F304211

General Info

Members Datasets Scaffolds Average Seq Length
198 114 396 323

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10063528|Ga0081539_100635282
Length 349
Sequence MKKGHKEASMTQKKTKRMPGRLLARLGIAGVLGVGLTLGVAACGGGGSDSIDLVAYSTPQQVYEDELEPAFKDTSDGKDADFSNSFGASGDQSRAVESGQPADVVEFSLEPDMTRLVDAGVVASDWNQNEYKGIVTDSVVTLMVRPGNPENIHSFEDLTRDDVEVIDPNPATSGGARWNIMAIYGSQIEAGRSEAEAQDFVKQVIANTSVQDDSARDSLNTFSSGKGDVLVGYENEAIQAKAEGIDIDYVTPDSTILIENPIATTKDAGDAAQKFVDFLYTEPAQQDFADAGYRPVVKSVFDKNASKFPEPSGLFTIADFGGWSKVADPFFGDDGWVIKAEADLGNPTD

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
46 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
47 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
66 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 4.04
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10063528 3300005985 Bacteria 2014
2 LJQas_1001390 3300000549 Bacteria 3621
3 JGI25407J50210_10008564 3300003373 Bacteria 2581
4 JGI25407J50210_10025664 3300003373 Unclassified 1527
5 Ga0070683_100004118 3300005329 Bacteria 11912
6 Ga0070683_100005396 3300005329 Bacteria 10669
7 Ga0070683_100143268 3300005329 Bacteria 2264
8 Ga0070668_100186268 3300005347 Bacteria 1698
9 Ga0070708_100220877 3300005445 Bacteria 1777
10 Ga0070707_100233291 3300005468 Bacteria 1791
11 Ga0070698_100040607 3300005471 Bacteria 4780
12 Ga0070684_100002880 3300005535 Bacteria 12794
13 Ga0070684_100003057 3300005535 Bacteria 12487
14 Ga0070684_100009397 3300005535 Bacteria 7698
15 Ga0070684_100333782 3300005535 Bacteria 1393
16 Ga0068856_100322909 3300005614 Bacteria 1561
17 Ga0081455_10027209 3300005937 Bacteria 5242
18 Ga0081455_10050612 3300005937 Bacteria 3571
19 Ga0081455_10054360 3300005937 Bacteria 3413
20 Ga0081455_10224807 3300005937 Bacteria 1389
21 Ga0081538_10001236 3300005981 Bacteria 26773
22 Ga0081538_10003387 3300005981 Bacteria 15086
23 Ga0081538_10008093 3300005981 Bacteria 8976
24 Ga0081538_10017084 3300005981 Bacteria 5526
25 Ga0081538_10018464 3300005981 Bacteria 5235
26 Ga0081538_10018826 3300005981 Bacteria 5164
27 Ga0081540_1000686 3300005983 Bacteria 31589
28 Ga0081540_1028347 3300005983 Bacteria 3146
29 Ga0081540_1043582 3300005983 Bacteria 2299
30 Ga0081540_1077268 3300005983 Bacteria 1514
31 Ga0081539_10043005 3300005985 Bacteria 2624
32 Ga0075364_10185689 3300006051 Bacteria 1408
33 Ga0075432_10008510 3300006058 Bacteria 3500
34 Ga0075428_100001709 3300006844 Bacteria 23438
35 Ga0075428_100009817 3300006844 Bacteria 10642
36 Ga0075428_100222493 3300006844 Bacteria 2038
37 Ga0075428_100263747 3300006844 Bacteria 1854
38 Ga0075428_100301755 3300006844 Bacteria 1722
39 Ga0075430_100011094 3300006846 Bacteria 7637
40 Ga0075430_100080170 3300006846 Bacteria 2735
41 Ga0075430_100114088 3300006846 Bacteria 2252
42 Ga0075430_100137410 3300006846 Bacteria 2036
43 Ga0075430_100184260 3300006846 Bacteria 1736
44 Ga0075431_100007845 3300006847 Bacteria 10638
45 Ga0075431_100035950 3300006847 Bacteria 5102
46 Ga0075431_100074448 3300006847 Bacteria 3504
47 Ga0075431_100125235 3300006847 Bacteria 2651
48 Ga0075429_100003839 3300006880 Bacteria 12830
49 Ga0068865_100204277 3300006881 Bacteria 1535
50 Ga0075436_100231361 3300006914 Bacteria 1313
51 Ga0111539_10200638 3300009094 Bacteria 2326
