F304280

General Info

Members Datasets Scaffolds Average Seq Length
198 76 197 139

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100456230|Ga0075431_1004562302
Length 160
Sequence MDRKASGHSWRSVTQRSREFTVTDSNRVYKRSFTIPTDAIDENGHANNVAYVQWMQDIAVEHYASIGGIEAQGKDATWVIREHKIEYFLPAFAGEEIEIKTWVENIRRVRSLRKYEFVRRSDGRVLVRGETDWVFVDAKTGKPLPIPEEVSKVFTISREA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
62 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
63 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
64 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
67 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
68 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
69 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
70 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
71 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
72 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
73 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
74 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
75 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
76 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1071245 2162886006 Bacteria 2199
2 Ga0065704_10070442 3300005289 Bacteria 24654
3 Ga0065704_10081207 3300005289 Unclassified 3802
4 Ga0065704_10175504 3300005289 Unclassified 1266
5 Ga0065704_10424649 3300005289 Bacteria 729
6 Ga0065707_10000435 3300005295 Bacteria 91033
7 Ga0065707_10083667 3300005295 Bacteria 8499
8 Ga0065707_10101297 3300005295 Bacteria 2872
9 Ga0065707_10126871 3300005295 Unclassified 1995
10 Ga0065707_10131304 3300005295 Bacteria 1915
11 Ga0065707_10227422 3300005295 Unclassified 1201
12 Ga0065707_10459798 3300005295 Unclassified 792
13 Ga0065707_10527817 3300005295 Unclassified 679
14 Ga0065707_10672063 3300005295 Bacteria 653
15 Ga0070680_100136722 3300005336 Bacteria 2053
16 Ga0070689_100065071 3300005340 Bacteria 2838
17 Ga0070669_101951287 3300005353 Bacteria 513
18 Ga0070705_100529798 3300005440 Unclassified 899
19 Ga0070700_100117858 3300005441 Bacteria 1775
20 Ga0070694_100251971 3300005444 Bacteria 1336
21 Ga0070694_100522060 3300005444 Bacteria 947
22 Ga0070694_101945421 3300005444 Unclassified 502
23 Ga0070706_100077645 3300005467 Unclassified 3073
24 Ga0070706_100260751 3300005467 Bacteria 1618
25 Ga0070707_101100981 3300005468 Bacteria 760
26 Ga0070698_100025169 3300005471 Bacteria 6202
27 Ga0070699_100005190 3300005518 Bacteria 11456
28 Ga0070699_100111635 3300005518 Unclassified 2401
29 Ga0070695_100300978 3300005545 Bacteria 1185
30 Ga0070695_100690567 3300005545 Bacteria 809
31 Ga0070704_100118981 3300005549 Bacteria 2025
32 Ga0068859_100165591 3300005617 Bacteria 2291
33 Ga0068859_100504549 3300005617 Bacteria 1305
34 Ga0068859_101643898 3300005617 Bacteria 709
35 Ga0068864_100265876 3300005618 Bacteria 1597
36 Ga0068861_100798698 3300005719 Bacteria 885
37 Ga0068863_100441628 3300005841 Bacteria 1276
38 Ga0068862_100362860 3300005844 Bacteria 1347
39 Ga0068862_100838379 3300005844 Unclassified 900
40 Ga0075428_100003712 3300006844 Bacteria 16726
41 Ga0075428_100031827 3300006844 Bacteria 5827
42 Ga0075428_100073882 3300006844 Bacteria 3724
43 Ga0075430_100015972 3300006846 Bacteria 6393
44 Ga0075430_100180371 3300006846 Bacteria 1756
45 Ga0075430_100348358 3300006846 Bacteria 1223
