F304598

General Info

Members Datasets Scaffolds Average Seq Length
198 163 396 148

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10054871|Ga0265324_100548713
Length 172
Sequence MNQNSYKCQFRRARLLTFVIVPKLFSENIMKIAIGSDHAGFNYKEQIKQLLTQLGHEVRDFGTFAAEPPVDYPVYVRPAADAVSKGIAERAIVLGGSGNGEAMVANRLKGVRCALCWNEETARLGRQHNDANVISLGARMITAEMALRIVRIWLDTPFEGGRHERRIKMIDT

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
90 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 2.02
Rhizosphere 93.43
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10054871 3300029957 Bacteria 1366
2 rootL2_10017135 3300003322 Bacteria 2594
3 rootH1_10340694 3300003323 Bacteria 1325
4 Ga0065704_10304317 3300005289 Bacteria 879
5 Ga0065707_10208196 3300005295 Unclassified 1269
6 Ga0070658_10021129 3300005327 Bacteria 5214
7 Ga0070676_10425035 3300005328 Bacteria 929
8 Ga0070683_100031035 3300005329 Bacteria 4856
9 Ga0070690_100509916 3300005330 Bacteria 901
10 Ga0070670_100020832 3300005331 Bacteria 5638
11 Ga0068869_101688150 3300005334 Bacteria 565
12 Ga0070660_100318420 3300005339 Bacteria 1277
13 Ga0070689_100100884 3300005340 Bacteria 2284
14 Ga0070689_100636901 3300005340 Unclassified 926
15 Ga0070669_100951791 3300005353 Unclassified 735
16 Ga0070688_101331859 3300005365 Bacteria 580
17 Ga0070714_100003078 3300005435 Bacteria 12373
18 Ga0070713_100487154 3300005436 Bacteria 1162
19 Ga0070710_10123126 3300005437 Bacteria 1572
20 Ga0070705_100043225 3300005440 Unclassified 2581
21 Ga0070681_10586117 3300005458 Bacteria 1029
22 Ga0070681_10951497 3300005458 Unclassified 778
23 Ga0070685_10020497 3300005466 Unclassified 3577
24 Ga0070706_100000218 3300005467 Bacteria 70622
25 Ga0070707_100000140 3300005468 Bacteria 68016
26 Ga0070707_100000260 3300005468 Bacteria 52836
27 Ga0070698_100061912 3300005471 Bacteria 3776
28 Ga0070698_100064817 3300005471 Bacteria 3680
29 Ga0070699_100204865 3300005518 Bacteria 1755
30 Ga0070699_100593343 3300005518 Unclassified 1010
31 Ga0070679_100032630 3300005530 Bacteria 5153
32 Ga0070679_100848046 3300005530 Bacteria 857
33 Ga0070684_100076204 3300005535 Bacteria 2960
34 Ga0070697_100175738 3300005536 Bacteria 1814
35 Ga0068853_100527042 3300005539 Bacteria 1117
36 Ga0070686_100949760 3300005544 Bacteria 702
37 Ga0070665_100000426 3300005548 Bacteria 61588
38 Ga0070704_100004894 3300005549 Bacteria 7772
39 Ga0070704_100010791 3300005549 Bacteria 5571
40 Ga0068855_100433788 3300005563 Bacteria 1436
41 Ga0068859_100000015 3300005617 Bacteria 271458
42 Ga0068859_101061838 3300005617 Unclassified 890
43 Ga0068866_10171414 3300005718 Bacteria 1274
44 Ga0070712_100544808 3300006175 Bacteria 977
45 Ga0075367_10362956 3300006178 Bacteria 914
46 Ga0068871_100917653 3300006358 Unclassified 812
47 Ga0075434_100663956 3300006871 Bacteria 1061
48 Ga0075436_100000171 3300006914 Bacteria 40817
49 Ga0097620_100000015 3300006931 Bacteria 271458
50 Ga0097620_101061981 3300006931 Unclassified 890
51 Ga0075435_100331838 3300007076 Bacteria 1303
52 Ga0105240_10402195 3300009093 Bacteria 1542
53 Ga0111539_10687641 3300009094 Unclassified 1191
54 Ga0114129_10008597 3300009147 Bacteria 14561
55 Ga0105243_10006090 3300009148 Bacteria 9326
