F304648

General Info

Members Datasets Scaffolds Average Seq Length
198 134 396 149

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10558639|Ga0307406_105586392
Length 162
Sequence LFSTFRFPLSISVMRAVIQRVSRANVTVDGGMTGKIGRGVLVLLGVSKKDSEKEALYVLEKTLNLRIFEDPEGKMNLSLLDIKGELLVVSQFTLYGDARKGRRPSFIDAAAPDEANCLYEFFVAAARRQISKVGTGRFQAMMDVELVNDGPVTILLDSDKIF

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
129 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 19.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10558639 3300031901 Bacteria 938
2 LJQas_1000153 3300000549 Bacteria 12218
3 JGI24751J29686_10044753 3300002459 Bacteria 915
4 rootL2_10146030 3300003322 Bacteria 2646
5 Ga0065704_10120680 3300005289 Bacteria 1778
6 Ga0065707_10154154 3300005295 Bacteria 1605
7 Ga0070690_100092233 3300005330 Bacteria 1997
8 Ga0070670_100199664 3300005331 Bacteria 1737
9 Ga0070666_10034621 3300005335 Unclassified 3347
10 Ga0068868_100102380 3300005338 Bacteria 2319
11 Ga0070661_100211839 3300005344 Bacteria 1484
12 Ga0070675_100161381 3300005354 Bacteria 1928
13 Ga0070671_100027097 3300005355 Bacteria 4715
14 Ga0070671_100355466 3300005355 Bacteria 1251
15 Ga0070671_100471035 3300005355 Bacteria 1079
16 Ga0070688_100033575 3300005365 Bacteria 3103
17 Ga0070659_100014073 3300005366 Bacteria 5970
18 Ga0070663_100116749 3300005455 Bacteria 2012
19 Ga0070681_10107158 3300005458 Bacteria 2735
20 Ga0068867_100838742 3300005459 Bacteria 823
21 Ga0070685_10555771 3300005466 Unclassified 820
22 Ga0070698_100309644 3300005471 Bacteria 1510
23 Ga0068853_101208324 3300005539 Unclassified 730
24 Ga0070672_100088834 3300005543 Bacteria 2489
25 Ga0070672_100913111 3300005543 Bacteria 776
26 Ga0070686_100158490 3300005544 Bacteria 1592
27 Ga0068855_100038697 3300005563 Bacteria 5666
28 Ga0070664_100016197 3300005564 Bacteria 6110
29 Ga0070664_100450733 3300005564 Bacteria 1181
30 Ga0068857_100072209 3300005577 Bacteria 3076
31 Ga0068854_100144669 3300005578 Bacteria 1828
32 Ga0068856_101196010 3300005614 Bacteria 776
33 Ga0068852_100182675 3300005616 Bacteria 1973
34 Ga0068859_100092493 3300005617 Bacteria 3076
35 Ga0068859_100119888 3300005617 Bacteria 2697
36 Ga0068864_100081420 3300005618 Bacteria 2838
37 Ga0068864_100172932 3300005618 Bacteria 1970
38 Ga0068861_100380702 3300005719 Bacteria 1247
39 Ga0068851_10104462 3300005834 Bacteria 1506
40 Ga0068863_100011474 3300005841 Bacteria 8568
41 Ga0068863_101727085 3300005841 Unclassified 635
42 Ga0068858_100518782 3300005842 Bacteria 1152
43 Ga0068858_101769367 3300005842 Unclassified 610
44 Ga0068860_100204092 3300005843 Bacteria 1916
45 Ga0068860_100237851 3300005843 Bacteria 1771
46 Ga0068862_100828373 3300005844 Bacteria 905
47 Ga0081539_10129528 3300005985 Unclassified 1241
48 Ga0097621_100937981 3300006237 Unclassified 807
49 Ga0097621_100937984 3300006237 Unclassified 807
50 Ga0075434_100359645 3300006871 Bacteria 1477
51 Ga0097620_100092488 3300006931 Bacteria 3076
52 Ga0097620_100119893 3300006931 Bacteria 2697
53 Ga0105251_10083244 3300009011 Unclassified 1477
54 Ga0105247_10037198 3300009101 Bacteria 2970
55 Ga0105247_10359622 3300009101 Bacteria 1026
56 Ga0105242_10069249 3300009176 Bacteria 2922