46 Ga0075431_100046594 3300006847 Unclassified 4471
47 Ga0075431_100456230 3300006847 Unclassified 1273
48 Ga0075431_101894780 3300006847 Unclassified 552
49 Ga0075433_10208174 3300006852 Bacteria 1739
50 Ga0075433_10362345 3300006852 Unclassified 1281
51 Ga0075433_10508601 3300006852 Bacteria 1060
52 Ga0075434_100619468 3300006871 Bacteria 1101
53 Ga0075429_100006339 3300006880 Bacteria 10239
54 Ga0075429_100008377 3300006880 Bacteria 9000
55 Ga0075429_100016500 3300006880 Bacteria 6399
56 Ga0075429_100101825 3300006880 Unclassified 2507
57 Ga0075429_100266391 3300006880 Bacteria 1500
58 Ga0075429_100302559 3300006880 Bacteria 1400
59 Ga0097620_100165597 3300006931 Bacteria 2291
60 Ga0097620_100504583 3300006931 Bacteria 1305
61 Ga0097620_101644326 3300006931 Bacteria 709
62 Ga0111539_10135924 3300009094 Unclassified 2879
63 Ga0105245_12278285 3300009098 Unclassified 595
64 Ga0114129_10002433 3300009147 Bacteria 25829
65 Ga0114129_10006929 3300009147 Bacteria 16121
66 Ga0114129_10065775 3300009147 Bacteria 5059
67 Ga0114129_10086539 3300009147 Bacteria 4346
68 Ga0114129_10091789 3300009147 Unclassified 4207
69 Ga0114129_10233408 3300009147 Bacteria 2477
70 Ga0114129_10317843 3300009147 Bacteria 2070
71 Ga0114129_10326212 3300009147 Bacteria 2040
72 Ga0114129_10431612 3300009147 Bacteria 1731
73 Ga0114129_10798707 3300009147 Bacteria 1204
74 Ga0114129_11112569 3300009147 Bacteria 988
75 Ga0114129_11474963 3300009147 Unclassified 837
76 Ga0114129_11775980 3300009147 Bacteria 751
77 Ga0105249_10021508 3300009553 Bacteria 5774
78 Ga0105249_10313530 3300009553 Bacteria 1578
79 Ga0105246_10097375 3300011119 Bacteria 2134
80 Ga0105246_11443664 3300011119 Bacteria 644
81 Ga0105246_11710415 3300011119 Bacteria 598
82 Ga0163163_11179122 3300014325 Unclassified 829
83 Ga0157380_10205450 3300014326 Unclassified 1751
84 Ga0157380_12259118 3300014326 Bacteria 608
85 Ga0207684_10118916 3300025910 Bacteria 2265
86 Ga0207646_11238948 3300025922 Unclassified 653
87 Ga0207681_10233580 3300025923 Unclassified 1428
88 Ga0207670_10097330 3300025936 Bacteria 2094
89 Ga0207712_11504446 3300025961 Bacteria 603
90 Ga0207708_10239675 3300026075 Bacteria 1459
91 Ga0207676_11217476 3300026095 Bacteria 746
92 Ga0209966_1007407 3300027695 Bacteria 1923
93 Ga0268265_10575858 3300028380 Bacteria 1072
94 Ga0265337_1000648 3300028556 Bacteria 18351
95 Ga0265337_1019766 3300028556 Bacteria 2118
96 Ga0265337_1124173 3300028556 Unclassified 700
97 Ga0265318_10073606 3300028577 Bacteria 1265
98 Ga0265323_10050516 3300028653 Unclassified 1478
99 Ga0265338_10104924 3300028800 Bacteria 2292
100 Ga0316577_10091498 3300031733 Bacteria 1703
101 Ga0307410_10330676 3300031852 Unclassified 1212
102 Ga0307412_11136170 3300031911 Unclassified 697
103 Ga0307416_102485338 3300032002 Unclassified 617
104 Ga0307416_102532733 3300032002 Unclassified 611
105 Ga0307416_102558674 3300032002 Unclassified 608
106 Ga0307415_100682264 3300032126 Unclassified 925
107 Ga0307415_100712808 3300032126 Bacteria 907
108 Ga0373932_0350572 3300035112 Bacteria 561
109 Ga0373961_0034746 3300035241 Bacteria 1427
110 Ga0373931_0767729 3300035691 Bacteria 641
111 Ga0451807_1178370 3300041486 Bacteria 1729
112 Ga0451577_0001965 3300042876 Bacteria 25856
113 Ga0451577_0021878 3300042876 Bacteria 5846