56 Ga0105243_11773447 3300009148 Bacteria 648
57 Ga0105242_10026145 3300009176 Bacteria 4625
58 Ga0105248_10071734 3300009177 Bacteria 3891
59 Ga0105237_11122100 3300009545 Unclassified 793
60 Ga0105237_11809031 3300009545 Bacteria 618
61 Ga0105238_10003386 3300009551 Bacteria 15918
62 Ga0105249_10295348 3300009553 Bacteria 1623
63 Ga0105249_10520192 3300009553 Bacteria 1237
64 Ga0157371_10220662 3300013102 Bacteria 1362
65 Ga0157371_10326178 3300013102 Bacteria 1115
66 Ga0157370_10502803 3300013104 Bacteria 1113
67 Ga0157374_10045464 3300013296 Bacteria 4064
68 Ga0157374_11389462 3300013296 Bacteria 725
69 Ga0157374_11764412 3300013296 Bacteria 644
70 Ga0157372_10203604 3300013307 Bacteria 2293
71 Ga0157372_10442221 3300013307 Bacteria 1515
72 Ga0157372_10717548 3300013307 Bacteria 1163
73 Ga0157377_10812180 3300014745 Bacteria 691
74 Ga0213876_10004800 3300021384 Bacteria 7501
75 Ga0207692_10097727 3300025898 Bacteria 1606
76 Ga0207642_11037613 3300025899 Bacteria 529
77 Ga0207705_10030642 3300025909 Bacteria 3838
78 Ga0207684_10000292 3300025910 Bacteria 71954
79 Ga0207707_10127451 3300025912 Bacteria 2226
80 Ga0207707_10658146 3300025912 Bacteria 882
81 Ga0207671_10401037 3300025914 Unclassified 1091
82 Ga0207652_10362249 3300025921 Bacteria 1309
83 Ga0207652_10653900 3300025921 Unclassified 940
84 Ga0207646_10000867 3300025922 Bacteria 39113
85 Ga0207646_10000920 3300025922 Bacteria 37949
86 Ga0207646_11665047 3300025922 Bacteria 549
87 Ga0207681_10063504 3300025923 Bacteria 2547
88 Ga0207694_10009072 3300025924 Bacteria 7505
89 Ga0207664_10020839 3300025929 Bacteria 4864
90 Ga0207686_10162450 3300025934 Bacteria 1567
91 Ga0207709_10008153 3300025935 Bacteria 5801
92 Ga0207670_10396441 3300025936 Unclassified 1103
93 Ga0207670_11084820 3300025936 Unclassified 675
94 Ga0207704_10186276 3300025938 Bacteria 1505
95 Ga0207711_10058077 3300025941 Bacteria 3328
96 Ga0207661_10023564 3300025944 Bacteria 4653
97 Ga0207667_10349471 3300025949 Bacteria 1508
98 Ga0207712_10135659 3300025961 Bacteria 1881
99 Ga0207674_10541201 3300026116 Bacteria 1125
100 Ga0268266_10003871 3300028379 Bacteria 14593
101 Ga0268264_10000747 3300028381 Bacteria 36690
102 Ga0265338_10011215 3300028800 Bacteria 10385
103 Ga0265338_10031551 3300028800 Bacteria 5192
104 Ga0265338_10218428 3300028800 Bacteria 1425
105 Ga0265320_10050834 3300031240 Bacteria 2013
106 Ga0265320_10079928 3300031240 Bacteria 1528
107 Ga0265325_10040385 3300031241 Bacteria 2450
108 Ga0265340_10000438 3300031247 Bacteria 22415
109 Ga0265339_10013479 3300031249 Bacteria 4951
110 Ga0265316_10050009 3300031344 Bacteria 3290
111 Ga0265314_10110364 3300031711 Bacteria 1749
112 Ga0316576_10436291 3300031727 Bacteria 968
113 Ga0307411_10595093 3300032005 Bacteria 950
114 Ga0316583_10072939 3300032133 Bacteria 1201
115 Ga0373928_0117032 3300035084 Bacteria 711
116 Ga0373943_0317966 3300035170 Bacteria 887
117 Ga0316574_0096387 3300035398 Bacteria 1890
118 Ga0373931_0919211 3300035691 Bacteria 589
119 Ga0373933_0810407 3300035724 Bacteria 616
120 Ga0373947_0066340 3300035725 Bacteria 2203
121 Ga0373937_0114106 3300036401 Bacteria 2515
122 Ga0316584_0179657 3300036712 Bacteria 1567