57 Ga0105249_10021786 3300009553 Bacteria 5739
58 Ga0105239_10007172 3300010375 Bacteria 12819
59 Ga0105239_11540457 3300010375 Bacteria 768
60 Ga0157373_10113957 3300013100 Bacteria 1900
61 Ga0157371_10417509 3300013102 Bacteria 983
62 Ga0157370_10250580 3300013104 Bacteria 1638
63 Ga0157369_10198670 3300013105 Bacteria 2105
64 Ga0157374_10154223 3300013296 Bacteria 2234
65 Ga0163162_10259134 3300013306 Bacteria 1871
66 Ga0163162_10380514 3300013306 Bacteria 1545
67 Ga0163162_10853048 3300013306 Bacteria 1026
68 Ga0157372_11093795 3300013307 Unclassified 922
69 Ga0157375_10012281 3300013308 Bacteria 7595
70 Ga0157375_10101513 3300013308 Bacteria 2960
71 Ga0157375_10962019 3300013308 Bacteria 995
72 Ga0163163_10025526 3300014325 Bacteria 5634
73 Ga0163163_10075392 3300014325 Bacteria 3367
74 Ga0163163_10530639 3300014325 Bacteria 1239
75 Ga0157377_10108091 3300014745 Bacteria 1668
76 Ga0157379_11605182 3300014968 Unclassified 635
77 Ga0157376_11065200 3300014969 Unclassified 833
78 Ga0157376_12799451 3300014969 Unclassified 528
79 Ga0163161_10171712 3300017792 Bacteria 1658
80 Ga0213876_10164277 3300021384 Bacteria 1181
81 Ga0213875_10066464 3300021388 Unclassified 1685
82 Ga0207656_10008798 3300025321 Bacteria 3733
83 Ga0207710_10474270 3300025900 Unclassified 648
84 Ga0207680_10106675 3300025903 Bacteria 1809
85 Ga0207647_10534045 3300025904 Bacteria 652
86 Ga0207707_10151305 3300025912 Bacteria 2029
87 Ga0207662_10376334 3300025918 Unclassified 958
88 Ga0207662_11272391 3300025918 Unclassified 523
89 Ga0207650_10005574 3300025925 Bacteria 8596
90 Ga0207650_10101491 3300025925 Bacteria 2215
91 Ga0207650_10465709 3300025925 Unclassified 1053
92 Ga0207659_10256557 3300025926 Unclassified 1421
93 Ga0207659_10260503 3300025926 Bacteria 1410
94 Ga0207644_10226604 3300025931 Bacteria 1484
95 Ga0207644_10281900 3300025931 Bacteria 1334
96 Ga0207644_10540007 3300025931 Unclassified 964
97 Ga0207690_10051442 3300025932 Bacteria 2755
98 Ga0207706_10036213 3300025933 Bacteria 4384
99 Ga0207706_10037150 3300025933 Bacteria 4325
100 Ga0207686_11078407 3300025934 Unclassified 654
101 Ga0207670_10023212 3300025936 Bacteria 3858
102 Ga0207670_10515196 3300025936 Unclassified 973
103 Ga0207691_10095191 3300025940 Bacteria 2664
104 Ga0207711_10205246 3300025941 Bacteria 1799
105 Ga0207667_10272092 3300025949 Bacteria 1731
106 Ga0207651_10060894 3300025960 Bacteria 2623
107 Ga0207712_10175018 3300025961 Bacteria 1681
108 Ga0207640_10006517 3300025981 Bacteria 6408
109 Ga0207658_10474842 3300025986 Bacteria 1110
110 Ga0207658_11196312 3300025986 Unclassified 695
111 Ga0207677_10063278 3300026023 Bacteria 2571
112 Ga0207703_10059240 3300026035 Unclassified 3127
113 Ga0207703_10345405 3300026035 Bacteria 1369
114 Ga0207639_10695437 3300026041 Bacteria 943
115 Ga0207639_12052589 3300026041 Unclassified 533
116 Ga0207702_11190483 3300026078 Bacteria 756
117 Ga0207641_10051600 3300026088 Bacteria 3483
118 Ga0207641_10306856 3300026088 Bacteria 1501
119 Ga0207648_10680285 3300026089 Bacteria 952
120 Ga0207676_10051407 3300026095 Bacteria 3217
121 Ga0207674_10204592 3300026116 Bacteria 1923
122 Ga0207698_10537545 3300026142 Bacteria 1143