114 Ga0451577_0031471 3300042876 Bacteria 4787
115 Ga0451577_0115701 3300042876 Bacteria 2401
116 Ga0451577_0117631 3300042876 Bacteria 2381
117 Ga0451577_0119093 3300042876 Bacteria 2365
118 Ga0451577_0227352 3300042876 Bacteria 1687
119 Ga0451577_0294362 3300042876 Bacteria 1471
120 Ga0451577_0316372 3300042876 Bacteria 1415
121 Ga0451577_0367571 3300042876 Unclassified 1305
122 Ga0451577_0431755 3300042876 Unclassified 1196
123 Ga0453683_0000634 3300044673 Bacteria 38191
124 Ga0453683_0026795 3300044673 Bacteria 3659
125 Ga0453683_0042401 3300044673 Bacteria 2857
126 Ga0453683_0088006 3300044673 Bacteria 1947
127 Ga0453683_0335986 3300044673 Unclassified 969
128 Ga0453683_0862721 3300044673 Unclassified 597
129 Ga0453684_0000044 3300044712 Bacteria 585643
130 Ga0453684_0000802 3300044712 Bacteria 107142
131 Ga0453684_0010133 3300044712 Bacteria 16185
132 Ga0453684_0015699 3300044712 Bacteria 11933
133 Ga0453684_0018151 3300044712 Bacteria 10829
134 Ga0453684_0024404 3300044712 Bacteria 8840
135 Ga0453684_0039368 3300044712 Bacteria 6443
136 Ga0453684_0092031 3300044712 Unclassified 3740
137 Ga0453684_0106858 3300044712 Bacteria 3409
138 Ga0453684_0110970 3300044712 Bacteria 3332
139 Ga0453684_0124243 3300044712 Bacteria 3109
140 Ga0453684_0146186 3300044712 Bacteria 2815
141 Ga0453684_0154382 3300044712 Bacteria 2724
142 Ga0453684_0157635 3300044712 Bacteria 2689
143 Ga0453684_0185583 3300044712 Unclassified 2438
144 Ga0453684_0216511 3300044712 Bacteria 2221
145 Ga0453684_0281020 3300044712 Unclassified 1898
146 Ga0453684_0345317 3300044712 Bacteria 1679
147 Ga0453684_0458003 3300044712 Unclassified 1419
148 Ga0453684_0462023 3300044712 Bacteria 1411
149 Ga0453684_0478481 3300044712 Bacteria 1382
150 Ga0453684_0508614 3300044712 Bacteria 1332
151 Ga0453684_0575622 3300044712 Unclassified 1237
152 Ga0453684_0618550 3300044712 Unclassified 1185
153 Ga0453684_0816752 3300044712 Bacteria 1004
154 Ga0453684_1398295 3300044712 Bacteria 726
155 Ga0451576_0016517 3300045051 Bacteria 8142
156 Ga0451576_0051582 3300045051 Unclassified 4313
157 Ga0451576_0062842 3300045051 Bacteria 3870
158 Ga0451576_0260727 3300045051 Unclassified 1812
159 Ga0451576_0424074 3300045051 Bacteria 1396
160 Ga0451576_0450887 3300045051 Unclassified 1350
161 Ga0451576_0456891 3300045051 Bacteria 1341
162 Ga0451576_0523696 3300045051 Bacteria 1246
163 Ga0451576_0624622 3300045051 Bacteria 1132
164 Ga0451576_1263578 3300045051 Bacteria 770
165 Ga0451576_2090051 3300045051 Unclassified 583
166 Ga0495622_0176756 3300046557 Bacteria 958
167 Ga0495615_0272706 3300048090 Unclassified 541
168 Ga0496108_0557031 3300048911 Unclassified 1000
169 Ga0501299_205441 3300049522 Unclassified 525
170 Ga0501040_0907307 3300049576 Unclassified 638
171 Ga0501074_0963810 3300049590 Bacteria 600
172 Ga0501075_0338927 3300049591 Bacteria 1146
173 Ga0501076_0104098 3300049592 Bacteria 2290
174 Ga0501076_0362807 3300049592 Unclassified 1190
175 nmdc:mga05p37_1446129_c1 3300050507 Unclassified 689
176 nmdc:mga05p37_270314_c1 3300050507 Bacteria 2031
177 nmdc:mga05p37_3062_c1 3300050507 Bacteria 19415
178 nmdc:mga05p37_350067_c1 3300050507 Bacteria 1740
179 nmdc:mga05p37_492022_c1 3300050507 Bacteria 1410
180 nmdc:mga05p37_50680_c1 3300050507 Bacteria 5106
181 nmdc:mga09592_152935_c1 3300050508 Unclassified 1991
