F304984

General Info

Members Datasets Scaffolds Average Seq Length
198 145 396 147

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0031607|Ga0496126_0031607_4062_4526
Length 154
Sequence MDGRAAMVDILHRVGVEGSTPEAVYRALTTVDGLAGWWTEDTTGSEGVGGVLAFRFPPVGGFDMEVVELRPSERVVWRVVDGPEEWVGTTVEWDLRQDGDWTIVLFGHRGWAEPVEFMHHCSTKWATYLLSLKVLAETGVGAPAPRDVQISDWH

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
82 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
141 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
142 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
143 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
144 8002784119 Frankia sp. AgB1.9 Isolate Nodule
145 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 1.01
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 1.01
Rhizoplane 10.1
Rhizosphere 79.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0031607 3300048929 Bacteria 4997
2 rootH2_10044220 3300003320 Bacteria 1038
3 Ga0070658_10693341 3300005327 Bacteria 884
4 Ga0070680_100175941 3300005336 Bacteria 1802
5 Ga0070682_100375376 3300005337 Bacteria 1068
6 Ga0070682_100771738 3300005337 Bacteria 778
7 Ga0070675_101281916 3300005354 Bacteria 675
8 Ga0070688_100605684 3300005365 Bacteria 839
9 Ga0070659_100502429 3300005366 Bacteria 1034
10 Ga0070667_100999087 3300005367 Bacteria 781
11 Ga0070701_10985586 3300005438 Bacteria 587
12 Ga0070681_11481891 3300005458 Bacteria 603
13 Ga0068867_101270114 3300005459 Bacteria 679
14 Ga0070672_101965131 3300005543 Bacteria 527
15 Ga0070686_100257795 3300005544 Bacteria 1277
16 Ga0070704_100838050 3300005549 Bacteria 824
17 Ga0070702_100022520 3300005615 Bacteria 3333
18 Ga0068852_100645994 3300005616 Bacteria 1065
19 Ga0068864_100167912 3300005618 Bacteria 1999
20 Ga0068870_10132025 3300005840 Bacteria 1452
21 Ga0068870_10520623 3300005840 Bacteria 796
22 Ga0068863_100005155 3300005841 Bacteria 12891
23 Ga0068863_101507056 3300005841 Bacteria 681
24 Ga0081539_10034835 3300005985 Bacteria 3036
25 Ga0081539_10171634 3300005985 Bacteria 1025
26 Ga0068865_100799003 3300006881 Bacteria 814
27 Ga0105245_11306258 3300009098 Bacteria 774
28 Ga0105241_11085464 3300009174 Bacteria 753
29 Ga0105248_10000079 3300009177 Bacteria 111571
30 Ga0105248_10272349 3300009177 Bacteria 1906
31 Ga0105248_10446037 3300009177 Bacteria 1458
32 Ga0105248_12688885 3300009177 Bacteria 567
33 Ga0105238_10920153 3300009551 Bacteria 893
34 Ga0105249_10184375 3300009553 Bacteria 2033
35 Ga0105249_10392868 3300009553 Bacteria 1415
36 Ga0105239_10018452 3300010375 Bacteria 7705
37 Ga0105246_10371104 3300011119 Bacteria 1179
38 Ga0105246_10432620 3300011119 Bacteria 1101
39 Ga0157374_12698488 3300013296 Bacteria 524
40 Ga0157378_12779841 3300013297 Bacteria 542
41 Ga0163162_10840659 3300013306 Bacteria 1034
42 Ga0163162_12329578 3300013306 Bacteria 615
43 Ga0157372_10581538 3300013307 Bacteria 1305
44 Ga0157372_11367133 3300013307 Bacteria 817
45 Ga0157372_11494575 3300013307 Bacteria 778
46 Ga0157375_10236504 3300013308 Bacteria 1986
47 Ga0157375_10419684 3300013308 Bacteria 1504
48 Ga0157375_10895534 3300013308 Bacteria 1032
49 Ga0163163_11174591 3300014325 Bacteria 830