123 Ga0268264_10286964 3300028381 Bacteria 1544
124 Ga0268264_11124369 3300028381 Bacteria 794
125 Ga0307408_100036230 3300031548 Bacteria 3467
126 Ga0307405_10288304 3300031731 Bacteria 1239
127 Ga0307413_10011029 3300031824 Bacteria 4419
128 Ga0307413_10018834 3300031824 Bacteria 3632
129 Ga0307410_10002379 3300031852 Bacteria 9069
130 Ga0307410_10014405 3300031852 Bacteria 4651
131 Ga0307410_10105603 3300031852 Bacteria 2028
132 Ga0307410_10169696 3300031852 Bacteria 1643
133 Ga0307406_10004723 3300031901 Bacteria 7422
134 Ga0307407_10004705 3300031903 Bacteria 5832
135 Ga0307407_10013977 3300031903 Bacteria 3915
136 Ga0307407_10067250 3300031903 Unclassified 2117
137 Ga0307412_10024821 3300031911 Bacteria 3705
138 Ga0307412_10059441 3300031911 Bacteria 2562
139 Ga0307412_10450708 3300031911 Bacteria 1060
140 Ga0307409_100002183 3300031995 Bacteria 10099
141 Ga0307409_100014324 3300031995 Bacteria 5151
142 Ga0307409_100410057 3300031995 Bacteria 1297
143 Ga0307409_101355788 3300031995 Bacteria 737
144 Ga0307416_100138851 3300032002 Bacteria 2205
145 Ga0307416_102796946 3300032002 Bacteria 584
146 Ga0307414_10015413 3300032004 Bacteria 4612
147 Ga0307414_10085430 3300032004 Bacteria 2325
148 Ga0307411_10023528 3300032005 Bacteria 3651
149 Ga0307411_10431730 3300032005 Bacteria 1097
150 Ga0307415_100056017 3300032126 Bacteria 2701
151 Ga0373936_0188545 3300035113 Unclassified 907
152 Ga0373943_0686725 3300035170 Bacteria 606
153 Ga0373943_0842858 3300035170 Unclassified 546
154 Ga0373955_0056757 3300035172 Unclassified 2149
155 Ga0373937_0134601 3300036401 Bacteria 2310
156 Ga0395900_0676125 3300037418 Unclassified 967
157 Ga0395898_0472913 3300037466 Unclassified 1193
158 Ga0395905_0001915 3300037471 Bacteria 23895
159 Ga0395905_0002833 3300037471 Bacteria 18986
160 Ga0395905_0010606 3300037471 Bacteria 8944
161 Ga0395905_0395028 3300037471 Bacteria 1277
162 Ga0395905_0719016 3300037471 Unclassified 901
163 Ga0436364_1356593 3300037853 Bacteria 7116
164 Ga0395901_0858519 3300038443 Unclassified 892
165 Ga0395901_0994025 3300038443 Unclassified 815
166 Ga0400483_010343 3300039062 Unclassified 3500
167 Ga0400483_251337 3300039062 Unclassified 3263
168 Ga0400489_80384 3300039093 Bacteria 17796
169 Ga0451791_1722463 3300041451 Bacteria 647
170 Ga0451843_0572904 3300041509 Bacteria 749
171 Ga0453683_0006768 3300044673 Bacteria 7832
172 Ga0453684_0005013 3300044712 Bacteria 26895
173 Ga0453684_0013975 3300044712 Bacteria 12934
174 Ga0453684_0031514 3300044712 Bacteria 7448
175 Ga0453684_0060598 3300044712 Bacteria 4864
176 Ga0453684_0064075 3300044712 Bacteria 4697
177 Ga0453684_0119227 3300044712 Bacteria 3189
178 Ga0453684_0545104 3300044712 Bacteria 1278
179 Ga0453684_0777425 3300044712 Bacteria 1034
180 Ga0453684_1549587 3300044712 Bacteria 682
181 Ga0451576_0008385 3300045051 Bacteria 12135
182 Ga0451576_0144942 3300045051 Bacteria 2476
183 Ga0495592_0183014 3300046454 Bacteria 1426
184 Ga0495628_0027498 3300046516 Bacteria 4628
185 Ga0495630_0060822 3300046517 Bacteria 2836
186 Ga0495640_0142758 3300046533 Unclassified 1543
187 Ga0495586_0101625 3300046535 Unclassified 1596
188 Ga0495668_0013091 3300046616 Bacteria 4907