182 nmdc:mga09592_171714_c1 3300050508 Bacteria 1875
183 nmdc:mga09592_2454_c1 3300050508 Bacteria 14962
184 nmdc:mga09592_31554_c1 3300050508 Bacteria 4415
185 nmdc:mga09592_375981_c1 3300050508 Bacteria 1229
186 nmdc:mga09592_420820_c1 3300050508 Unclassified 1154
187 nmdc:mga09592_986855_c1 3300050508 Bacteria 705
188 nmdc:mga0qj67_123104_c1 3300050509 Bacteria 2098
189 nmdc:mga0qj67_286538_c1 3300050509 Bacteria 1335
190 nmdc:mga06r32_528132_c1 3300050510 Bacteria 1155
191 nmdc:mga08y16_194632_c1 3300050511 Unclassified 2102
192 nmdc:mga0n895_175223_c1 3300050512 Bacteria 2175
193 nmdc:mga0a205_257509_c1 3300050515 Viruses 1623
194 nmdc:mga0a205_339259_c1 3300050515 Unclassified 1371
195 nmdc:mga0a205_481802_c1 3300050515 Bacteria 1099
196 Ga0501082_0726902 3300060353 Bacteria 869
197 Ga0501082_1630561 3300060353 Unclassified 563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0176756 Ga0495622_0176756_523_936 112
2 3300042876 Ga0451577_0001965 Ga0451577_0001965_7641_8042 133
3 3300042876 Ga0451577_0117631 Ga0451577_0117631_1264_1665 133
4 3300042876 Ga0451577_0119093 Ga0451577_0119093_190_591 133
5 3300044712 Ga0453684_0010133 Ga0453684_0010133_11005_11406 133
6 3300044712 Ga0453684_0015699 Ga0453684_0015699_4890_5291 133
7 3300044712 Ga0453684_0092031 Ga0453684_0092031_1610_2011 133
8 3300044712 Ga0453684_0157635 Ga0453684_0157635_1251_1652 133
9 3300044712 Ga0453684_0816752 Ga0453684_0816752_245_646 133
10 3300005844 Ga0068862_100838379 Ga0068862_1008383791 134
11 3300009147 Ga0114129_10431612 Ga0114129_104316122 134
12 3300042876 Ga0451577_0021878 Ga0451577_0021878_3383_3787 134
13 3300042876 Ga0451577_0316372 Ga0451577_0316372_730_1134 134
14 3300044712 Ga0453684_0039368 Ga0453684_0039368_4644_5048 134
15 3300044712 Ga0453684_0106858 Ga0453684_0106858_1288_1692 134
16 3300045051 Ga0451576_0456891 Ga0451576_0456891_235_642 134
17 3300050507 nmdc:mga05p37_492022_c1 nmdc:mga05p37_492022_c1_813_1238 134
18 3300005289 Ga0065704_10175504 Ga0065704_101755042 135
19 3300005295 Ga0065707_10131304 Ga0065707_101313041 135
20 3300005468 Ga0070707_101100981 Ga0070707_1011009812 135
21 3300005617 Ga0068859_100504549 Ga0068859_1005045492 135
22 3300006844 Ga0075428_100031827 Ga0075428_1000318274 135
23 3300006846 Ga0075430_100180371 Ga0075430_1001803712 135
24 3300006847 Ga0075431_101894780 Ga0075431_1018947801 135
25 3300006880 Ga0075429_100016500 Ga0075429_1000165004 135
26 3300006880 Ga0075429_100266391 Ga0075429_1002663911 135
27 3300006931 Ga0097620_100504583 Ga0097620_1005045832 135
28 3300009098 Ga0105245_12278285 Ga0105245_122782851 135
29 3300009147 Ga0114129_10002433 Ga0114129_100024334 135
30 3300009147 Ga0114129_10065775 Ga0114129_100657755 135
31 3300009147 Ga0114129_10086539 Ga0114129_100865392 135
32 3300009147 Ga0114129_10091789 Ga0114129_100917895 135
33 3300009147 Ga0114129_11474963 Ga0114129_114749632 135
34 3300009147 Ga0114129_11775980 Ga0114129_117759801 135
35 3300011119 Ga0105246_11443664 Ga0105246_114436641 135
36 3300027695 Ga0209966_1007407 Ga0209966_10074073 135
37 3300028556 Ga0265337_1000648 Ga0265337_100064811 135
38 3300028556 Ga0265337_1019766 Ga0265337_10197663 135
39 3300028556 Ga0265337_1124173 Ga0265337_11241731 135
40 3300028577 Ga0265318_10073606 Ga0265318_100736062 135
