F304777

General Info

Members Datasets Scaffolds Average Seq Length
198 138 185 233

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0083011|Ga0439434_0083011_165_968
Length 267
Sequence VYGSVPADIPEGEPGVAAAAGADWAIVPPLDGKAMPEEAPMSETSELRAVRVWDLPTRLFHWLLALCVVGLIVTSKIGGNALQWHMWLGLTVGALLVFRLLWGIVGGRWSRFGSFAYAPGTVLRYLRRDHRDDDHFEVGHNPLGAFSVFAMIGVLVIQVATGLFADDEIATTGPLNRFVATDTGLAATGWHKGWGQWLIIGLVVLHVGAIIVYRLRGIGLVSAMWRGDKLLPAAVPPSADSVRERVLALVLIALCAAGAVAVARLGG

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221717 Acidovorax sp. Root267 Isolate Unclassified
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
80 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
81 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
133 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
137 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
138 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.43
Metatranscriptomes 0
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.25
Nodule 0
Rhizoplane 0.51
Rhizosphere 57.58
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10096707 3300003320 Bacteria 2510
2 rootL2_10017555 3300003322 Bacteria 8928
3 Ga0065165_1002060 3300005262 Bacteria 18596
4 Ga0070676_10016550 3300005328 Bacteria 4078
5 Ga0070670_100168926 3300005331 Bacteria 1897
6 Ga0070677_10023424 3300005333 Bacteria 2286
7 Ga0068868_100134113 3300005338 Bacteria 2028
8 Ga0070669_100230080 3300005353 Bacteria 1469
9 Ga0070675_100050812 3300005354 Bacteria 3405
10 Ga0070671_100065665 3300005355 Bacteria 3023
11 Ga0070671_100342322 3300005355 Bacteria 1276
12 Ga0070667_100081716 3300005367 Bacteria 2765
13 Ga0070708_100039179 3300005445 Bacteria 4145
14 Ga0070662_100231593 3300005457 Bacteria 1478
15 Ga0068867_100010107 3300005459 Bacteria 6651
16 Ga0070707_100474918 3300005468 Bacteria 1212
17 Ga0070672_100024336 3300005543 Bacteria 4473
18 Ga0070665_100542041 3300005548 Bacteria 1175
19 Ga0068857_100024715 3300005577 Bacteria 5291
20 Ga0068870_10037829 3300005840 Bacteria 2489
21 Ga0075365_10016654 3300006038 Bacteria 4476
22 Ga0075368_10039772 3300006042 Bacteria 1844
23 Ga0075364_10173290 3300006051 Bacteria 1459
24 Ga0075362_10048989 3300006177 Bacteria 1886
25 Ga0075367_10010899 3300006178 Bacteria 4791
26 Ga0075366_10097926 3300006195 Bacteria 1759
27 Ga0075366_10108361 3300006195 Bacteria 1670
28 Ga0075366_10135221 3300006195 Bacteria 1489
29 Ga0075366_10140483 3300006195 Bacteria 1460
30 Ga0075370_10001988 3300006353 Bacteria 9265
31 Ga0075370_10003799 3300006353 Bacteria 7230
32 Ga0075370_10009963 3300006353 Bacteria 4953
33 Ga0075370_10012166 3300006353 Bacteria 4540
34 Ga0075370_10071534 3300006353 Bacteria 1984
35 Ga0075370_10241614 3300006353 Bacteria 1069
36 Ga0075370_10297200 3300006353 Unclassified 960
37 Ga0068865_100161273 3300006881 Bacteria 1711
38 Ga0105243_10065575 3300009148 Bacteria 2917
39 Ga0105243_10186089 3300009148 Bacteria 1810