52 Ga0105245_10001984 3300009098 Bacteria 18590
53 Ga0105245_10283239 3300009098 Bacteria 1621
54 Ga0114129_10019061 3300009147 Bacteria 9773
55 Ga0114129_10039901 3300009147 Bacteria 6623
56 Ga0114129_10521881 3300009147 Bacteria 1548
57 Ga0105243_10013282 3300009148 Bacteria 6227
58 Ga0105246_10183925 3300011119 Bacteria 1612
59 Ga0157371_10268919 3300013102 Bacteria 1230
60 Ga0163162_10040479 3300013306 Bacteria 4660
61 Ga0207687_10005687 3300025927 Bacteria 8241
62 Ga0207687_10149386 3300025927 Bacteria 1781
63 Ga0207687_10188237 3300025927 Bacteria 1604
64 Ga0207687_10319641 3300025927 Bacteria 1256
65 Ga0207709_10036083 3300025935 Bacteria 2928
66 Ga0207661_10061141 3300025944 Bacteria 3042
67 Ga0207661_10070441 3300025944 Bacteria 2855
68 Ga0207679_10384939 3300025945 Unclassified 1230
69 Ga0207702_10263816 3300026078 Bacteria 1622
70 Ga0207674_10000602 3300026116 Bacteria 47280
71 Ga0207674_10009302 3300026116 Bacteria 11254
72 Ga0207428_10084653 3300027907 Bacteria 2471
73 Ga0307408_100049494 3300031548 Bacteria 3019
74 Ga0307405_10103405 3300031731 Bacteria 1915
75 Ga0307405_10246733 3300031731 Bacteria 1326
76 Ga0307413_10115776 3300031824 Bacteria 1805
77 Ga0307410_10036761 3300031852 Bacteria 3192
78 Ga0307407_10004547 3300031903 Bacteria 5906
79 Ga0307409_100064201 3300031995 Bacteria 2883
80 Ga0307416_100003574 3300032002 Bacteria 9170
81 Ga0307416_100068437 3300032002 Bacteria 2934
82 Ga0307411_10191974 3300032005 Bacteria 1560
83 Ga0307415_100264442 3300032126 Bacteria 1405
84 Ga0373961_0009049 3300035241 Bacteria 2431
85 Ga0373931_0062897 3300035691 Bacteria 2005
86 Ga0373947_0062448 3300035725 Bacteria 2267
87 Ga0395899_0052843 3300037312 Bacteria 3010
88 Ga0395899_0056811 3300037312 Bacteria 2891
89 Ga0395899_0059516 3300037312 Bacteria 2816
90 Ga0395900_0014195 3300037418 Bacteria 8133
91 Ga0395900_0031827 3300037418 Bacteria 5422
92 Ga0395900_0187334 3300037418 Bacteria 2100
93 Ga0395900_0365511 3300037418 Bacteria 1413
94 Ga0395898_0019064 3300037466 Bacteria 6984
95 Ga0395898_0048270 3300037466 Bacteria 4176
96 Ga0395898_0055792 3300037466 Bacteria 3853
97 Ga0395898_0094191 3300037466 Bacteria 2878
98 Ga0395898_0490520 3300037466 Unclassified 1169
99 Ga0395905_0004634 3300037471 Bacteria 14223
100 Ga0395905_0052344 3300037471 Bacteria 3822
101 Ga0395905_0134046 3300037471 Bacteria 2330
102 Ga0395905_0163325 3300037471 Bacteria 2093
103 Ga0395905_0226206 3300037471 Bacteria 1750
104 Ga0395905_0229961 3300037471 Bacteria 1734
105 Ga0395905_0292182 3300037471 Bacteria 1516
106 Ga0395901_0004266 3300038443 Bacteria 14419
107 Ga0395901_0038434 3300038443 Bacteria 4950
108 Ga0395901_0245258 3300038443 Bacteria 1867
109 Ga0395901_0656566 3300038443 Bacteria 1051
110 Ga0451853_1494816 3300041512 Unclassified 1483
111 Ga0439464_0001867 3300042439 Bacteria 5090
112 Ga0466961_0209322 3300044693 Bacteria 1204
113 Ga0466957_0121198 3300044842 Bacteria 1667
114 Ga0466958_0103992 3300045836 Bacteria 1768
115 Ga0466967_0179805 3300045976 Bacteria 1995
116 Ga0495603_0035627 3300046455 Bacteria 2989
117 Ga0495641_0031481 3300046461 Bacteria 2534
118 Ga0495605_0123722 3300046474 Unclassified 1171
119 Ga0495584_0030091 3300046491 Bacteria 2751
120 Ga0495596_0031230 3300046500 Bacteria 2129
121 Ga0495596_0045469 3300046500 Bacteria 1726