41 3300028653 Ga0265323_10050516 Ga0265323_100505161 135
42 3300028800 Ga0265338_10104924 Ga0265338_101049242 135
43 3300031733 Ga0316577_10091498 Ga0316577_100914983 135
44 3300044712 Ga0453684_0018151 Ga0453684_0018151_3583_3990 135
45 3300044712 Ga0453684_0146186 Ga0453684_0146186_2361_2768 135
46 3300044712 Ga0453684_0216511 Ga0453684_0216511_670_1077 135
47 3300044712 Ga0453684_0281020 Ga0453684_0281020_986_1396 135
48 3300044712 Ga0453684_0575622 Ga0453684_0575622_520_927 135
49 3300044712 Ga0453684_0618550 Ga0453684_0618550_46_453 135
50 3300045051 Ga0451576_0624622 Ga0451576_0624622_474_914 135
51 3300045051 Ga0451576_2090051 Ga0451576_2090051_74_511 135
52 3300048911 Ga0496108_0557031 Ga0496108_0557031_486_917 135
53 3300049590 Ga0501074_0963810 Ga0501074_0963810_73_483 135
54 3300050507 nmdc:mga05p37_270314_c1 nmdc:mga05p37_270314_c1_729_1169 135
55 3300050507 nmdc:mga05p37_50680_c1 nmdc:mga05p37_50680_c1_4382_4816 135
56 3300050508 nmdc:mga09592_375981_c1 nmdc:mga09592_375981_c1_380_787 135
57 3300050508 nmdc:mga09592_986855_c1 nmdc:mga09592_986855_c1_140_571 135
58 3300050509 nmdc:mga0qj67_123104_c1 nmdc:mga0qj67_123104_c1_410_841 135
59 3300005295 Ga0065707_10101297 Ga0065707_101012972 136
60 3300005295 Ga0065707_10227422 Ga0065707_102274222 136
61 3300005518 Ga0070699_100005190 Ga0070699_10000519016 136
62 3300006880 Ga0075429_100302559 Ga0075429_1003025592 136
63 3300025923 Ga0207681_10233580 Ga0207681_102335801 136
64 3300031852 Ga0307410_10330676 Ga0307410_103306761 136
65 3300032002 Ga0307416_102485338 Ga0307416_1024853381 136
66 3300032002 Ga0307416_102532733 Ga0307416_1025327331 136
67 3300032002 Ga0307416_102558674 Ga0307416_1025586742 136
68 3300032126 Ga0307415_100712808 Ga0307415_1007128082 136
69 3300042876 Ga0451577_0031471 Ga0451577_0031471_263_676 136
70 3300042876 Ga0451577_0294362 Ga0451577_0294362_567_977 136
71 3300042876 Ga0451577_0367571 Ga0451577_0367571_530_991 136
72 3300044673 Ga0453683_0000634 Ga0453683_0000634_31273_31683 136
73 3300044673 Ga0453683_0335986 Ga0453683_0335986_286_702 136
74 3300044712 Ga0453684_0024404 Ga0453684_0024404_6758_7168 136
75 3300044712 Ga0453684_0124243 Ga0453684_0124243_787_1197 136
76 3300044712 Ga0453684_0345317 Ga0453684_0345317_257_667 136
77 3300044712 Ga0453684_0458003 Ga0453684_0458003_956_1369 136
78 3300045051 Ga0451576_0016517 Ga0451576_0016517_7545_7955 136
79 3300045051 Ga0451576_0450887 Ga0451576_0450887_673_1134 136
80 3300049592 Ga0501076_0362807 Ga0501076_0362807_179_592 136
81 3300050508 nmdc:mga09592_420820_c1 nmdc:mga09592_420820_c1_642_1058 136
82 3300060353 Ga0501082_0726902 Ga0501082_0726902_204_617 136
83 2162886006 SwRhRL3b_contig_1071245 SwRhRL3b_0234.00002080 137
84 3300005289 Ga0065704_10070442 Ga0065704_1007044213 137
85 3300005289 Ga0065704_10081207 Ga0065704_100812073 137
86 3300005289 Ga0065704_10424649 Ga0065704_104246492 137
87 3300005295 Ga0065707_10000435 Ga0065707_1000043516 137
88 3300005295 Ga0065707_10083667 Ga0065707_100836673 137
89 3300005295 Ga0065707_10126871 Ga0065707_101268713 137
90 3300005295 Ga0065707_10459798 Ga0065707_104597981 137
91 3300005295 Ga0065707_10527817 Ga0065707_105278171 137
92 3300005295 Ga0065707_10672063 Ga0065707_106720631 137
93 3300005336 Ga0070680_100136722 Ga0070680_1001367222 137