40 Ga0157375_10072844 3300013308 Bacteria 3453
41 Ga0157377_10046282 3300014745 Bacteria 2432
42 Ga0163161_10032224 3300017792 Bacteria 3741
43 Ga0209050_1000222 3300025298 Bacteria 126562
44 Ga0207688_10042995 3300025901 Bacteria 2515
45 Ga0207645_10001670 3300025907 Bacteria 18048
46 Ga0207645_10018245 3300025907 Bacteria 4621
47 Ga0207645_10117495 3300025907 Bacteria 1725
48 Ga0207643_10041914 3300025908 Bacteria 2580
49 Ga0207684_10076164 3300025910 Bacteria 2851
50 Ga0207681_10108924 3300025923 Bacteria 2012
51 Ga0207650_10228417 3300025925 Bacteria 1500
52 Ga0207706_10269318 3300025933 Bacteria 1486
53 Ga0207709_10339082 3300025935 Bacteria 1131
54 Ga0207704_10639424 3300025938 Bacteria 875
55 Ga0207691_10020725 3300025940 Bacteria 6216
56 Ga0207689_10026606 3300025942 Bacteria 4846
57 Ga0207640_10435768 3300025981 Bacteria 1076
58 Ga0207677_10015871 3300026023 Bacteria 4445
59 Ga0207677_10537566 3300026023 Bacteria 1016
60 Ga0207648_10014018 3300026089 Bacteria 7427
61 Ga0207648_10016628 3300026089 Bacteria 6715
62 Ga0207674_10099098 3300026116 Bacteria 2897
63 Ga0209974_10001536 3300027876 Bacteria 8381
64 Ga0209974_10071736 3300027876 Bacteria 1182
65 Ga0307517_10136252 3300028786 Bacteria 1745
66 Ga0307517_10175038 3300028786 Bacteria 1400
67 Ga0307515_10000037 3300028794 Bacteria 331970
68 Ga0307515_10000123 3300028794 Bacteria 186601
69 Ga0307515_10009530 3300028794 Bacteria 18753
70 Ga0307515_10009883 3300028794 Bacteria 18375
71 Ga0307515_10110774 3300028794 Bacteria 3209
72 Ga0307515_10210369 3300028794 Bacteria 1791
73 Ga0307515_10435249 3300028794 Bacteria 929
74 Ga0307512_10043138 3300030522 Bacteria 3724
75 Ga0307513_10006134 3300031456 Bacteria 15771
76 Ga0307513_10010549 3300031456 Bacteria 11563
77 Ga0307513_10169196 3300031456 Bacteria 2065
78 Ga0307509_10068554 3300031507 Bacteria 3712
79 Ga0307408_100001205 3300031548 Bacteria 19516
80 Ga0307408_100017398 3300031548 Bacteria 4810
81 Ga0307408_100238481 3300031548 Bacteria 1493
82 Ga0307508_10000134 3300031616 Bacteria 87501
83 Ga0307514_10003119 3300031649 Bacteria 16302
84 Ga0307516_10172836 3300031730 Bacteria 1900
85 Ga0307410_10074880 3300031852 Bacteria 2359
86 Ga0307406_10001471 3300031901 Bacteria 13007
87 Ga0307406_10226501 3300031901 Bacteria 1393
88 Ga0307411_10029324 3300032005 Bacteria 3358
89 Ga0307411_10112145 3300032005 Bacteria 1954
90 Ga0307507_10052786 3300033179 Bacteria 3892
91 Ga0307510_10228588 3300033180 Bacteria 1365
92 Ga0373937_0188493 3300036401 Bacteria 1938
93 Ga0439465_0155189 3300041413 Bacteria 819
94 Ga0451839_1587376 3300041496 Bacteria 728
95 Ga0451839_1613183 3300041496 Bacteria 849
96 Ga0439431_0005131 3300041997 Bacteria 2889
97 Ga0450912_007165 3300042116 Bacteria 900
98 Ga0450888_004519 3300042126 Bacteria 1456
99 Ga0450890_017967 3300042127 Bacteria 944
100 Ga0439434_0083011 3300042435 Bacteria 1018
101 Ga0453684_0356330 3300044712 Bacteria 1648