189 Ga0495634_0458326 3300046642 Bacteria 751
190 Ga0496104_0272342 3300048907 Bacteria 1606
191 Ga0496108_0128800 3300048911 Bacteria 2175
192 Ga0501235_098242 3300049669 Bacteria 713
193 Ga0501239_000811 3300049672 Bacteria 2524
194 Ga0501249_003159 3300049679 Bacteria 3313
195 Ga0501272_000228 3300049769 Bacteria 4678
196 nmdc:mga0n895_401911_c1 3300050512 Bacteria 1385
197 nmdc:mga0a205_776889_c1 3300050515 Bacteria 806
198 Ga0501084_1065371 3300054114 Bacteria 679
199 Ga0307406_10558639
200 LJQas_1000153
201 JGI24751J29686_10044753
202 rootL2_10146030
203 Ga0065704_10120680
204 Ga0065707_10154154
205 Ga0070690_100092233
206 Ga0070670_100199664
207 Ga0070666_10034621
208 Ga0068868_100102380
209 Ga0070661_100211839
210 Ga0070675_100161381
211 Ga0070671_100027097
212 Ga0070671_100355466
213 Ga0070671_100471035
214 Ga0070688_100033575
215 Ga0070659_100014073
216 Ga0070663_100116749
217 Ga0070681_10107158
218 Ga0068867_100838742
219 Ga0070685_10555771
220 Ga0070698_100309644
221 Ga0068853_101208324
222 Ga0070672_100088834
223 Ga0070672_100913111
224 Ga0070686_100158490
225 Ga0068855_100038697
226 Ga0070664_100016197
227 Ga0070664_100450733
228 Ga0068857_100072209
229 Ga0068854_100144669
230 Ga0068856_101196010
231 Ga0068852_100182675
232 Ga0068859_100092493
233 Ga0068859_100119888
234 Ga0068864_100081420
235 Ga0068864_100172932
236 Ga0068861_100380702
237 Ga0068851_10104462
238 Ga0068863_100011474
239 Ga0068863_101727085
240 Ga0068858_100518782
241 Ga0068858_101769367
242 Ga0068860_100204092
243 Ga0068860_100237851
244 Ga0068862_100828373
245 Ga0081539_10129528
246 Ga0097621_100937981
247 Ga0097621_100937984
248 Ga0075434_100359645
249 Ga0097620_100092488
250 Ga0097620_100119893
251 Ga0105251_10083244
252 Ga0105247_10037198
253 Ga0105247_10359622
254 Ga0105242_10069249
255 Ga0105249_10021786
256 Ga0105239_10007172
257 Ga0105239_11540457
258 Ga0157373_10113957
259 Ga0157371_10417509
260 Ga0157370_10250580
261 Ga0157369_10198670
262 Ga0157374_10154223
263 Ga0163162_10259134
264 Ga0163162_10380514
265 Ga0163162_10853048
266 Ga0157372_11093795
267 Ga0157375_10012281
268 Ga0157375_10101513
269 Ga0157375_10962019
270 Ga0163163_10025526
271 Ga0163163_10075392
272 Ga0163163_10530639
273 Ga0157377_10108091
274 Ga0157379_11605182
275 Ga0157376_11065200
276 Ga0157376_12799451
277 Ga0163161_10171712
278 Ga0213876_10164277
279 Ga0213875_10066464
280 Ga0207656_10008798
281 Ga0207710_10474270
282 Ga0207680_10106675
283 Ga0207647_10534045
284 Ga0207707_10151305
285 Ga0207662_10376334
286 Ga0207662_11272391
287 Ga0207650_10005574
288 Ga0207650_10101491
289 Ga0207650_10465709
290 Ga0207659_10256557
291 Ga0207659_10260503
292 Ga0207644_10226604
293 Ga0207644_10281900
294 Ga0207644_10540007
295 Ga0207690_10051442
296 Ga0207706_10036213
297 Ga0207706_10037150
298 Ga0207686_11078407
299 Ga0207670_10023212
300 Ga0207670_10515196
301 Ga0207691_10095191
302 Ga0207711_10205246
303 Ga0207667_10272092
304 Ga0207651_10060894
305 Ga0207712_10175018
306 Ga0207640_10006517
307 Ga0207658_10474842
308 Ga0207658_11196312
309 Ga0207677_10063278
310 Ga0207703_10059240
311 Ga0207703_10345405
312 Ga0207639_10695437
313 Ga0207639_12052589