94 3300005340 Ga0070689_100065071 Ga0070689_1000650714 137
95 3300005353 Ga0070669_101951287 Ga0070669_1019512871 137
96 3300005440 Ga0070705_100529798 Ga0070705_1005297981 137
97 3300005441 Ga0070700_100117858 Ga0070700_1001178582 137
98 3300005444 Ga0070694_100251971 Ga0070694_1002519712 137
99 3300005444 Ga0070694_100522060 Ga0070694_1005220602 137
100 3300005444 Ga0070694_101945421 Ga0070694_1019454211 137
101 3300005467 Ga0070706_100077645 Ga0070706_1000776452 137
102 3300005467 Ga0070706_100260751 Ga0070706_1002607511 137
103 3300005471 Ga0070698_100025169 Ga0070698_1000251697 137
104 3300005518 Ga0070699_100111635 Ga0070699_1001116355 137
105 3300005545 Ga0070695_100300978 Ga0070695_1003009782 137
106 3300005545 Ga0070695_100690567 Ga0070695_1006905672 137
107 3300005549 Ga0070704_100118981 Ga0070704_1001189814 137
108 3300005617 Ga0068859_100165591 Ga0068859_1001655914 137
109 3300005617 Ga0068859_101643898 Ga0068859_1016438981 137
110 3300005618 Ga0068864_100265876 Ga0068864_1002658762 137
111 3300005719 Ga0068861_100798698 Ga0068861_1007986982 137
112 3300005841 Ga0068863_100441628 Ga0068863_1004416283 137
113 3300005844 Ga0068862_100362860 Ga0068862_1003628602 137
114 3300006844 Ga0075428_100003712 Ga0075428_10000371215 137
115 3300006844 Ga0075428_100073882 Ga0075428_1000738822 137
116 3300006846 Ga0075430_100015972 Ga0075430_1000159722 137
117 3300006846 Ga0075430_100348358 Ga0075430_1003483582 137
118 3300006847 Ga0075431_100046594 Ga0075431_1000465943 137
119 3300006847 Ga0075431_100456230 Ga0075431_1004562302 137
120 3300006852 Ga0075433_10208174 Ga0075433_102081743 137
121 3300006852 Ga0075433_10362345 Ga0075433_103623451 137
122 3300006852 Ga0075433_10508601 Ga0075433_105086012 137
123 3300006871 Ga0075434_100619468 Ga0075434_1006194682 137
124 3300006880 Ga0075429_100006339 Ga0075429_10000633912 137
125 3300006880 Ga0075429_100008377 Ga0075429_1000083777 137
126 3300006880 Ga0075429_100101825 Ga0075429_1001018252 137
127 3300006931 Ga0097620_100165597 Ga0097620_1001655974 137
128 3300006931 Ga0097620_101644326 Ga0097620_1016443261 137
129 3300009094 Ga0111539_10135924 Ga0111539_101359242 137
130 3300009147 Ga0114129_10002433 Ga0114129_1000243313 137
131 3300009147 Ga0114129_10006929 Ga0114129_100069294 137
132 3300009147 Ga0114129_10233408 Ga0114129_102334082 137
133 3300009147 Ga0114129_10317843 Ga0114129_103178432 137
134 3300009147 Ga0114129_10326212 Ga0114129_103262122 137
135 3300009147 Ga0114129_10798707 Ga0114129_107987072 137
136 3300009147 Ga0114129_11112569 Ga0114129_111125692 137
137 3300009553 Ga0105249_10021508 Ga0105249_100215082 137
138 3300009553 Ga0105249_10313530 Ga0105249_103135302 137
139 3300011119 Ga0105246_10097375 Ga0105246_100973753 137
140 3300011119 Ga0105246_11710415 Ga0105246_117104152 137
141 3300014325 Ga0163163_11179122 Ga0163163_111791221 137
142 3300014326 Ga0157380_10205450 Ga0157380_102054503 137
143 3300014326 Ga0157380_12259118 Ga0157380_122591182 137
144 3300025910 Ga0207684_10118916 Ga0207684_101189162 137
145 3300025922 Ga0207646_11238948 Ga0207646_112389482 137
146 3300025936 Ga0207670_10097330 Ga0207670_100973304 137
147 3300025961 Ga0207712_11504446 Ga0207712_115044461 137
148 3300026075 Ga0207708_10239675 Ga0207708_102396752 137
149 3300026095 Ga0207676_11217476 Ga0207676_112174761 137