50 Ga0163163_11400693 3300014325 Bacteria 761
51 Ga0163163_11822727 3300014325 Bacteria 669
52 Ga0163163_11967167 3300014325 Bacteria 644
53 Ga0157380_10397974 3300014326 Bacteria 1306
54 Ga0157380_11269593 3300014326 Bacteria 783
55 Ga0157380_11422834 3300014326 Bacteria 744
56 Ga0157379_10000842 3300014968 Bacteria 24851
57 Ga0163161_10060225 3300017792 Bacteria 2763
58 Ga0206354_11597883 3300020081 Bacteria 624
59 Ga0206353_10636236 3300020082 Bacteria 782
60 Ga0207688_10570326 3300025901 Bacteria 712
61 Ga0207654_10658979 3300025911 Bacteria 750
62 Ga0207663_11078612 3300025916 Bacteria 645
63 Ga0207649_10798767 3300025920 Bacteria 736
64 Ga0207652_10617339 3300025921 Bacteria 971
65 Ga0207694_10478442 3300025924 Bacteria 1041
66 Ga0207659_10505473 3300025926 Bacteria 1023
67 Ga0207687_10819848 3300025927 Bacteria 794
68 Ga0207700_11121546 3300025928 Bacteria 703
69 Ga0207706_10062081 3300025933 Bacteria 3291
70 Ga0207704_10475854 3300025938 Bacteria 1002
71 Ga0207704_11437011 3300025938 Bacteria 591
72 Ga0207665_11108210 3300025939 Bacteria 631
73 Ga0207711_10000072 3300025941 Bacteria 112054
74 Ga0207711_10343851 3300025941 Bacteria 1381
75 Ga0207689_10518147 3300025942 Bacteria 1000
76 Ga0207658_10764108 3300025986 Bacteria 876
77 Ga0207703_10000017 3300026035 Bacteria 282185
78 Ga0207641_10035381 3300026088 Bacteria 4160
79 Ga0207648_10634503 3300026089 Bacteria 986
80 Ga0207676_10198587 3300026095 Bacteria 1770
81 Ga0207676_11053868 3300026095 Bacteria 803
82 Ga0207676_12100740 3300026095 Bacteria 563
83 Ga0207698_11370509 3300026142 Bacteria 722
84 Ga0207698_11433933 3300026142 Bacteria 706
85 Ga0268266_10648428 3300028379 Bacteria 1016
86 Ga0307408_100033361 3300031548 Bacteria 3597
87 Ga0307408_100152504 3300031548 Bacteria 1826
88 Ga0307408_101611086 3300031548 Bacteria 617
89 Ga0307405_10106390 3300031731 Bacteria 1892
90 Ga0307405_10394503 3300031731 Bacteria 1081
91 Ga0307413_10047704 3300031824 Bacteria 2556
92 Ga0307413_10108510 3300031824 Bacteria 1853
93 Ga0307410_10042724 3300031852 Bacteria 2998
94 Ga0307410_10105266 3300031852 Bacteria 2031
95 Ga0307410_10491734 3300031852 Bacteria 1008
96 Ga0307410_11679117 3300031852 Bacteria 562
97 Ga0307406_10095655 3300031901 Bacteria 2010
98 Ga0307407_10069113 3300031903 Bacteria 2095
99 Ga0307412_10461543 3300031911 Bacteria 1049
100 Ga0307409_100156484 3300031995 Bacteria 1986
101 Ga0307409_100207551 3300031995 Bacteria 1758
102 Ga0307409_100228019 3300031995 Bacteria 1686
103 Ga0307409_100424654 3300031995 Bacteria 1276
104 Ga0307409_100776508 3300031995 Bacteria 964
105 Ga0307416_100146949 3300032002 Bacteria 2154
106 Ga0307416_102059580 3300032002 Bacteria 673
107 Ga0307414_10317484 3300032004 Bacteria 1325
108 Ga0307411_10052891 3300032005 Bacteria 2658
109 Ga0307415_100007143 3300032126 Bacteria 6085
110 Ga0373944_0160680 3300035089 Bacteria 797
111 Ga0373937_0020155 3300036401 Bacteria 5976
112 Ga0395899_0182636 3300037312 Bacteria 1472
113 Ga0395901_0044889 3300038443 Bacteria 4584
114 Ga0439466_0040307 3300041411 Bacteria 1562
115 Ga0451793_1242181 3300041452 Bacteria 696