102 Ga0495627_006366 3300046453 Bacteria 4635
103 Ga0495605_0000595 3300046474 Bacteria 28668
104 Ga0495605_0170147 3300046474 Bacteria 963
105 Ga0495584_0003613 3300046491 Bacteria 8434
106 Ga0495584_0048555 3300046491 Bacteria 2139
107 Ga0495585_0040617 3300046492 Bacteria 2611
108 Ga0495585_0065827 3300046492 Bacteria 1985
109 Ga0495596_0000218 3300046500 Bacteria 39821
110 Ga0495596_0011805 3300046500 Bacteria 3751
111 Ga0495607_0058044 3300046501 Bacteria 2215
112 Ga0495606_0012694 3300046507 Bacteria 6725
113 Ga0495616_0032295 3300046513 Bacteria 2736
114 Ga0495616_0089968 3300046513 Bacteria 1455
115 Ga0495620_0053866 3300046515 Bacteria 1702
116 Ga0495631_0018276 3300046518 Bacteria 3303
117 Ga0495631_0063031 3300046518 Bacteria 1606
118 Ga0495632_0010610 3300046519 Bacteria 5439
119 Ga0495632_0016737 3300046519 Bacteria 4067
120 Ga0495643_0058242 3300046522 Bacteria 2056
121 Ga0495643_0125416 3300046522 Bacteria 1293
122 Ga0495644_0025639 3300046523 Bacteria 2237
123 Ga0495644_0066590 3300046523 Bacteria 1353
124 Ga0495663_0007662 3300046525 Bacteria 2985
125 Ga0495654_0000701 3300046530 Bacteria 26290
126 Ga0495609_0013701 3300046538 Bacteria 3825
127 Ga0495597_0004295 3300046542 Bacteria 7873
128 Ga0495597_0029583 3300046542 Bacteria 2500
129 Ga0495633_0082830 3300046558 Bacteria 1492
130 Ga0495656_0025390 3300046615 Bacteria 2348
131 Ga0495656_0100171 3300046615 Bacteria 1339
132 Ga0495668_0015163 3300046616 Bacteria 4505
133 Ga0495668_0026245 3300046616 Bacteria 3306
134 Ga0495611_0131417 3300046648 Bacteria 1168
135 Ga0495625_0023246 3300046660 Bacteria 4737
136 Ga0495625_0030027 3300046660 Bacteria 4059
137 Ga0495661_0025182 3300046665 Bacteria 3846
138 Ga0495669_0002982 3300046684 Bacteria 6957
139 Ga0495670_0010639 3300046691 Bacteria 4522
140 Ga0495589_0017974 3300046794 Bacteria 3627
141 Ga0495589_0025353 3300046794 Bacteria 3009
142 Ga0495660_0109211 3300046810 Bacteria 1413
143 Ga0495687_015945 3300047443 Bacteria 3795
144 Ga0495687_078637 3300047443 Bacteria 1298
145 Ga0495677_0020919 3300047445 Bacteria 2372
146 Ga0495677_0048080 3300047445 Bacteria 1567
147 Ga0495681_0011313 3300047470 Bacteria 5323
148 Ga0495686_0186855 3300047472 Bacteria 1197
149 Ga0495626_0014638 3300048091 Bacteria 4038
150 Ga0496106_0004453 3300048909 Bacteria 10386
151 Ga0501037_0089342 3300049573 Bacteria 2229
152 Ga0501223_004540 3300049663 Bacteria 2961
153 Ga0501044_0483517 3300049823 Bacteria 1141
154 nmdc:mga03n38_2908_c2 3300050490 Bacteria 2924
155 nmdc:mga03n38_50167_c1 3300050490 Bacteria 1858
156 nmdc:mga00v17_10729_c1 3300050491 Bacteria 5016
157 nmdc:mga00v17_51967_c1 3300050491 Bacteria 2492
158 nmdc:mga0yw44_136364_c1 3300050492 Bacteria 1592
159 nmdc:mga0k408_113074_c1 3300050493 Bacteria 1605
160 nmdc:mga0k408_1176_c1 3300050493 Bacteria 14315
161 nmdc:mga0k408_154654_c1 3300050493 Bacteria 1366
162 nmdc:mga0k408_284186_c1 3300050493 Bacteria 988