150 3300028380 Ga0268265_10575858 Ga0268265_105758583 137
151 3300031911 Ga0307412_11136170 Ga0307412_111361702 137
152 3300032126 Ga0307415_100682264 Ga0307415_1006822642 137
153 3300035112 Ga0373932_0350572 Ga0373932_0350572_12_425 137
154 3300035241 Ga0373961_0034746 Ga0373961_0034746_914_1327 137
155 3300035691 Ga0373931_0767729 Ga0373931_0767729_166_579 137
156 3300041486 Ga0451807_1178370 Ga0451807_1178370_172_615 137
157 3300042876 Ga0451577_0115701 Ga0451577_0115701_833_1246 137
158 3300042876 Ga0451577_0227352 Ga0451577_0227352_37_462 137
159 3300042876 Ga0451577_0431755 Ga0451577_0431755_348_761 137
160 3300044673 Ga0453683_0026795 Ga0453683_0026795_2655_3089 137
161 3300044673 Ga0453683_0042401 Ga0453683_0042401_1605_2018 137
162 3300044673 Ga0453683_0088006 Ga0453683_0088006_551_967 137
163 3300044673 Ga0453683_0862721 Ga0453683_0862721_59_484 137
164 3300044712 Ga0453684_0000044 Ga0453684_0000044_127570_127989 137
165 3300044712 Ga0453684_0000802 Ga0453684_0000802_71197_71613 137
166 3300044712 Ga0453684_0110970 Ga0453684_0110970_2373_2792 137
167 3300044712 Ga0453684_0154382 Ga0453684_0154382_411_833 137
168 3300044712 Ga0453684_0185583 Ga0453684_0185583_131_550 137
169 3300044712 Ga0453684_0462023 Ga0453684_0462023_774_1187 137
170 3300044712 Ga0453684_0478481 Ga0453684_0478481_894_1313 137
171 3300044712 Ga0453684_0508614 Ga0453684_0508614_442_885 137
172 3300044712 Ga0453684_1398295 Ga0453684_1398295_98_517 137
173 3300045051 Ga0451576_0051582 Ga0451576_0051582_3240_3674 137
174 3300045051 Ga0451576_0062842 Ga0451576_0062842_746_1162 137
175 3300045051 Ga0451576_0260727 Ga0451576_0260727_924_1340 137
176 3300045051 Ga0451576_0424074 Ga0451576_0424074_592_1017 137
177 3300045051 Ga0451576_0523696 Ga0451576_0523696_288_707 137
178 3300045051 Ga0451576_1263578 Ga0451576_1263578_204_617 137
179 3300048090 Ga0495615_0272706 Ga0495615_0272706_11_448 137
180 3300049522 Ga0501299_205441 Ga0501299_205441_91_510 137
181 3300049576 Ga0501040_0907307 Ga0501040_0907307_163_579 137
182 3300049591 Ga0501075_0338927 Ga0501075_0338927_369_806 137
183 3300049592 Ga0501076_0104098 Ga0501076_0104098_499_915 137
184 3300050507 nmdc:mga05p37_1446129_c1 nmdc:mga05p37_1446129_c1_176_595 137
185 3300050507 nmdc:mga05p37_3062_c1 nmdc:mga05p37_3062_c1_1628_2047 137
186 3300050507 nmdc:mga05p37_350067_c1 nmdc:mga05p37_350067_c1_35_448 137
187 3300050508 nmdc:mga09592_152935_c1 nmdc:mga09592_152935_c1_735_1157 137
188 3300050508 nmdc:mga09592_171714_c1 nmdc:mga09592_171714_c1_910_1326 137
189 3300050508 nmdc:mga09592_2454_c1 nmdc:mga09592_2454_c1_878_1297 137
190 3300050508 nmdc:mga09592_31554_c1 nmdc:mga09592_31554_c1_3519_3941 137
191 3300050509 nmdc:mga0qj67_286538_c1 nmdc:mga0qj67_286538_c1_283_702 137
192 3300050510 nmdc:mga06r32_528132_c1 nmdc:mga06r32_528132_c1_22_441 137
193 3300050511 nmdc:mga08y16_194632_c1 nmdc:mga08y16_194632_c1_1253_1669 137
194 3300050512 nmdc:mga0n895_175223_c1 nmdc:mga0n895_175223_c1_1573_1989 137
195 3300050515 nmdc:mga0a205_257509_c1 nmdc:mga0a205_257509_c1_555_992 137
196 3300050515 nmdc:mga0a205_339259_c1 nmdc:mga0a205_339259_c1_891_1307 137
197 3300050515 nmdc:mga0a205_481802_c1 nmdc:mga0a205_481802_c1_221_634 137
198 3300060353 Ga0501082_1630561 Ga0501082_1630561_18_434 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

