F304662

General Info

Members Datasets Scaffolds Average Seq Length
198 150 396 346

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100090660|Ga0307415_1000906602
Length 369
Sequence MTFRLEVDAERWRTHLDGVLAGTPGLVPVVKGNGYGFGRELLAREAHRLGVDTVAVGVRSEVPAVRAAHAGDVLVMEPLRPGEAAPDGGTATAQGADAGVIRTVARLDVLRQVAALRRPPRIVVELDSPVHRHGIGPQQLDALARALTRVAYEGVALHLPLRGPRLDWARTALNRLRTAGLEPPALWVSHLDGEELRRLAAEAAPIRVRPRVGTGLWLGDRGALRATGTVLDAHPVWRRDAVGYRQRRAGTSGTLLVVSGGTSHGVGLRSPATGRXXXARSRDLLGGLAHGSGATPSPFRWQGRRLRFADVPHMQASMLLVPRDVAPPAIGTALECDVRMTVTAFDEVRLGEPVPAHAVADEAAPSRWS

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
82 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
142 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
143 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
144 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
145 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
146 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
147 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
148 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
149 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
150 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 6.57
Nodule 0
Rhizoplane 12.63
Rhizosphere 75.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100090660 3300032126 Bacteria 2212
2 JGI24744J21845_10002279 3300002077 Bacteria 3909
3 Ga0070682_100022205 3300005337 Bacteria 3756
4 Ga0070660_100003746 3300005339 Bacteria 10507
5 Ga0070691_10011767 3300005341 Bacteria 4003
6 Ga0070692_10008017 3300005345 Bacteria 4688
7 Ga0070674_100009836 3300005356 Bacteria 5750
8 Ga0070688_100050804 3300005365 Bacteria 2584
9 Ga0070659_100002789 3300005366 Bacteria 12438
10 Ga0070659_100103719 3300005366 Bacteria 2291
11 Ga0070667_100016453 3300005367 Bacteria 6121
12 Ga0070701_10012172 3300005438 Bacteria 3871
13 Ga0070700_100023210 3300005441 Bacteria 3627
14 Ga0068867_100108914 3300005459 Bacteria 2125
15 Ga0070686_100058893 3300005544 Bacteria 2473
16 Ga0070704_100106674 3300005549 Bacteria 2123
17 Ga0068855_100508631 3300005563 Bacteria 1308
18 Ga0068857_100368168 3300005577 Bacteria 1333
19 Ga0070702_100054477 3300005615 Bacteria 2302
20 Ga0068852_100063259 3300005616 Bacteria 3222
21 Ga0068866_10016250 3300005718 Bacteria 3324
22 Ga0068861_100022168 3300005719 Bacteria 4572
23 Ga0068860_100000169 3300005843 Bacteria 107281
24 Ga0068862_100156149 3300005844 Bacteria 2034
25 Ga0081538_10003573 3300005981 Bacteria 14630
26 Ga0075365_10079390 3300006038 Bacteria 2221
27 Ga0075365_10141770 3300006038 Bacteria 1668
28 Ga0075363_100086677 3300006048 Bacteria 1719
29 Ga0075364_10008058 3300006051 Bacteria 6283
30 Ga0075364_10148955 3300006051 Bacteria 1577
31 Ga0075432_10001826 3300006058 Bacteria 7012
32 Ga0075367_10026112 3300006178 Bacteria 3309
33 Ga0075370_10019565 3300006353 Bacteria 3689
34 Ga0075370_10102526 3300006353 Bacteria 1657
35 Ga0068871_100309165 3300006358 Bacteria 1389
36 Ga0075428_100045208 3300006844 Bacteria 4839
37 Ga0075428_100228769 3300006844 Bacteria 2007
38 Ga0075433_10000405 3300006852 Bacteria 27519
39 Ga0075434_100000259 3300006871 Bacteria 37447
40 Ga0068865_100023507 3300006881 Bacteria 4036
41 Ga0075436_100003635 3300006914 Bacteria 10569
42 Ga0075435_100011764 3300007076 Bacteria 6457
43 Ga0111539_10001131 3300009094 Bacteria 35269
