365_10007606
213 Ga0075365_10011162
214 Ga0075365_10078351
215 Ga0075365_10196497
216 Ga0075368_10094301
217 Ga0075363_100013178
218 Ga0075363_100244097
219 Ga0075367_10033531
220 Ga0111539_10201826
221 Ga0111539_10330830
222 Ga0105245_10880632
223 Ga0114129_10938591
224 Ga0105243_10075861
225 Ga0105243_10078267
226 Ga0105243_10440769
227 Ga0105239_10018791
228 Ga0163161_10030471
229 Ga0213876_10000165
230 Ga0207662_10077263
231 Ga0207662_10152619
232 Ga0207657_10006115
233 Ga0207687_10147009
234 Ga0207644_10102803
235 Ga0207690_10000065
236 Ga0207706_10184721
237 Ga0207691_10076309
238 Ga0207679_10033790
239 Ga0207658_10222357
240 Ga0207677_10078362
241 Ga0207708_10011445
242 Ga0207698_10509927
243 Ga0307405_10256082
244 Ga0307406_10378157
245 Ga0307407_10436656
246 Ga0307409_100046367
247 Ga0307409_100242160
248 Ga0307416_100460724
249 Ga0307414_10103689
250 Ga0307411_10239104
251 Ga0307415_100274984
252 Ga0373928_0009920
253 Ga0395905_0221389
254 Ga0436364_0700534
255 Ga0395901_0058147
256 Ga0439461_0014839
257 Ga0439465_0022900
258 Ga0439431_0002326
259 Ga0439445_0013100
260 Ga0466965_0009523
261 Ga0466965_0065730
262 Ga0466965_0132875
263 Ga0466965_0151425
264 Ga0466966_0050639
265 Ga0466961_0046556
266 Ga0466961_0065712
267 Ga0466961_0092190
268 Ga0466961_0184376
269 Ga0466961_0304918
270 Ga0466961_0349231
271 Ga0466963_0017586
272 Ga0466963_0059414
273 Ga0466964_0008419
274 Ga0466964_0044649
275 Ga0466971_0021122
276 Ga0466971_0024579
277 Ga0466970_0019448
278 Ga0466970_0022298
279 Ga0466970_0052246
280 Ga0466957_0033723
281 Ga0466957_0035280
282 Ga0466957_0064122
283 Ga0466960_0003270
284 Ga0466960_0017194
285 Ga0466960_0311388
286 Ga0466959_0173959
287 Ga0466958_0027694
288 Ga0466967_0030813
289 Ga0466967_0031810
290 Ga0466967_0096919
291 Ga0466967_0155670
292 Ga0466967_0428336
293 Ga0466967_0431960
294 Ga0495664_0119520
295 Ga0495596_0057203
296 Ga0496101_0173392
297 Ga0496102_0036529
298 Ga0496102_0259134
299 Ga0496103_0065815
300 Ga0496106_0072037
301 Ga0496106_0239896
302 Ga0496107_0013409
303 Ga0496107_0114277
304 Ga0496108_0022397
305 Ga0496108_0034881
306 Ga0496108_0115396
307 Ga0496108_0305903
308 Ga0496109_0017358
309 Ga0496109_0027268
310 Ga0496109_0426477
311 Ga0496110_0031830
312 Ga0496110_0199120
313 Ga0496110_0228181
314 Ga0496111_0178093
315 Ga0496113_0024292
316 Ga0496113_0093496
317 Ga0496113_0252645
318 Ga0496113_0408000
319 Ga0496114_0020147
320 Ga0496114_0391985
321 Ga0496115_0421224
322 Ga0501032_0153425
323 Ga0501034_0271377
324 Ga0501034_0504788
325 Ga0501039_0076073
326 Ga0501039_0304972
327 Ga0501039_0395345
328 Ga0501039_0413774
329 Ga0501040_0170470
330 Ga0501040_0396675
331 Ga0501041_0171436
332 Ga0501041_0239168
333 Ga0501042_0003748
334 Ga0501042_0043513
335 Ga0501043_0200584
336 Ga0501046_0477293
337 Ga0501048_0034032
338 Ga0501048_0044707
339 Ga0501067_0025099
340 Ga0501068_0092788
341 Ga0501069_0008361
342 Ga0501069_0009274
343 Ga0501069_0137316
344 Ga0501069_0176862
345 Ga0501070_0005980
346 Ga0501070_0040833
347 Ga0501070_0048023
348 Ga0501070_0164174
349 Ga0501071_0192518
350 Ga0501071_0196453
351 Ga0501072_0147561
352 Ga0501073_0008996
353 Ga0501074_0008308
354 Ga0501074_0200559
355 Ga0501076_0212014
356 Ga0501076_0317997
357 Ga0501209_061844
358 Ga0501079_0005186
359 Ga0501079_0100781
360 Ga0501079_0377153
361 Ga0501080_0011713
362 Ga0501080_0062213
363 Ga0501080_0369378
364 Ga0501080_0441769
365 Ga0501044_0009173
366 Ga0501044_0236818
367 Ga0501044_0416372
368 Ga0501045_0200368
369 Ga0501045_0458378
370 nmdc:mga03n38_61975_c1
371 nmdc:mga00v17_36122_c1
372 nmdc:mga00v17_51598_c1
373 nmdc:mga0yw44_688_c1
374 nmdc:mga06z11_206250_c1
375 nmdc:mga08y16_223524_c1
376 Ga0495601_0131717
377 Ga0495655_0073850
378 Ga0500556_0000318
379 Ga0500593_000397
380 Ga0500573_0004462
381 Ga0466962_0042602
382 Ga0466962_0059730
383 Ga0466962_0081228
384 Ga0530510_0289831
385 2643823763
386 2643889690
387 2643958746
388 2644230871
389 2644323267
390 2644535441
391 2740167518
392 2812331965
393 2819745468
394 2855389278
395 2984576932
396 2990258679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

63

245

0.95

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

58

310

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9379 7 256
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9369 3 256
4mi2-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.9353 7 256
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9347 7 256
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9346 2 256
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9622 2 55 3.30.300.220
4jcsA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9545 7 198 3.90.226.10
af_C6TH01_2_215_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9517 1 198 3.90.226.10
4fzwD01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.951 7 198 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9489 3 198 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A838LMB4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9934 2 256 GO:0006635
GO:0016829
GO:0016853
AF-A0A7W0S6R4-F1-model_v4 deleted 0.9888 7 222
AF-A0A838LMB4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9857 2 256 GO:0006635
GO:0016829
GO:0016853
AF-A0A7I8MY74-F1-model_v4 Enoyl-CoA hydratase (EC) (EC 4.2.1.17) 0.978 7 254 GO:0004300
GO:0006635
AF-A0A1F8WKM0-F1-model_v4 Enoyl-CoA hydratase 0.9778 3 256 GO:0006635
GO:0016829

Map