163 nmdc:mga0k408_3012_c1 3300050493 Bacteria 8945
164 nmdc:mga0k408_34234_c1 3300050493 Bacteria 2907
165 nmdc:mga0k408_36517_c1 3300050493 Bacteria 2821
166 nmdc:mga0k408_62632_c2 3300050493 Bacteria 1501
167 nmdc:mga06z11_17436_c1 3300050494 Bacteria 3259
168 nmdc:mga04h51_230375_c1 3300050495 Bacteria 737
169 nmdc:mga04h51_3431_c1 3300050495 Bacteria 3855
170 nmdc:mga07m45_18013_c1 3300050496 Bacteria 3804
171 nmdc:mga07m45_2674_c1 3300050496 Bacteria 8400
172 nmdc:mga07m45_3796_c1 3300050496 Bacteria 7313
173 nmdc:mga07m45_39266_c1 3300050496 Bacteria 2645
174 nmdc:mga07m45_64512_c1 3300050496 Bacteria 2079
175 Ga0500578_0000064 3300053086 Bacteria 117170
176 Ga0500644_0005946 3300053088 Bacteria 3102
177 Ga0500646_0017115 3300053090 Bacteria 1898
178 Ga0500651_0146010 3300053093 Bacteria 1423
179 Ga0500642_0005031 3300053130 Bacteria 4216
180 Ga0500658_0003094 3300053134 Bacteria 6357
181 Ga0500590_002641 3300053148 Bacteria 8046
182 Ga0500604_0069334 3300053151 Bacteria 1121
183 Ga0500622_0027531 3300053156 Bacteria 2996
184 Ga0500570_078532 3300053724 Bacteria 1500
185 Ga0500587_008471 3300053739 Bacteria 1322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0089968 Ga0495616_0089968_501_1190 200
2 3300031456 Ga0307513_10006134 Ga0307513_1000613414 206
3 3300006353 Ga0075370_10297200 Ga0075370_102972002 210
4 3300041496 Ga0451839_1613183 Ga0451839_1613183_35_736 213
5 3300053130 Ga0500642_0005031 Ga0500642_0005031_795_1496 213
6 3300046665 Ga0495661_0025182 Ga0495661_0025182_3175_3828 217
7 iso_pu_bacteria 2643221609 2644061010 217
8 iso_pu_bacteria 2643221611 2644071682 217
9 iso_pu_bacteria 2738543012 2739247163 217
10 iso_pu_bacteria 2816332133 2816476213 217
11 3300006038 Ga0075365_10016654 Ga0075365_100166542 218
12 3300006042 Ga0075368_10039772 Ga0075368_100397722 218
13 3300006051 Ga0075364_10173290 Ga0075364_101732901 218
14 3300006178 Ga0075367_10010899 Ga0075367_100108994 218
15 3300006353 Ga0075370_10071534 Ga0075370_100715342 218
16 3300050490 nmdc:mga03n38_2908_c2 nmdc:mga03n38_2908_c2_1884_2615 218
17 3300050491 nmdc:mga00v17_51967_c1 nmdc:mga00v17_51967_c1_1709_2440 218
18 3300050492 nmdc:mga0yw44_136364_c1 nmdc:mga0yw44_136364_c1_152_883 218
19 3300050493 nmdc:mga0k408_1176_c1 nmdc:mga0k408_1176_c1_7131_7862 218
20 3300050495 nmdc:mga04h51_3431_c1 nmdc:mga04h51_3431_c1_2395_3126 218
21 3300050496 nmdc:mga07m45_2674_c1 nmdc:mga07m45_2674_c1_550_1281 218
22 3300046474 Ga0495605_0170147 Ga0495605_0170147_14_673 219
23 3300046515 Ga0495620_0053866 Ga0495620_0053866_18_677 219
24 3300050495 nmdc:mga04h51_230375_c1 nmdc:mga04h51_230375_c1_48_707 219
25 iso_pu_bacteria 2547132374 2548501881 219
26 iso_pu_bacteria 2643221717 2644647225 219
27 3300046530 Ga0495654_0000701 Ga0495654_0000701_18554_19216 220
28 3300049573 Ga0501037_0089342 Ga0501037_0089342_1054_1716 220
29 3300049823 Ga0501044_0483517 Ga0501044_0483517_17_679 220
30 3300053090 Ga0500646_0017115 Ga0500646_0017115_1077_1739 220