123 Ga0316584_0304417 3300036712 Bacteria 1153
124 Ga0316584_0668676 3300036712 Bacteria 714
125 Ga0373925_0769082 3300037068 Unclassified 794
126 Ga0395899_0069551 3300037312 Bacteria 2578
127 Ga0395900_0089048 3300037418 Bacteria 3173
128 Ga0395898_0098673 3300037466 Bacteria 2805
129 Ga0395905_0114946 3300037471 Unclassified 2529
130 Ga0395901_0125793 3300038443 Unclassified 2694
131 Ga0436365_0267419 3300039437 Bacteria 28037
132 Ga0451797_1459810 3300041453 Bacteria 713
133 Ga0451802_1073110 3300041460 Bacteria 788
134 Ga0451853_3131094 3300041512 Bacteria 1187
135 Ga0453683_0266572 3300044673 Bacteria 1093
136 Ga0453684_0016193 3300044712 Bacteria 11685
137 Ga0453684_0419443 3300044712 Bacteria 1495
138 Ga0451576_0111528 3300045051 Unclassified 2847
139 Ga0451576_0794563 3300045051 Bacteria 994
140 Ga0451576_1479057 3300045051 Bacteria 706
141 Ga0495603_0003221 3300046455 Bacteria 9720
142 Ga0495638_0013438 3300046460 Bacteria 5574
143 Ga0495580_0065724 3300046472 Bacteria 2540
144 Ga0495582_0009988 3300046473 Bacteria 5224
145 Ga0495582_0116249 3300046473 Bacteria 1504
146 Ga0495662_0065667 3300046476 Unclassified 1754
147 Ga0495584_0009259 3300046491 Bacteria 5078
148 Ga0495585_0042677 3300046492 Bacteria 2539
149 Ga0495596_0108502 3300046500 Bacteria 1078
150 Ga0495583_0236074 3300046506 Bacteria 736
151 Ga0495618_0099145 3300046514 Bacteria 1864
152 Ga0495630_0000065 3300046517 Bacteria 85152
153 Ga0495644_0003699 3300046523 Bacteria 6017
154 Ga0495663_0003727 3300046525 Bacteria 4355
155 Ga0495666_0000894 3300046526 Bacteria 13969
156 Ga0495640_0031594 3300046533 Bacteria 3777
157 Ga0495586_0000012 3300046535 Bacteria 138093
158 Ga0495609_0032855 3300046538 Bacteria 2356
159 Ga0495621_0068215 3300046539 Bacteria 1305
160 Ga0495633_0072812 3300046558 Bacteria 1602
161 Ga0495656_0000563 3300046615 Bacteria 12126
162 Ga0495634_0009642 3300046642 Bacteria 7112
163 Ga0495659_0080364 3300046664 Bacteria 1236
164 Ga0495647_0237000 3300046681 Bacteria 809
165 Ga0495658_0067961 3300046683 Bacteria 2062
166 Ga0495658_0996723 3300046683 Bacteria 535
167 Ga0495670_0012293 3300046691 Bacteria 4207
168 Ga0495671_0352238 3300046692 Bacteria 706
169 Ga0495589_0105036 3300046794 Bacteria 1365
170 Ga0495636_0031693 3300047318 Bacteria 2168
171 Ga0495674_0003001 3300047319 Bacteria 16443
172 Ga0495672_0346513 3300047320 Bacteria 691
173 Ga0495676_0009916 3300047321 Bacteria 8651
174 Ga0495680_0901341 3300047322 Unclassified 571
175 Ga0495683_0096432 3300047323 Bacteria 1427
176 Ga0495685_052906 3300047447 Bacteria 1375
177 Ga0495684_0637008 3300047471 Unclassified 715
178 Ga0495615_0012533 3300048090 Bacteria 1750
179 Ga0496109_1463965 3300048912 Bacteria 618
180 Ga0496115_0044407 3300048918 Bacteria 3544
181 Ga0501067_0079299 3300049583 Bacteria 1819
182 Ga0501068_0006392 3300049584 Bacteria 6493
183 Ga0501068_0501714 3300049584 Bacteria 787
184 Ga0501075_0001239 3300049591 Bacteria 16557
185 Ga0501077_0000044 3300049593 Bacteria 63393
186 Ga0501080_0002093 3300049742 Bacteria 17322
187 Ga0501081_1074738 3300049743 Bacteria 609
188 nmdc:mga06z11_89650_c1 3300050494 Bacteria 1667
189 nmdc:mga04h51_321697_c1 3300050495 Bacteria 634