122 Ga0495596_0085017 3300046500 Bacteria 1228
123 Ga0495607_0116149 3300046501 Bacteria 1412
124 Ga0495637_0045370 3300046520 Unclassified 1865
125 Ga0495637_0076992 3300046520 Bacteria 1336
126 Ga0495663_0015036 3300046525 Bacteria 2178
127 Ga0495663_0025184 3300046525 Unclassified 1733
128 Ga0495609_0041629 3300046538 Bacteria 2064
129 Ga0495659_0043963 3300046664 Bacteria 1605
130 Ga0495658_0038194 3300046683 Bacteria 2658
131 Ga0495613_0083997 3300046689 Bacteria 2312
132 Ga0495581_0016645 3300047315 Bacteria 4274
133 Ga0495672_0063091 3300047320 Bacteria 2128
134 Ga0495676_0041654 3300047321 Bacteria 3777
135 Ga0495677_0051183 3300047445 Bacteria 1521
136 Ga0496106_0125008 3300048909 Bacteria 2013
137 Ga0496108_0047016 3300048911 Bacteria 3607
138 Ga0496108_0074640 3300048911 Bacteria 2864
139 Ga0496110_0070895 3300048913 Bacteria 3089
140 Ga0496110_0097903 3300048913 Bacteria 2628
141 Ga0496110_0121610 3300048913 Bacteria 2352
142 Ga0496111_0033706 3300048914 Bacteria 3654
143 Ga0496111_0092434 3300048914 Bacteria 2218
144 Ga0501031_0001963 3300049568 Bacteria 12973
145 Ga0501032_0001437 3300049569 Bacteria 18911
146 Ga0501033_0010705 3300049570 Bacteria 7030
147 Ga0501034_0009125 3300049571 Bacteria 10411
148 Ga0501034_0026745 3300049571 Bacteria 5871
149 Ga0501034_0103497 3300049571 Bacteria 2840
150 Ga0501036_0016169 3300049572 Bacteria 6232
151 Ga0501038_0008578 3300049574 Bacteria 9381
152 Ga0501039_0043347 3300049575 Bacteria 3475
153 Ga0501040_0008636 3300049576 Bacteria 6616
154 Ga0501041_0009093 3300049577 Bacteria 5845
155 Ga0501043_0002106 3300049579 Bacteria 16982
156 Ga0501046_0003361 3300049580 Bacteria 14697
157 Ga0501047_0000336 3300049581 Bacteria 53637
158 Ga0501047_0160475 3300049581 Bacteria 2120
159 Ga0501067_0001349 3300049583 Bacteria 13285
160 Ga0501068_0000582 3300049584 Bacteria 18517
161 Ga0501069_0008200 3300049585 Bacteria 5485
162 Ga0501070_0004457 3300049586 Bacteria 12027
163 Ga0501070_0004645 3300049586 Bacteria 11765
164 Ga0501070_0028227 3300049586 Bacteria 4705
165 Ga0501070_0040024 3300049586 Bacteria 3909
166 Ga0501071_0010359 3300049587 Bacteria 6244
167 Ga0501072_0008083 3300049588 Bacteria 7983
168 Ga0501072_0028116 3300049588 Bacteria 4390
169 Ga0501072_0078854 3300049588 Bacteria 2608
170 Ga0501073_0125810 3300049589 Bacteria 1777
171 Ga0501076_0009532 3300049592 Bacteria 7169
172 Ga0501076_0110917 3300049592 Bacteria 2217
173 Ga0501077_0054889 3300049593 Bacteria 2530
174 Ga0501079_0012389 3300049741 Bacteria 6506
175 Ga0501080_0002780 3300049742 Bacteria 15372
176 Ga0501083_0002399 3300049744 Bacteria 12834
177 Ga0501035_0007463 3300049822 Bacteria 10213
178 Ga0501044_0025788 3300049823 Bacteria 6231
179 Ga0501044_0115607 3300049823 Bacteria 2688
180 Ga0501045_0029343 3300049824 Bacteria 3975
181 Ga0501045_0195344 3300049824 Bacteria 1508
182 nmdc:mga00v17_55463_c1 3300050491 Bacteria 2420
183 nmdc:mga05p37_183904_c1 3300050507 Bacteria 2541
184 nmdc:mga05p37_27591_c1 3300050507 Bacteria 6914
185 nmdc:mga05p37_407281_c1 3300050507 Bacteria 1586
186 nmdc:mga05p37_655553_c1 3300050507 Bacteria 1174
187 nmdc:mga05p37_7464_c2 3300050507 Bacteria 10464
188 nmdc:mga09592_3849_c1 3300050508 Bacteria 12085
189 nmdc:mga09592_55577_c1 3300050508 Bacteria 3345