31 3300031548 Ga0307408_100017398 Ga0307408_1000173986 222
32 3300042116 Ga0450912_007165 Ga0450912_007165_20_700 222
33 3300049663 Ga0501223_004540 Ga0501223_004540_1634_2314 222
34 3300027876 Ga0209974_10071736 Ga0209974_100717361 223
35 3300006353 Ga0075370_10003799 Ga0075370_100037996 224
36 3300050493 nmdc:mga0k408_3012_c1 nmdc:mga0k408_3012_c1_4539_5252 224
37 3300050496 nmdc:mga07m45_39266_c1 nmdc:mga07m45_39266_c1_692_1405 224
38 3300050491 nmdc:mga00v17_10729_c1 nmdc:mga00v17_10729_c1_2649_3479 225
39 3300050496 nmdc:mga07m45_18013_c1 nmdc:mga07m45_18013_c1_2450_3127 225
40 3300005262 Ga0065165_1002060 Ga0065165_10020607 226
41 3300005543 Ga0070672_100024336 Ga0070672_1000243362 226
42 3300005548 Ga0070665_100542041 Ga0070665_1005420412 226
43 3300005577 Ga0068857_100024715 Ga0068857_1000247152 226
44 3300006177 Ga0075362_10048989 Ga0075362_100489892 226
45 3300006195 Ga0075366_10097926 Ga0075366_100979262 226
46 3300006195 Ga0075366_10135221 Ga0075366_101352212 226
47 3300006353 Ga0075370_10001988 Ga0075370_100019886 226
48 3300006353 Ga0075370_10009963 Ga0075370_100099636 226
49 3300006353 Ga0075370_10012166 Ga0075370_100121663 226
50 3300009148 Ga0105243_10186089 Ga0105243_101860893 226
51 3300013308 Ga0157375_10072844 Ga0157375_100728444 226
52 3300014745 Ga0157377_10046282 Ga0157377_100462823 226
53 3300025298 Ga0209050_1000222 Ga0209050_100022251 226
54 3300025907 Ga0207645_10001670 Ga0207645_1000167012 226
55 3300025907 Ga0207645_10117495 Ga0207645_101174952 226
56 3300025938 Ga0207704_10639424 Ga0207704_106394242 226
57 3300025940 Ga0207691_10020725 Ga0207691_100207253 226
58 3300026023 Ga0207677_10015871 Ga0207677_100158716 226
59 3300026089 Ga0207648_10014018 Ga0207648_1001401810 226
60 3300026089 Ga0207648_10016628 Ga0207648_1001662810 226
61 3300026116 Ga0207674_10099098 Ga0207674_100990983 226
62 3300027876 Ga0209974_10001536 Ga0209974_100015365 226
63 3300028786 Ga0307517_10175038 Ga0307517_101750382 226
64 3300028794 Ga0307515_10009530 Ga0307515_1000953010 226
65 3300031456 Ga0307513_10169196 Ga0307513_101691963 226
66 3300031649 Ga0307514_10003119 Ga0307514_100031196 226
67 3300031852 Ga0307410_10074880 Ga0307410_100748803 226
68 3300032005 Ga0307411_10029324 Ga0307411_100293244 226
69 3300036401 Ga0373937_0188493 Ga0373937_0188493_1239_1919 226
70 3300046519 Ga0495632_0016737 Ga0495632_0016737_1304_2023 226
71 3300046648 Ga0495611_0131417 Ga0495611_0131417_318_1040 226
72 3300046660 Ga0495625_0023246 Ga0495625_0023246_3894_4613 226
73 3300046810 Ga0495660_0109211 Ga0495660_0109211_305_1024 226
74 3300047443 Ga0495687_015945 Ga0495687_015945_2781_3500 226
75 3300047443 Ga0495687_078637 Ga0495687_078637_11_730 226
76 3300048909 Ga0496106_0004453 Ga0496106_0004453_1768_2448 226
77 3300050493 nmdc:mga0k408_113074_c1 nmdc:mga0k408_113074_c1_176_856 226
78 3300050493 nmdc:mga0k408_154654_c1 nmdc:mga0k408_154654_c1_615_1295 226