190 nmdc:mga05p37_36059_c1 3300050507 Bacteria 6068
191 nmdc:mga08y16_2028723_c1 3300050511 Unclassified 524
192 nmdc:mga08y16_482639_c1 3300050511 Unclassified 1261
193 nmdc:mga0n895_381465_c1 3300050512 Bacteria 1426
194 nmdc:mga0rr50_459222_c1 3300050513 Bacteria 1080
195 nmdc:mga08x19_350341_c1 3300050514 Bacteria 1031
196 nmdc:mga08x19_49_c1 3300050514 Bacteria 134655
197 Ga0500595_130114 3300053119 Unclassified 709
198 Ga0501082_0000043 3300060353 Bacteria 89262
199 Ga0265324_10054871
200 rootL2_10017135
201 rootH1_10340694
202 Ga0065704_10304317
203 Ga0065707_10208196
204 Ga0070658_10021129
205 Ga0070676_10425035
206 Ga0070683_100031035
207 Ga0070690_100509916
208 Ga0070670_100020832
209 Ga0068869_101688150
210 Ga0070660_100318420
211 Ga0070689_100100884
212 Ga0070689_100636901
213 Ga0070669_100951791
214 Ga0070688_101331859
215 Ga0070714_100003078
216 Ga0070713_100487154
217 Ga0070710_10123126
218 Ga0070705_100043225
219 Ga0070681_10586117
220 Ga0070681_10951497
221 Ga0070685_10020497
222 Ga0070706_100000218
223 Ga0070707_100000140
224 Ga0070707_100000260
225 Ga0070698_100061912
226 Ga0070698_100064817
227 Ga0070699_100204865
228 Ga0070699_100593343
229 Ga0070679_100032630
230 Ga0070679_100848046
231 Ga0070684_100076204
232 Ga0070697_100175738
233 Ga0068853_100527042
234 Ga0070686_100949760
235 Ga0070665_100000426
236 Ga0070704_100004894
237 Ga0070704_100010791
238 Ga0068855_100433788
239 Ga0068859_100000015
240 Ga0068859_101061838
241 Ga0068866_10171414
242 Ga0070712_100544808
243 Ga0075367_10362956
244 Ga0068871_100917653
245 Ga0075434_100663956
246 Ga0075436_100000171
247 Ga0097620_100000015
248 Ga0097620_101061981
249 Ga0075435_100331838
250 Ga0105240_10402195
251 Ga0111539_10687641
252 Ga0114129_10008597
253 Ga0105243_10006090
254 Ga0105243_11773447
255 Ga0105242_10026145
256 Ga0105248_10071734
257 Ga0105237_11122100
258 Ga0105237_11809031
259 Ga0105238_10003386
260 Ga0105249_10295348
261 Ga0105249_10520192
262 Ga0157371_10220662
263 Ga0157371_10326178
264 Ga0157370_10502803
265 Ga0157374_10045464
266 Ga0157374_11389462
267 Ga0157374_11764412
268 Ga0157372_10203604
269 Ga0157372_10442221
270 Ga0157372_10717548
271 Ga0157377_10812180
272 Ga0213876_10004800
273 Ga0207692_10097727
274 Ga0207642_11037613
275 Ga0207705_10030642
276 Ga0207684_10000292
277 Ga0207707_10127451
278 Ga0207707_10658146
279 Ga0207671_10401037
280 Ga0207652_10362249
281 Ga0207652_10653900
282 Ga0207646_10000867
283 Ga0207646_10000920
284 Ga0207646_11665047
285 Ga0207681_10063504
286 Ga0207694_10009072
287 Ga0207664_10020839
288 Ga0207686_10162450
289 Ga0207709_10008153
290 Ga0207670_10396441
291 Ga0207670_11084820
292 Ga0207704_10186276
293 Ga0207711_10058077
294 Ga0207661_10023564
295 Ga0207667_10349471
296 Ga0207712_10135659
297 Ga0207674_10541201
298 Ga0268266_10003871
299 Ga0268264_10000747
300 Ga0265338_10011215
301 Ga0265338_10031551
302 Ga0265338_10218428
303 Ga0265320_10050834
304 Ga0265320_10079928
305 Ga0265325_10040385
306 Ga0265340_10000438
307 Ga0265339_10013479
308 Ga0265316_10050009
309 Ga0265314_10110364
310 Ga0316576_10436291
311 Ga0307411_10595093
312 Ga0316583_10072939
313 Ga0373928_0117032