43

126

0.94

PF01643

Acyl-ACP_TE

Acyl-ACP thioesterase N-terminal domain

26

154

0.92

PF13279

4HBT_2

Thioesterase-like superfamily

35

154

0.89

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

23

134

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.9359 56 112
5byu-assembly1.cif.gz_A crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9351 8 128
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9297 8 128
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9265 3 128
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.923 7 133
ID Description Score Start End Superfamily
af_A0A1D6K9H0_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9398 55 112 3.10.129.10
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9318 53 127 3.10.129.10
5eo2D01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9299 4 110 3.10.129.10
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9297 8 128 3.10.129.10
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9284 56 112 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A136KZL8-F1-model_v4 Thioesterase superfamily protein 0.9997 1 133 GO:0047617
AF-A0A136KZL8-F1-model_v4 Thioesterase superfamily protein 0.9923 1 133 GO:0047617
AF-A0A2P8WD30-F1-model_v4 Acyl-CoA thioesterase 0.9904 6 126 GO:0047617
AF-A0A7C4UR96-F1-model_v4 Acyl-CoA thioesterase 0.9875 1 135 GO:0047617
AF-A0A3A0BN99-F1-model_v4 Acyl-CoA thioesterase 0.9856 1 132 GO:0047617

Feature Viewer

pLDDT pTM Quality
94.65 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map