79 3300050493 nmdc:mga0k408_284186_c1 nmdc:mga0k408_284186_c1_201_893 226
80 3300050493 nmdc:mga0k408_34234_c1 nmdc:mga0k408_34234_c1_343_1023 226
81 3300050496 nmdc:mga07m45_3796_c1 nmdc:mga07m45_3796_c1_10_729 226
82 3300053086 Ga0500578_0000064 Ga0500578_0000064_754_1491 226
83 3300053093 Ga0500651_0146010 Ga0500651_0146010_620_1339 226
84 3300053134 Ga0500658_0003094 Ga0500658_0003094_1069_1788 226
85 3300053148 Ga0500590_002641 Ga0500590_002641_798_1478 226
86 3300053151 Ga0500604_0069334 Ga0500604_0069334_158_850 226
87 3300053156 Ga0500622_0027531 Ga0500622_0027531_2216_2908 226
88 iso_pu_bacteria 2585428058 2587732625 226
89 iso_pu_bacteria 2588253510 2588290220 226
90 iso_pu_bacteria 2643221592 2643967524 226
91 iso_pu_bacteria 2643221625 2644140347 226
92 iso_pu_bacteria 2643221648 2644271586 226
93 3300031548 Ga0307408_100001205 Ga0307408_1000012056 227
94 3300031901 Ga0307406_10001471 Ga0307406_100014716 227
95 3300032005 Ga0307411_10112145 Ga0307411_101121452 227
96 3300041413 Ga0439465_0155189 Ga0439465_0155189_111_794 227
97 3300041997 Ga0439431_0005131 Ga0439431_0005131_149_832 227
98 3300042126 Ga0450888_004519 Ga0450888_004519_200_883 227
99 3300042127 Ga0450890_017967 Ga0450890_017967_218_901 227
100 3300046453 Ga0495627_006366 Ga0495627_006366_1656_2339 227
101 3300046491 Ga0495584_0003613 Ga0495584_0003613_6538_7221 227
102 3300046492 Ga0495585_0040617 Ga0495585_0040617_1477_2160 227
103 3300046492 Ga0495585_0065827 Ga0495585_0065827_356_1039 227
104 3300046500 Ga0495596_0000218 Ga0495596_0000218_16640_17323 227
105 3300046501 Ga0495607_0058044 Ga0495607_0058044_245_928 227
106 3300046507 Ga0495606_0012694 Ga0495606_0012694_3278_3961 227
107 3300046513 Ga0495616_0032295 Ga0495616_0032295_849_1532 227
108 3300046518 Ga0495631_0018276 Ga0495631_0018276_411_1094 227
109 3300046518 Ga0495631_0063031 Ga0495631_0063031_742_1425 227
110 3300046519 Ga0495632_0010610 Ga0495632_0010610_2464_3147 227
111 3300046523 Ga0495644_0025639 Ga0495644_0025639_1045_1728 227
112 3300046523 Ga0495644_0066590 Ga0495644_0066590_53_736 227
113 3300046525 Ga0495663_0007662 Ga0495663_0007662_1533_2216 227
114 3300046538 Ga0495609_0013701 Ga0495609_0013701_98_781 227
115 3300046542 Ga0495597_0029583 Ga0495597_0029583_1171_1854 227
116 3300046558 Ga0495633_0082830 Ga0495633_0082830_232_915 227
117 3300046615 Ga0495656_0025390 Ga0495656_0025390_1622_2305 227
118 3300046615 Ga0495656_0100171 Ga0495656_0100171_88_771 227
119 3300046616 Ga0495668_0015163 Ga0495668_0015163_3502_4185 227
120 3300046660 Ga0495625_0030027 Ga0495625_0030027_3197_3880 227
121 3300046684 Ga0495669_0002982 Ga0495669_0002982_4432_5115 227
122 3300046691 Ga0495670_0010639 Ga0495670_0010639_2603_3286 227
123 3300046794 Ga0495589_0017974 Ga0495589_0017974_1998_2681 227
124 3300047445 Ga0495677_0048080 Ga0495677_0048080_702_1385 227
125 3300047472 Ga0495686_0186855 Ga0495686_0186855_244_927 227