116 Ga0451837_1046311 3300041494 Bacteria 580
117 Ga0451849_0745610 3300041505 Bacteria 562
118 Ga0451851_1168512 3300041507 Bacteria 779
119 Ga0451853_3316641 3300041512 Bacteria 1325
120 Ga0451853_3361630 3300041512 Bacteria 627
121 Ga0439449_0383300 3300042007 Bacteria 533
122 Ga0439434_0141247 3300042435 Bacteria 794
123 Ga0439444_0088694 3300042437 Bacteria 687
124 Ga0466972_0078959 3300044658 Bacteria 1567
125 Ga0466965_0003175 3300044683 Bacteria 7178
126 Ga0466965_0828815 3300044683 Bacteria 537
127 Ga0466961_0326210 3300044693 Bacteria 936
128 Ga0466963_0749694 3300044694 Bacteria 689
129 Ga0466964_0048686 3300044706 Bacteria 1734
130 Ga0466971_0366551 3300044719 Bacteria 699
131 Ga0466970_0023869 3300044765 Bacteria 3197
132 Ga0466970_0414556 3300044765 Bacteria 769
133 Ga0466957_0024635 3300044842 Bacteria 3562
134 Ga0466957_1447758 3300044842 Bacteria 501
135 Ga0466960_0106240 3300044901 Bacteria 1452
136 Ga0466958_0208206 3300045836 Bacteria 1245
137 Ga0466958_0430069 3300045836 Bacteria 854
138 Ga0466958_0626996 3300045836 Bacteria 700
139 Ga0466967_0022661 3300045976 Bacteria 5131
140 Ga0466967_0118373 3300045976 Bacteria 2443
141 Ga0495651_0001297 3300046462 Bacteria 19387
142 Ga0495653_0060757 3300046463 Bacteria 2862
143 Ga0495582_0039693 3300046473 Bacteria 2592
144 Ga0495608_0227959 3300046511 Bacteria 1167
145 Ga0495652_0429350 3300046529 Bacteria 929
146 Ga0495587_0089738 3300046536 Bacteria 1776
147 Ga0495667_0004138 3300046559 Bacteria 9755
148 Ga0495634_0605338 3300046642 Bacteria 636
149 Ga0495635_0026770 3300046663 Bacteria 4011
150 Ga0495657_0004694 3300046675 Bacteria 10887
151 Ga0495623_0015716 3300046679 Bacteria 4891
152 Ga0495674_0269686 3300047319 Bacteria 1397
153 Ga0495680_0005865 3300047322 Bacteria 11491
154 Ga0495675_0051642 3300047444 Bacteria 2611
155 Ga0495684_0115506 3300047471 Bacteria 2024
156 Ga0495602_0053324 3300048088 Bacteria 3583
157 Ga0496100_1260245 3300048903 Bacteria 583
158 Ga0496100_1678581 3300048903 Bacteria 502
159 Ga0496101_0796628 3300048904 Bacteria 745
160 Ga0496102_0151508 3300048905 Bacteria 2179
161 Ga0496103_0035051 3300048906 Bacteria 3071
162 Ga0496104_0211334 3300048907 Bacteria 1852
163 Ga0496104_0817447 3300048907 Bacteria 838
164 Ga0496105_0045760 3300048908 Bacteria 3611
165 Ga0496105_1157087 3300048908 Bacteria 572
166 Ga0496107_0655166 3300048910 Bacteria 774
167 Ga0496109_0083805 3300048912 Bacteria 2940
168 Ga0496112_0004813 3300048915 Bacteria 11523
169 Ga0496112_0011413 3300048915 Bacteria 8113
170 Ga0496113_0080119 3300048916 Bacteria 2501
171 Ga0496114_0001275 3300048917 Bacteria 19037
172 Ga0496114_0029730 3300048917 Bacteria 4492
173 Ga0496114_0050906 3300048917 Bacteria 3448
174 Ga0496114_0275009 3300048917 Bacteria 1484
175 Ga0496115_0052555 3300048918 Bacteria 3269
176 Ga0496116_0000406 3300048919 Bacteria 62016
177 Ga0496117_0005849 3300048920 Bacteria 12728
178 Ga0496117_0053213 3300048920 Bacteria 2846
179 Ga0496118_0002089 3300048921 Bacteria 28088
180 Ga0496118_0004290 3300048921 Bacteria 17062
181 Ga0496119_0007317 3300048922 Bacteria 9988
182 Ga0496119_0031004 3300048922 Bacteria 3593
183 Ga0496121_0007821 3300048924 Bacteria 12794