44 Ga0111539_10086114 3300009094 Bacteria 3693
45 Ga0111539_10327869 3300009094 Bacteria 1782
46 Ga0105245_10047293 3300009098 Bacteria 3846
47 Ga0105245_10312025 3300009098 Bacteria 1547
48 Ga0105243_10002070 3300009148 Bacteria 17014
49 Ga0105248_10026081 3300009177 Bacteria 6502
50 Ga0105239_10191203 3300010375 Bacteria 2291
51 Ga0163162_10210561 3300013306 Bacteria 2074
52 Ga0157372_10174399 3300013307 Bacteria 2489
53 Ga0157372_10227664 3300013307 Bacteria 2161
54 Ga0157375_10190000 3300013308 Bacteria 2208
55 Ga0157375_10622971 3300013308 Bacteria 1237
56 Ga0163163_10018082 3300014325 Bacteria 6587
57 Ga0207643_10005026 3300025908 Bacteria 7085
58 Ga0207657_10009058 3300025919 Bacteria 10051
59 Ga0207687_10042525 3300025927 Bacteria 3127
60 Ga0207687_10372368 3300025927 Bacteria 1168
61 Ga0207691_10057015 3300025940 Bacteria 3557
62 Ga0207711_10027883 3300025941 Bacteria 4747
63 Ga0207661_10137225 3300025944 Bacteria 2102
64 Ga0207661_10312063 3300025944 Bacteria 1412
65 Ga0207677_10231760 3300026023 Bacteria 1488
66 Ga0207677_10353651 3300026023 Bacteria 1232
67 Ga0207678_10161932 3300026067 Bacteria 1911
68 Ga0207708_10004620 3300026075 Bacteria 10134
69 Ga0207648_10062693 3300026089 Bacteria 3241
70 Ga0207675_100003976 3300026118 Bacteria 14338
71 Ga0207683_10172150 3300026121 Bacteria 1961
72 Ga0207698_10121801 3300026142 Bacteria 2209
73 Ga0207698_10125920 3300026142 Bacteria 2179
74 Ga0207428_10000697 3300027907 Bacteria 39092
75 Ga0268264_10000880 3300028381 Bacteria 31670
76 Ga0316182_1143420 3300030745 Bacteria 4958
77 Ga0307408_100060853 3300031548 Bacteria 2754
78 Ga0316579_10001841 3300031691 Bacteria 7844
79 Ga0307405_10007117 3300031731 Bacteria 5565
80 Ga0307413_10001521 3300031824 Bacteria 8889
81 Ga0307410_10000308 3300031852 Bacteria 19104
82 Ga0307410_10067555 3300031852 Bacteria 2466
83 Ga0307406_10000547 3300031901 Bacteria 21691
84 Ga0307406_10012207 3300031901 Bacteria 4894
85 Ga0307406_10043208 3300031901 Bacteria 2818
86 Ga0307412_10013857 3300031911 Bacteria 4740
87 Ga0307409_100083915 3300031995 Bacteria 2585
88 Ga0307416_100001427 3300032002 Bacteria 12984
89 Ga0307416_100028128 3300032002 Bacteria 4176
90 Ga0307416_100298218 3300032002 Bacteria 1600
91 Ga0307414_10004774 3300032004 Bacteria 7396
92 Ga0307414_10104187 3300032004 Bacteria 2142
93 Ga0307411_10002681 3300032005 Bacteria 7979
94 Ga0307411_10071349 3300032005 Bacteria 2354
95 Ga0307415_100005390 3300032126 Bacteria 6785
96 Ga0395899_0002003 3300037312 Bacteria 16776
97 Ga0395898_0137152 3300037466 Bacteria 2343
98 Ga0395901_0056954 3300038443 Bacteria 4066
99 Ga0439465_0017703 3300041413 Bacteria 2227
100 Ga0439465_0026711 3300041413 Bacteria 1827
101 Ga0451837_0313374 3300041494 Bacteria 8302
102 Ga0451839_0547630 3300041496 Bacteria 2263
103 Ga0451853_3859627 3300041512 Bacteria 4890
104 Ga0439445_0017570 3300042004 Bacteria 1769
105 Ga0439440_0003711 3300042993 Bacteria 2965
106 Ga0466969_0002452 3300044656 Bacteria 9893
107 Ga0466969_0018440 3300044656 Bacteria 3635
108 Ga0466963_0092626 3300044694 Bacteria 2059
109 Ga0466971_0003621 3300044719 Bacteria 6599
110 Ga0466970_0001442 3300044765 Bacteria 11509
111 Ga0466970_0070653 3300044765 Bacteria 1877
112 Ga0466960_0081346 3300044901 Bacteria 1633
113 Ga0466959_0023606 3300045049 Bacteria 4551