314 Ga0373943_0317966
315 Ga0316574_0096387
316 Ga0373931_0919211
317 Ga0373933_0810407
318 Ga0373947_0066340
319 Ga0373937_0114106
320 Ga0316584_0179657
321 Ga0316584_0304417
322 Ga0316584_0668676
323 Ga0373925_0769082
324 Ga0395899_0069551
325 Ga0395900_0089048
326 Ga0395898_0098673
327 Ga0395905_0114946
328 Ga0395901_0125793
329 Ga0436365_0267419
330 Ga0451797_1459810
331 Ga0451802_1073110
332 Ga0451853_3131094
333 Ga0453683_0266572
334 Ga0453684_0016193
335 Ga0453684_0419443
336 Ga0451576_0111528
337 Ga0451576_0794563
338 Ga0451576_1479057
339 Ga0495603_0003221
340 Ga0495638_0013438
341 Ga0495580_0065724
342 Ga0495582_0009988
343 Ga0495582_0116249
344 Ga0495662_0065667
345 Ga0495584_0009259
346 Ga0495585_0042677
347 Ga0495596_0108502
348 Ga0495583_0236074
349 Ga0495618_0099145
350 Ga0495630_0000065
351 Ga0495644_0003699
352 Ga0495663_0003727
353 Ga0495666_0000894
354 Ga0495640_0031594
355 Ga0495586_0000012
356 Ga0495609_0032855
357 Ga0495621_0068215
358 Ga0495633_0072812
359 Ga0495656_0000563
360 Ga0495634_0009642
361 Ga0495659_0080364
362 Ga0495647_0237000
363 Ga0495658_0067961
364 Ga0495658_0996723
365 Ga0495670_0012293
366 Ga0495671_0352238
367 Ga0495589_0105036
368 Ga0495636_0031693
369 Ga0495674_0003001
370 Ga0495672_0346513
371 Ga0495676_0009916
372 Ga0495680_0901341
373 Ga0495683_0096432
374 Ga0495685_052906
375 Ga0495684_0637008
376 Ga0495615_0012533
377 Ga0496109_1463965
378 Ga0496115_0044407
379 Ga0501067_0079299
380 Ga0501068_0006392
381 Ga0501068_0501714
382 Ga0501075_0001239
383 Ga0501077_0000044
384 Ga0501080_0002093
385 Ga0501081_1074738
386 nmdc:mga06z11_89650_c1
387 nmdc:mga04h51_321697_c1
388 nmdc:mga05p37_36059_c1
389 nmdc:mga08y16_2028723_c1
390 nmdc:mga08y16_482639_c1
391 nmdc:mga0n895_381465_c1
392 nmdc:mga0rr50_459222_c1
393 nmdc:mga08x19_350341_c1
394 nmdc:mga08x19_49_c1
395 Ga0500595_130114
396 Ga0501082_0000043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

32

170

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9894 1 141
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9819 2 141
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9812 2 141
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9731 2 141
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9702 2 141
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.981 2 141 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9697 2 141 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9668 1 145 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9654 1 141 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9631 2 141 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2V6JTY0-F1-model_v4 Ribose-5-phosphate isomerase 1.003 1 125 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6B4V8-F1-model_v4 Ribose-5-phosphate isomerase 1.003 1 117 GO:0004751
GO:0009052
GO:0019316
AF-A0A6L7Y9Y9-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 1.003 26 141 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6HBS0-F1-model_v4 Ribose 5-phosphate isomerase B 1.002 1 141 GO:0004751
GO:0009052
GO:0019316
AF-A0A1I3THX0-F1-model_v4 Ribose 5-phosphate isomerase B 1.002 1 141 GO:0004751
GO:0009052
GO:0019316

Map