190 nmdc:mga0qj67_103213_c1 3300050509 Bacteria 2300
191 nmdc:mga0qj67_12653_c1 3300050509 Bacteria 6362
192 nmdc:mga06r32_115180_c1 3300050510 Bacteria 2647
193 nmdc:mga06r32_41925_c1 3300050510 Bacteria 4350
194 nmdc:mga06r32_920_c1 3300050510 Bacteria 26138
195 nmdc:mga08y16_200108_c1 3300050511 Bacteria 2070
196 Ga0501084_0017593 3300054114 Bacteria 5946
197 Ga0501082_0090043 3300060353 Bacteria 2649
198 Ga0466962_0129465 3300061719 Bacteria 1219
199 Ga0081539_10063528
200 LJQas_1001390
201 JGI25407J50210_10008564
202 JGI25407J50210_10025664
203 Ga0070683_100004118
204 Ga0070683_100005396
205 Ga0070683_100143268
206 Ga0070668_100186268
207 Ga0070708_100220877
208 Ga0070707_100233291
209 Ga0070698_100040607
210 Ga0070684_100002880
211 Ga0070684_100003057
212 Ga0070684_100009397
213 Ga0070684_100333782
214 Ga0068856_100322909
215 Ga0081455_10027209
216 Ga0081455_10050612
217 Ga0081455_10054360
218 Ga0081455_10224807
219 Ga0081538_10001236
220 Ga0081538_10003387
221 Ga0081538_10008093
222 Ga0081538_10017084
223 Ga0081538_10018464
224 Ga0081538_10018826
225 Ga0081540_1000686
226 Ga0081540_1028347
227 Ga0081540_1043582
228 Ga0081540_1077268
229 Ga0081539_10043005
230 Ga0075364_10185689
231 Ga0075432_10008510
232 Ga0075428_100001709
233 Ga0075428_100009817
234 Ga0075428_100222493
235 Ga0075428_100263747
236 Ga0075428_100301755
237 Ga0075430_100011094
238 Ga0075430_100080170
239 Ga0075430_100114088
240 Ga0075430_100137410
241 Ga0075430_100184260
242 Ga0075431_100007845
243 Ga0075431_100035950
244 Ga0075431_100074448
245 Ga0075431_100125235
246 Ga0075429_100003839
247 Ga0068865_100204277
248 Ga0075436_100231361
249 Ga0111539_10200638
250 Ga0105245_10001984
251 Ga0105245_10283239
252 Ga0114129_10019061
253 Ga0114129_10039901
254 Ga0114129_10521881
255 Ga0105243_10013282
256 Ga0105246_10183925
257 Ga0157371_10268919
258 Ga0163162_10040479
259 Ga0207687_10005687
260 Ga0207687_10149386
261 Ga0207687_10188237
262 Ga0207687_10319641
263 Ga0207709_10036083
264 Ga0207661_10061141
265 Ga0207661_10070441
266 Ga0207679_10384939
267 Ga0207702_10263816
268 Ga0207674_10000602
269 Ga0207674_10009302
270 Ga0207428_10084653
271 Ga0307408_100049494
272 Ga0307405_10103405
273 Ga0307405_10246733
274 Ga0307413_10115776
275 Ga0307410_10036761
276 Ga0307407_10004547
277 Ga0307409_100064201
278 Ga0307416_100003574
279 Ga0307416_100068437
280 Ga0307411_10191974
281 Ga0307415_100264442
282 Ga0373961_0009049
283 Ga0373931_0062897
284 Ga0373947_0062448
285 Ga0395899_0052843
286 Ga0395899_0056811
287 Ga0395899_0059516
288 Ga0395900_0014195
289 Ga0395900_0031827
290 Ga0395900_0187334
291 Ga0395900_0365511
292 Ga0395898_0019064
293 Ga0395898_0048270
294 Ga0395898_0055792
295 Ga0395898_0094191
296 Ga0395898_0490520
297 Ga0395905_0004634
298 Ga0395905_0052344
299 Ga0395905_0134046
300 Ga0395905_0163325
301 Ga0395905_0226206
302 Ga0395905_0229961
303 Ga0395905_0292182
304 Ga0395901_0004266
305 Ga0395901_0038434
306 Ga0395901_0245258
307 Ga0395901_0656566
308 Ga0451853_1494816
309 Ga0439464_0001867
310 Ga0466961_0209322
311 Ga0466957_0121198
312 Ga0466958_0103992
313 Ga0466967_0179805
314 Ga0495603_0035627
315 Ga0495641_0031481
316 Ga0495605_0123722
317 Ga0495584_0030091
318 Ga0495596_0031230
319 Ga0495596_0045469