114 Ga0495592_0026917 3300046454 Bacteria 4359
115 Ga0495638_0073959 3300046460 Bacteria 2079
116 Ga0495651_0005250 3300046462 Bacteria 9874
117 Ga0495662_0000273 3300046476 Bacteria 22049
118 Ga0495664_0018113 3300046477 Bacteria 4028
119 Ga0495664_0119091 3300046477 Bacteria 1597
120 Ga0495608_0000947 3300046511 Bacteria 20421
121 Ga0495666_0000632 3300046526 Bacteria 15840
122 Ga0495652_0032071 3300046529 Bacteria 4596
123 Ga0495665_0005773 3300046531 Bacteria 6681
124 Ga0495586_0011010 3300046535 Bacteria 4807
125 Ga0495587_0266030 3300046536 Bacteria 962
126 Ga0495645_0076673 3300046543 Bacteria 2404
127 Ga0495667_0011300 3300046559 Bacteria 6042
128 Ga0495634_0028105 3300046642 Bacteria 3906
129 Ga0495635_0022981 3300046663 Bacteria 4346
130 Ga0495635_0087516 3300046663 Bacteria 2132
131 Ga0495588_0184207 3300046674 Bacteria 1103
132 Ga0495657_0001822 3300046675 Bacteria 18224
133 Ga0495623_0062031 3300046679 Bacteria 2343
134 Ga0495623_0157264 3300046679 Bacteria 1338
135 Ga0495646_0001610 3300046680 Bacteria 13428
136 Ga0495581_0002446 3300047315 Bacteria 10500
137 Ga0495604_0003204 3300047317 Bacteria 13077
138 Ga0495604_0007738 3300047317 Bacteria 8511
139 Ga0495675_0007261 3300047444 Bacteria 6825
140 Ga0495675_0008391 3300047444 Bacteria 6397
141 Ga0495675_0025099 3300047444 Bacteria 3801
142 Ga0495684_0065955 3300047471 Bacteria 2752
143 Ga0495593_0018746 3300047673 Bacteria 3886
144 Ga0495602_0032048 3300048088 Bacteria 4955
145 Ga0496100_0227037 3300048903 Bacteria 1372
146 Ga0496102_0008531 3300048905 Bacteria 8787
147 Ga0496104_0004155 3300048907 Bacteria 12566
148 Ga0496104_0306009 3300048907 Bacteria 1502
149 Ga0496105_0011803 3300048908 Bacteria 6918
150 Ga0496105_0044842 3300048908 Bacteria 3648
151 Ga0496106_0035151 3300048909 Bacteria 3746
152 Ga0496107_0024323 3300048910 Bacteria 4285
153 Ga0496107_0057979 3300048910 Bacteria 2799
154 Ga0496108_0014303 3300048911 Bacteria 6477
155 Ga0496108_0087834 3300048911 Bacteria 2641
156 Ga0496108_0093483 3300048911 Bacteria 2558
157 Ga0496108_0248211 3300048911 Bacteria 1548
158 Ga0496109_0012659 3300048912 Bacteria 7288
159 Ga0496109_0038592 3300048912 Bacteria 4318
160 Ga0496111_0126478 3300048914 Bacteria 1889
161 Ga0496114_0009792 3300048917 Bacteria 7614
162 Ga0496114_0013844 3300048917 Bacteria 6468
163 Ga0496114_0057825 3300048917 Bacteria 3238
164 Ga0496114_0065957 3300048917 Bacteria 3034
165 Ga0496114_0073395 3300048917 Bacteria 2879
166 Ga0496114_0091307 3300048917 Bacteria 2586
167 Ga0496115_0003831 3300048918 Bacteria 10839
168 Ga0496115_0022231 3300048918 Bacteria 4911
169 Ga0496115_0082647 3300048918 Bacteria 2617
170 Ga0501031_0201151 3300049568 Bacteria 1300
171 Ga0501040_0188534 3300049576 Bacteria 1463
172 Ga0501070_0014341 3300049586 Bacteria 6670
173 Ga0501072_0027016 3300049588 Bacteria 4479
174 Ga0501076_0248989 3300049592 Bacteria 1454
175 nmdc:mga00v17_28710_c1 3300050491 Bacteria 3260
176 nmdc:mga00v17_46501_c1 3300050491 Bacteria 2626
177 nmdc:mga0yw44_271851_c1 3300050492 Bacteria 1131
178 nmdc:mga06z11_26077_c1 3300050494 Bacteria 2778
179 nmdc:mga08y16_1339_c1 3300050511 Bacteria 24556
180 nmdc:mga08y16_194217_c1 3300050511 Bacteria 2105
181 nmdc:mga08y16_375656_c1 3300050511 Bacteria 1457
182 nmdc:mga0n895_8656_c1 3300050512 Bacteria 8834