184 Ga0501292_071840 3300049515 Bacteria 645
185 Ga0501037_0999554 3300049573 Bacteria 545
186 Ga0501070_0994049 3300049586 Bacteria 651
187 nmdc:mga0k408_53026_c1 3300050493 Bacteria 2350
188 nmdc:mga07m45_21663_c1 3300050496 Bacteria 3501
189 Ga0495601_0315132 3300053077 Bacteria 1019
190 Ga0495595_0003740 3300053084 Bacteria 6051
191 Ga0495619_0149977 3300053085 Bacteria 1608
192 Ga0466962_0050593 3300061719 Bacteria 1986
193 2799186446 2799112218 Bacteria 4315149
194 2816425960 2816332119 Bacteria 8120218
195 2819427662 2818991318 Bacteria 5266538
196 3002999799 3002998708 Bacteria 11715108
197 8002792227 8002784119 Bacteria 9788632
198 8055418764 8055412473 Bacteria 6257500
199 Ga0496126_0031607
200 rootH2_10044220
201 Ga0070658_10693341
202 Ga0070680_100175941
203 Ga0070682_100375376
204 Ga0070682_100771738
205 Ga0070675_101281916
206 Ga0070688_100605684
207 Ga0070659_100502429
208 Ga0070667_100999087
209 Ga0070701_10985586
210 Ga0070681_11481891
211 Ga0068867_101270114
212 Ga0070672_101965131
213 Ga0070686_100257795
214 Ga0070704_100838050
215 Ga0070702_100022520
216 Ga0068852_100645994
217 Ga0068864_100167912
218 Ga0068870_10132025
219 Ga0068870_10520623
220 Ga0068863_100005155
221 Ga0068863_101507056
222 Ga0081539_10034835
223 Ga0081539_10171634
224 Ga0068865_100799003
225 Ga0105245_11306258
226 Ga0105241_11085464
227 Ga0105248_10000079
228 Ga0105248_10272349
229 Ga0105248_10446037
230 Ga0105248_12688885
231 Ga0105238_10920153
232 Ga0105249_10184375
233 Ga0105249_10392868
234 Ga0105239_10018452
235 Ga0105246_10371104
236 Ga0105246_10432620
237 Ga0157374_12698488
238 Ga0157378_12779841
239 Ga0163162_10840659
240 Ga0163162_12329578
241 Ga0157372_10581538
242 Ga0157372_11367133
243 Ga0157372_11494575
244 Ga0157375_10236504
245 Ga0157375_10419684
246 Ga0157375_10895534
247 Ga0163163_11174591
248 Ga0163163_11400693
249 Ga0163163_11822727
250 Ga0163163_11967167
251 Ga0157380_10397974
252 Ga0157380_11269593
253 Ga0157380_11422834
254 Ga0157379_10000842
255 Ga0163161_10060225
256 Ga0206354_11597883
257 Ga0206353_10636236
258 Ga0207688_10570326
259 Ga0207654_10658979
260 Ga0207663_11078612
261 Ga0207649_10798767
262 Ga0207652_10617339
263 Ga0207694_10478442
264 Ga0207659_10505473
265 Ga0207687_10819848
266 Ga0207700_11121546
267 Ga0207706_10062081
268 Ga0207704_10475854
269 Ga0207704_11437011
270 Ga0207665_11108210
271 Ga0207711_10000072
272 Ga0207711_10343851
273 Ga0207689_10518147
274 Ga0207658_10764108
275 Ga0207703_10000017
276 Ga0207641_10035381
277 Ga0207648_10634503
278 Ga0207676_10198587
279 Ga0207676_11053868
280 Ga0207676_12100740
281 Ga0207698_11370509
282 Ga0207698_11433933
283 Ga0268266_10648428
284 Ga0307408_100033361
285 Ga0307408_100152504
286 Ga0307408_101611086
287 Ga0307405_10106390
288 Ga0307405_10394503
289 Ga0307413_10047704
290 Ga0307413_10108510
291 Ga0307410_10042724
292 Ga0307410_10105266
293 Ga0307410_10491734
294 Ga0307410_11679117
295 Ga0307406_10095655
296 Ga0307407_10069113
297 Ga0307412_10461543
298 Ga0307409_100156484
299 Ga0307409_100207551
300 Ga0307409_100228019
301 Ga0307409_100424654
302 Ga0307409_100776508
303 Ga0307416_100146949