126 3300028794 Ga0307515_10009883 Ga0307515_1000988317 228
127 3300031730 Ga0307516_10172836 Ga0307516_101728363 228
128 3300042435 Ga0439434_0083011 Ga0439434_0083011_165_968 228
129 3300044712 Ga0453684_0356330 Ga0453684_0356330_318_1004 228
130 3300046522 Ga0495643_0058242 Ga0495643_0058242_252_938 228
131 3300048091 Ga0495626_0014638 Ga0495626_0014638_610_1296 228
132 iso_pu_bacteria 2919450847 2919454608 228
133 iso_pu_bacteria 8001845381 8001849696 228
134 3300003322 rootL2_10017555 rootL2_100175556 229
135 3300005328 Ga0070676_10016550 Ga0070676_100165503 229
136 3300005331 Ga0070670_100168926 Ga0070670_1001689263 229
137 3300005333 Ga0070677_10023424 Ga0070677_100234242 229
138 3300005338 Ga0068868_100134113 Ga0068868_1001341131 229
139 3300005353 Ga0070669_100230080 Ga0070669_1002300802 229
140 3300005354 Ga0070675_100050812 Ga0070675_1000508122 229
141 3300005355 Ga0070671_100065665 Ga0070671_1000656654 229
142 3300005355 Ga0070671_100342322 Ga0070671_1003423222 229
143 3300005367 Ga0070667_100081716 Ga0070667_1000817162 229
144 3300005445 Ga0070708_100039179 Ga0070708_1000391795 229
145 3300005457 Ga0070662_100231593 Ga0070662_1002315931 229
146 3300005459 Ga0068867_100010107 Ga0068867_1000101072 229
147 3300005468 Ga0070707_100474918 Ga0070707_1004749181 229
148 3300005840 Ga0068870_10037829 Ga0068870_100378292 229
149 3300006195 Ga0075366_10108361 Ga0075366_101083611 229
150 3300006195 Ga0075366_10140483 Ga0075366_101404832 229
151 3300006353 Ga0075370_10241614 Ga0075370_102416142 229
152 3300006881 Ga0068865_100161273 Ga0068865_1001612732 229
153 3300009148 Ga0105243_10065575 Ga0105243_100655752 229
154 3300017792 Ga0163161_10032224 Ga0163161_100322243 229
155 3300025901 Ga0207688_10042995 Ga0207688_100429952 229
156 3300025907 Ga0207645_10018245 Ga0207645_100182452 229
157 3300025908 Ga0207643_10041914 Ga0207643_100419143 229
158 3300025910 Ga0207684_10076164 Ga0207684_100761643 229
159 3300025923 Ga0207681_10108924 Ga0207681_101089242 229
160 3300025925 Ga0207650_10228417 Ga0207650_102284171 229
161 3300025933 Ga0207706_10269318 Ga0207706_102693182 229
162 3300025935 Ga0207709_10339082 Ga0207709_103390821 229
163 3300025942 Ga0207689_10026606 Ga0207689_100266063 229
164 3300025981 Ga0207640_10435768 Ga0207640_104357682 229
165 3300026023 Ga0207677_10537566 Ga0207677_105375662 229
166 3300028786 Ga0307517_10136252 Ga0307517_101362523 229
167 3300028794 Ga0307515_10000037 Ga0307515_10000037209 229
168 3300028794 Ga0307515_10000123 Ga0307515_1000012312 229
169 3300028794 Ga0307515_10110774 Ga0307515_101107744 229
170 3300028794 Ga0307515_10210369 Ga0307515_102103692 229
171 3300028794 Ga0307515_10435249 Ga0307515_104352492 229
172 3300030522 Ga0307512_10043138 Ga0307512_100431383 229
173 3300031456 Ga0307513_10010549 Ga0307513_100105493 229
174 3300031507 Ga0307509_10068554 Ga0307509_100685543 229
175 3300031548 Ga0307408_100238481 Ga0307408_1002384812 229