183 nmdc:mga0rr50_34838_c1 3300050513 Bacteria 3609
184 nmdc:mga08x19_2691_c1 3300050514 Bacteria 10741
185 nmdc:mga0a205_702_c1 3300050515 Bacteria 26818
186 Ga0500616_0002424 3300053153 Bacteria 15525
187 Ga0501082_0178695 3300060353 Bacteria 1846
188 Ga0466962_0029776 3300061719 Bacteria 2613
189 2644018203 2643221601 Bacteria 7493239
190 2644174241 2643221631 Bacteria 8168043
191 2644455163 2643221681 Bacteria 3707866
192 2644539389 2643221697 Bacteria 3575694
193 2645721474 2643221961 Bacteria 3919167
194 2645724554 2643221962 Bacteria 3874254
195 2731906319 2731639228 Bacteria 4187555
196 2819741596 2818991472 Bacteria 10089953
197 2984592847 2984592036 Bacteria 3670284
198 2995468746 2995463766 Bacteria 8577691
199 Ga0307415_100090660
200 JGI24744J21845_10002279
201 Ga0070682_100022205
202 Ga0070660_100003746
203 Ga0070691_10011767
204 Ga0070692_10008017
205 Ga0070674_100009836
206 Ga0070688_100050804
207 Ga0070659_100002789
208 Ga0070659_100103719
209 Ga0070667_100016453
210 Ga0070701_10012172
211 Ga0070700_100023210
212 Ga0068867_100108914
213 Ga0070686_100058893
214 Ga0070704_100106674
215 Ga0068855_100508631
216 Ga0068857_100368168
217 Ga0070702_100054477
218 Ga0068852_100063259
219 Ga0068866_10016250
220 Ga0068861_100022168
221 Ga0068860_100000169
222 Ga0068862_100156149
223 Ga0081538_10003573
224 Ga0075365_10079390
225 Ga0075365_10141770
226 Ga0075363_100086677
227 Ga0075364_10008058
228 Ga0075364_10148955
229 Ga0075432_10001826
230 Ga0075367_10026112
231 Ga0075370_10019565
232 Ga0075370_10102526
233 Ga0068871_100309165
234 Ga0075428_100045208
235 Ga0075428_100228769
236 Ga0075433_10000405
237 Ga0075434_100000259
238 Ga0068865_100023507
239 Ga0075436_100003635
240 Ga0075435_100011764
241 Ga0111539_10001131
242 Ga0111539_10086114
243 Ga0111539_10327869
244 Ga0105245_10047293
245 Ga0105245_10312025
246 Ga0105243_10002070
247 Ga0105248_10026081
248 Ga0105239_10191203
249 Ga0163162_10210561
250 Ga0157372_10174399
251 Ga0157372_10227664
252 Ga0157375_10190000
253 Ga0157375_10622971
254 Ga0163163_10018082
255 Ga0207643_10005026
256 Ga0207657_10009058
257 Ga0207687_10042525
258 Ga0207687_10372368
259 Ga0207691_10057015
260 Ga0207711_10027883
261 Ga0207661_10137225
262 Ga0207661_10312063
263 Ga0207677_10231760
264 Ga0207677_10353651
265 Ga0207678_10161932
266 Ga0207708_10004620
267 Ga0207648_10062693
268 Ga0207675_100003976
269 Ga0207683_10172150
270 Ga0207698_10121801
271 Ga0207698_10125920
272 Ga0207428_10000697
273 Ga0268264_10000880
274 Ga0316182_1143420
275 Ga0307408_100060853
276 Ga0316579_10001841
277 Ga0307405_10007117
278 Ga0307413_10001521
279 Ga0307410_10000308
280 Ga0307410_10067555
281 Ga0307406_10000547
282 Ga0307406_10012207
283 Ga0307406_10043208
284 Ga0307412_10013857
285 Ga0307409_100083915
286 Ga0307416_100001427
287 Ga0307416_100028128
288 Ga0307416_100298218
289 Ga0307414_10004774
290 Ga0307414_10104187
291 Ga0307411_10002681
292 Ga0307411_10071349
293 Ga0307415_100005390
294 Ga0395899_0002003
295 Ga0395898_0137152
296 Ga0395901_0056954
297 Ga0439465_0017703
298 Ga0439465_0026711
299 Ga0451837_0313374
300 Ga0451839_0547630
301 Ga0451853_3859627
302 Ga0439445_0017570
303 Ga0439440_0003711
304 Ga0466969_0002452
305 Ga0466969_0018440
306 Ga0466963_0092626
307 Ga0466971_0003621
308 Ga0466970_0001442
309 Ga0466970_0070653
310 Ga0466960_0081346
311 Ga0466959_0023606