304 Ga0307416_102059580
305 Ga0307414_10317484
306 Ga0307411_10052891
307 Ga0307415_100007143
308 Ga0373944_0160680
309 Ga0373937_0020155
310 Ga0395899_0182636
311 Ga0395901_0044889
312 Ga0439466_0040307
313 Ga0451793_1242181
314 Ga0451837_1046311
315 Ga0451849_0745610
316 Ga0451851_1168512
317 Ga0451853_3316641
318 Ga0451853_3361630
319 Ga0439449_0383300
320 Ga0439434_0141247
321 Ga0439444_0088694
322 Ga0466972_0078959
323 Ga0466965_0003175
324 Ga0466965_0828815
325 Ga0466961_0326210
326 Ga0466963_0749694
327 Ga0466964_0048686
328 Ga0466971_0366551
329 Ga0466970_0023869
330 Ga0466970_0414556
331 Ga0466957_0024635
332 Ga0466957_1447758
333 Ga0466960_0106240
334 Ga0466958_0208206
335 Ga0466958_0430069
336 Ga0466958_0626996
337 Ga0466967_0022661
338 Ga0466967_0118373
339 Ga0495651_0001297
340 Ga0495653_0060757
341 Ga0495582_0039693
342 Ga0495608_0227959
343 Ga0495652_0429350
344 Ga0495587_0089738
345 Ga0495667_0004138
346 Ga0495634_0605338
347 Ga0495635_0026770
348 Ga0495657_0004694
349 Ga0495623_0015716
350 Ga0495674_0269686
351 Ga0495680_0005865
352 Ga0495675_0051642
353 Ga0495684_0115506
354 Ga0495602_0053324
355 Ga0496100_1260245
356 Ga0496100_1678581
357 Ga0496101_0796628
358 Ga0496102_0151508
359 Ga0496103_0035051
360 Ga0496104_0211334
361 Ga0496104_0817447
362 Ga0496105_0045760
363 Ga0496105_1157087
364 Ga0496107_0655166
365 Ga0496109_0083805
366 Ga0496112_0004813
367 Ga0496112_0011413
368 Ga0496113_0080119
369 Ga0496114_0001275
370 Ga0496114_0029730
371 Ga0496114_0050906
372 Ga0496114_0275009
373 Ga0496115_0052555
374 Ga0496116_0000406
375 Ga0496117_0005849
376 Ga0496117_0053213
377 Ga0496118_0002089
378 Ga0496118_0004290
379 Ga0496119_0007317
380 Ga0496119_0031004
381 Ga0496121_0007821
382 Ga0501292_071840
383 Ga0501037_0999554
384 Ga0501070_0994049
385 nmdc:mga0k408_53026_c1
386 nmdc:mga07m45_21663_c1
387 Ga0495601_0315132
388 Ga0495595_0003740
389 Ga0495619_0149977
390 Ga0466962_0050593
391 2799186446
392 2816425960
393 2819427662
394 3002999799
395 8002792227
396 8055418764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

19

137

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.9295 1 134
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.9229 1 134
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.862 2 129
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8554 2 134
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8517 2 134
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9295 1 134 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9229 1 134 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8719 2 129 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8576 4 137 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8439 3 140 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A838J2T4-F1-model_v4 SRPBCC domain-containing protein 0.9769 2 136
AF-A0A535RKA9-F1-model_v4 SRPBCC domain-containing protein 0.9743 1 136
AF-A0A7Z9GE84-F1-model_v4 SRPBCC domain-containing protein 0.9714 1 136
AF-A0A7Y5MNK2-F1-model_v4 SRPBCC domain-containing protein 0.9696 1 129
AF-A0A023BZ20-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9691 1 136

Map