314 Ga0207702_11190483
315 Ga0207641_10051600
316 Ga0207641_10306856
317 Ga0207648_10680285
318 Ga0207676_10051407
319 Ga0207674_10204592
320 Ga0207698_10537545
321 Ga0268264_10286964
322 Ga0268264_11124369
323 Ga0307408_100036230
324 Ga0307405_10288304
325 Ga0307413_10011029
326 Ga0307413_10018834
327 Ga0307410_10002379
328 Ga0307410_10014405
329 Ga0307410_10105603
330 Ga0307410_10169696
331 Ga0307406_10004723
332 Ga0307407_10004705
333 Ga0307407_10013977
334 Ga0307407_10067250
335 Ga0307412_10024821
336 Ga0307412_10059441
337 Ga0307412_10450708
338 Ga0307409_100002183
339 Ga0307409_100014324
340 Ga0307409_100410057
341 Ga0307409_101355788
342 Ga0307416_100138851
343 Ga0307416_102796946
344 Ga0307414_10015413
345 Ga0307414_10085430
346 Ga0307411_10023528
347 Ga0307411_10431730
348 Ga0307415_100056017
349 Ga0373936_0188545
350 Ga0373943_0686725
351 Ga0373943_0842858
352 Ga0373955_0056757
353 Ga0373937_0134601
354 Ga0395900_0676125
355 Ga0395898_0472913
356 Ga0395905_0001915
357 Ga0395905_0002833
358 Ga0395905_0010606
359 Ga0395905_0395028
360 Ga0395905_0719016
361 Ga0436364_1356593
362 Ga0395901_0858519
363 Ga0395901_0994025
364 Ga0400483_010343
365 Ga0400483_251337
366 Ga0400489_80384
367 Ga0451791_1722463
368 Ga0451843_0572904
369 Ga0453683_0006768
370 Ga0453684_0005013
371 Ga0453684_0013975
372 Ga0453684_0031514
373 Ga0453684_0060598
374 Ga0453684_0064075
375 Ga0453684_0119227
376 Ga0453684_0545104
377 Ga0453684_0777425
378 Ga0453684_1549587
379 Ga0451576_0008385
380 Ga0451576_0144942
381 Ga0495592_0183014
382 Ga0495628_0027498
383 Ga0495630_0060822
384 Ga0495640_0142758
385 Ga0495586_0101625
386 Ga0495668_0013091
387 Ga0495634_0458326
388 Ga0496104_0272342
389 Ga0496108_0128800
390 Ga0501235_098242
391 Ga0501239_000811
392 Ga0501249_003159
393 Ga0501272_000228
394 nmdc:mga0n895_401911_c1
395 nmdc:mga0a205_776889_c1
396 Ga0501084_1065371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

15

157

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9793 1 145
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9739 1 144
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9692 1 143
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.9692 1 144
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9678 1 145
ID Description Score Start End Superfamily
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9855 1 147 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9816 1 144 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9793 1 145 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9739 1 144 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9674 1 144 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A3C0CN39-F1-model_v4 deleted 0.9949 1 127
AF-A0A6L5F498-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.994 1 144 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-E5VMG1-F1-model_v4 D-Tyr-tRNA(Tyr) deacylase 0.9938 30 144 GO:0005737
GO:0051500
AF-A0A5N9EII5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9935 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1V5CNN3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.993 2 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map