176 3300031616 Ga0307508_10000134 Ga0307508_1000013438 229
177 3300031901 Ga0307406_10226501 Ga0307406_102265012 229
178 3300033179 Ga0307507_10052786 Ga0307507_100527862 229
179 3300033180 Ga0307510_10228588 Ga0307510_102285882 229
180 3300041496 Ga0451839_1587376 Ga0451839_1587376_23_718 229
181 3300046474 Ga0495605_0000595 Ga0495605_0000595_571_1278 229
182 3300046491 Ga0495584_0048555 Ga0495584_0048555_449_1156 229
183 3300046500 Ga0495596_0011805 Ga0495596_0011805_970_1677 229
184 3300046522 Ga0495643_0125416 Ga0495643_0125416_123_830 229
185 3300046542 Ga0495597_0004295 Ga0495597_0004295_486_1193 229
186 3300046616 Ga0495668_0026245 Ga0495668_0026245_2275_2982 229
187 3300046794 Ga0495589_0025353 Ga0495589_0025353_817_1524 229
188 3300047445 Ga0495677_0020919 Ga0495677_0020919_486_1193 229
189 3300047470 Ga0495681_0011313 Ga0495681_0011313_849_1556 229
190 3300050490 nmdc:mga03n38_50167_c1 nmdc:mga03n38_50167_c1_331_1116 229
191 3300050493 nmdc:mga0k408_36517_c1 nmdc:mga0k408_36517_c1_1789_2520 229
192 3300050493 nmdc:mga0k408_62632_c2 nmdc:mga0k408_62632_c2_61_798 229
193 3300050494 nmdc:mga06z11_17436_c1 nmdc:mga06z11_17436_c1_72_803 229
194 3300050496 nmdc:mga07m45_64512_c1 nmdc:mga07m45_64512_c1_315_1100 229
195 3300053088 Ga0500644_0005946 Ga0500644_0005946_106_837 229
196 3300053724 Ga0500570_078532 Ga0500570_078532_528_1259 229
197 3300053739 Ga0500587_008471 Ga0500587_008471_281_1081 229
198 3300003320 rootH2_10096707 rootH2_100967074 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

52

227

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.6829 9 192
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.6144 12 186
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5983 14 170
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.5934 12 186
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.5906 9 192
ID Description Score Start End Superfamily
af_P77409_60_261_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6857 8 193 1.20.950.20
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6827 9 192 1.20.950.20
af_P0AAM1_1_207_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6474 1 172 1.20.950.20
af_P77409_60_261_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6349 8 193 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6023 19 186 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A257C8D7-F1-model_v4 Cytochrome B 0.9873 2 230 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A372EDZ0-F1-model_v4 Cytochrome B 0.9796 9 230 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A4R3LKH8-F1-model_v4 Cytochrome b 0.9762 6 229 GO:0005506
GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A7U9FJC6-F1-model_v4 deleted 0.9744 4 230
AF-A0A2T7SWZ1-F1-model_v4 Cytochrome B 0.9717 1 227 GO:0005886
GO:0009055
GO:0020037
GO:0022904

Feature Viewer

pLDDT pTM Quality
88.65 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map