320 Ga0495596_0085017
321 Ga0495607_0116149
322 Ga0495637_0045370
323 Ga0495637_0076992
324 Ga0495663_0015036
325 Ga0495663_0025184
326 Ga0495609_0041629
327 Ga0495659_0043963
328 Ga0495658_0038194
329 Ga0495613_0083997
330 Ga0495581_0016645
331 Ga0495672_0063091
332 Ga0495676_0041654
333 Ga0495677_0051183
334 Ga0496106_0125008
335 Ga0496108_0047016
336 Ga0496108_0074640
337 Ga0496110_0070895
338 Ga0496110_0097903
339 Ga0496110_0121610
340 Ga0496111_0033706
341 Ga0496111_0092434
342 Ga0501031_0001963
343 Ga0501032_0001437
344 Ga0501033_0010705
345 Ga0501034_0009125
346 Ga0501034_0026745
347 Ga0501034_0103497
348 Ga0501036_0016169
349 Ga0501038_0008578
350 Ga0501039_0043347
351 Ga0501040_0008636
352 Ga0501041_0009093
353 Ga0501043_0002106
354 Ga0501046_0003361
355 Ga0501047_0000336
356 Ga0501047_0160475
357 Ga0501067_0001349
358 Ga0501068_0000582
359 Ga0501069_0008200
360 Ga0501070_0004457
361 Ga0501070_0004645
362 Ga0501070_0028227
363 Ga0501070_0040024
364 Ga0501071_0010359
365 Ga0501072_0008083
366 Ga0501072_0028116
367 Ga0501072_0078854
368 Ga0501073_0125810
369 Ga0501076_0009532
370 Ga0501076_0110917
371 Ga0501077_0054889
372 Ga0501079_0012389
373 Ga0501080_0002780
374 Ga0501083_0002399
375 Ga0501035_0007463
376 Ga0501044_0025788
377 Ga0501044_0115607
378 Ga0501045_0029343
379 Ga0501045_0195344
380 nmdc:mga00v17_55463_c1
381 nmdc:mga05p37_183904_c1
382 nmdc:mga05p37_27591_c1
383 nmdc:mga05p37_407281_c1
384 nmdc:mga05p37_655553_c1
385 nmdc:mga05p37_7464_c2
386 nmdc:mga09592_3849_c1
387 nmdc:mga09592_55577_c1
388 nmdc:mga0qj67_103213_c1
389 nmdc:mga0qj67_12653_c1
390 nmdc:mga06r32_115180_c1
391 nmdc:mga06r32_41925_c1
392 nmdc:mga06r32_920_c1
393 nmdc:mga08y16_200108_c1
394 Ga0501084_0017593
395 Ga0501082_0090043
396 Ga0466962_0129465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

51

294

0.85

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

153

313

0.77

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

40

314

0.77

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

54

286

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.967 17 300
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9538 17 300
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9275 17 310
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9255 17 311
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8812 17 310
ID Description Score Start End Superfamily
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9685 106 300 3.40.190.10
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9494 106 300 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9446 19 86 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9294 106 300 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9257 17 92 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y6CEN3-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9841 61 318 GO:0042597
GO:1902358
AF-A0A378X1U7-F1-model_v4 Sulfate-binding protein 0.9745 65 315 GO:0042597
GO:1902358
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9742 17 318 GO:0042597
GO:1902358
AF-A0A418LUJ5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9742 77 199 GO:0042597
GO:1902358
AF-A0A0F5N3A3-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9739 17 313 GO:0042597
GO:1902358

Map