312 Ga0495592_0026917
313 Ga0495638_0073959
314 Ga0495651_0005250
315 Ga0495662_0000273
316 Ga0495664_0018113
317 Ga0495664_0119091
318 Ga0495608_0000947
319 Ga0495666_0000632
320 Ga0495652_0032071
321 Ga0495665_0005773
322 Ga0495586_0011010
323 Ga0495587_0266030
324 Ga0495645_0076673
325 Ga0495667_0011300
326 Ga0495634_0028105
327 Ga0495635_0022981
328 Ga0495635_0087516
329 Ga0495588_0184207
330 Ga0495657_0001822
331 Ga0495623_0062031
332 Ga0495623_0157264
333 Ga0495646_0001610
334 Ga0495581_0002446
335 Ga0495604_0003204
336 Ga0495604_0007738
337 Ga0495675_0007261
338 Ga0495675_0008391
339 Ga0495675_0025099
340 Ga0495684_0065955
341 Ga0495593_0018746
342 Ga0495602_0032048
343 Ga0496100_0227037
344 Ga0496102_0008531
345 Ga0496104_0004155
346 Ga0496104_0306009
347 Ga0496105_0011803
348 Ga0496105_0044842
349 Ga0496106_0035151
350 Ga0496107_0024323
351 Ga0496107_0057979
352 Ga0496108_0014303
353 Ga0496108_0087834
354 Ga0496108_0093483
355 Ga0496108_0248211
356 Ga0496109_0012659
357 Ga0496109_0038592
358 Ga0496111_0126478
359 Ga0496114_0009792
360 Ga0496114_0013844
361 Ga0496114_0057825
362 Ga0496114_0065957
363 Ga0496114_0073395
364 Ga0496114_0091307
365 Ga0496115_0003831
366 Ga0496115_0022231
367 Ga0496115_0082647
368 Ga0501031_0201151
369 Ga0501040_0188534
370 Ga0501070_0014341
371 Ga0501072_0027016
372 Ga0501076_0248989
373 nmdc:mga00v17_28710_c1
374 nmdc:mga00v17_46501_c1
375 nmdc:mga0yw44_271851_c1
376 nmdc:mga06z11_26077_c1
377 nmdc:mga08y16_1339_c1
378 nmdc:mga08y16_194217_c1
379 nmdc:mga08y16_375656_c1
380 nmdc:mga0n895_8656_c1
381 nmdc:mga0rr50_34838_c1
382 nmdc:mga08x19_2691_c1
383 nmdc:mga0a205_702_c1
384 Ga0500616_0002424
385 Ga0501082_0178695
386 Ga0466962_0029776
387 2644018203
388 2644174241
389 2644455163
390 2644539389
391 2645721474
392 2645724554
393 2731906319
394 2819741596
395 2984592847
396 2995468746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

7

191

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ils-assembly2.cif.gz_C crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7918 5 334
4ils-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7624 5 339
4ils-assembly2.cif.gz_B crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7599 5 339
3kio-assembly1.cif.gz_A mouse rnase h2 complex 0.7573 154 205
4beq-assembly1.cif.gz_A-2 structure of vibrio cholerae broad spectrum racemase double mutant r173a, n174a 0.7537 5 346
ID Description Score Start End Superfamily
4y2wB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8295 10 206 3.20.20.10
1xfcA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8144 10 205 3.20.20.10
af_C6KT75_7_189_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8101 160 205 3.30.420.10
5yycC02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.7993 11 206 3.20.20.10
4ilsB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.7958 10 208 3.20.20.10
ID Description Score Start End GO Terms
AF-E2S8N1-F1-model_v4 Alanine racemase domain protein 0.9522 1 346 GO:0003824
AF-E2S8N1-F1-model_v4 Alanine racemase domain protein 0.9494 1 346 GO:0003824
AF-A0A1T4YZC2-F1-model_v4 Alanine racemase 0.9471 1 346 GO:0005829
GO:0008784
GO:0030170
AF-F5XGM1-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9463 2 346 GO:0005829
GO:0008784
GO:0030170
AF-A0A838GMK0-F1-model_v4 Alanine racemase 0.945 1 346

Map