F304207

General Info

Members Datasets Scaffolds Average Seq Length
198 161 137 367

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1009139|Ga0081540_10091392
Length 393
Sequence MSALGRPADVPPWVSIALIPLVNLVLAFVAAGLVVLLIYWGQYADGTLPGADYLYTPVRAAELLLKGAFGTVPNLSRTLYYTTDFIFAGLAVAVAFHAGLFNIGAEGQAYFAGLGVALVCLYLDFLPFILVLPLAIVAAALFGAAWAFIPAYLQARRGSHIVITTIMFNFIASSLMVYLLVHVMIAPGQQSPETRAFLPNTTMPTITEVVAWFGYKLPRLPLNLTFLWALACCVFVWIFIWHTRWGYALRTVGLNPRAAVYGGISVVGVIIMAMCISGALSGFIAVNEVMGFNRRLLLNFVAGAGFVGIAVSLMGRNHPFGIIFAAVLFGALYQGGTELSFEMPEITKWLVVTIQGLVILFAGALENMFRPRIEALFRRRPAPLQTAAGRTGG

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
7 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
8 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
9 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
10 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
11 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
12 2643221607 Rhizobium sp. Root73 Isolate Unclassified
13 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
14 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
15 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
16 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
17 2643221688 Rhizobium sp. Root482 Isolate Unclassified
18 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
19 2643221718 Rhizobium sp. Root268 Isolate Unclassified
20 2738543024 Aminobacter sp. AP02 Isolate Unclassified
21 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
22 2791355263 Rhizobium chutanense C5 Isolate Nodule
23 2791355266 Rhizobium sp. L43 Isolate Nodule
24 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
25 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
26 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
27 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
28 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
29 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
30 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
31 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
32 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
33 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
34 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
35 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
36 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
37 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
38 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
39 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
40 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
41 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
42 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
43 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
44 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
45 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
46 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
47 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
48 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
49 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
50 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
51 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
52 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
53 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
54 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
55 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
56 2936381700 Rhizobium chutanense C16 Isolate Unclassified
57 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
58 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
59 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
60 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
64 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
158 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
159 8005395548 Rhizobium sp. R339 Isolate Nodule
160 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
161 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 69.19
Metatranscriptomes 0
Isolates 30.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.71
Nodule 14.14
Rhizoplane 0
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 15.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001549 3300002739 Bacteria 3984
2 JGI25152J39213_1008695 3300002773 Bacteria 2492
3 JGI25150J39212_1001258 3300002774 Bacteria 7330
4 JGI25159J45721_1000023 3300002987 Bacteria 116643
5 JGI25159J45721_1001258 3300002987 Bacteria 10693
6 JGI25159J45721_1016567 3300002987 Bacteria 1565
7 JGI25151J46595_10000166 3300003187 Bacteria 85475
8 JGI25151J46595_10002653 3300003187 Bacteria 10514
9 JGI25151J46595_10038753 3300003187 Bacteria 1769
10 JGI25406J46586_10019776 3300003203 Bacteria 2735
11 JGI25153J46596_10011407 3300003215 Bacteria 3929
12 JGI25153J46596_10020573 3300003215 Bacteria 2492
13 JGI25153J46596_10048083 3300003215 Bacteria 1249
14 JGI25161J50226_1000078 3300003374 Bacteria 83416
15 Ga0055524_1004996 3300003775 Bacteria 6005
16 Ga0055524_1026541 3300003775 Bacteria 1786
17 Ga0055528_1020921 3300003790 Bacteria 2100
18 Ga0055543_1000069 3300004625 Bacteria 94040
19 Ga0065165_1028173 3300005262 Bacteria 1817
20 Ga0065704_10118510 3300005289 Bacteria 1815
21 Ga0065715_10096064 3300005293 Bacteria 3949
22 Ga0068869_100213316 3300005334 Bacteria 1527
23 Ga0070669_100035500 3300005353 Bacteria 3612
24 Ga0070710_10018447 3300005437 Bacteria 3590
25 Ga0070681_10031374 3300005458 Bacteria 5335
26 Ga0070706_100293316 3300005467 Bacteria 1518
27 Ga0070679_100047110 3300005530 Bacteria 4298
28 Ga0070697_100010490 3300005536 Bacteria 7231
29 Ga0070665_100246844 3300005548 Bacteria 1786
30 Ga0068854_100065337 3300005578 Bacteria 2645
31 Ga0068861_100055804 3300005719 Bacteria 3014
32 Ga0068860_100115623 3300005843 Bacteria 2566
33 Ga0068860_100295280 3300005843 Bacteria 1586
34 Ga0081455_10046690 3300005937 Bacteria 3755
35 Ga0081540_1009139 3300005983 Bacteria 6841
36 Ga0075365_10009158 3300006038 Bacteria 5672
37 Ga0075365_10055511 3300006038 Bacteria 2629
38 Ga0075367_10115930 3300006178 Bacteria 1647
39 Ga0075366_10030211 3300006195 Bacteria 3184
40 Ga0075430_100066162 3300006846 Bacteria 3035
41 Ga0105247_10208323 3300009101 Bacteria 1317
42 Ga0105243_10059372 3300009148 Bacteria 3052
43 Ga0105239_10470429 3300010375 Bacteria 1427
44 Ga0157370_10302805 3300013104 Bacteria 1475
45 Ga0214542_1017381 3300021321 Bacteria 6521
46 Ga0213872_10000039 3300021361 Bacteria 123507
47 Ga0209436_100268 3300025208 Bacteria 23804
48 Ga0207425_1003693 3300025245 Bacteria 4814
49 Ga0207425_1006012 3300025245 Bacteria 3377
50 Ga0209129_1001099 3300025258 Bacteria 15766
51 Ga0209129_1001848 3300025258 Bacteria 11206
52 Ga0209129_1002246 3300025258 Bacteria 9651
53 Ga0209673_1003397 3300025273 Bacteria 9438
54 Ga0209130_1000002 3300025284 Bacteria 722648
55 Ga0209130_1000422 3300025284 Bacteria 45627
56 Ga0209025_1000053 3300025294 Bacteria 317600
57 Ga0209025_1022982 3300025294 Bacteria 3282
58 Ga0209564_1000262 3300025295 Bacteria 112256
59 Ga0209758_1000466 3300025297 Bacteria 66920
60 Ga0209758_1002556 3300025297 Bacteria 18318
61 Ga0209758_1003684 3300025297 Bacteria 13618
62 Ga0207426_1000013 3300025302 Bacteria 721897
63 Ga0207426_1000198 3300025302 Bacteria 146241
64 Ga0207707_10098987 3300025912 Bacteria 2549
65 Ga0207660_10261125 3300025917 Bacteria 1370
66 Ga0207681_10093688 3300025923 Bacteria 2151
67 Ga0207681_10266893 3300025923 Bacteria 1342
68 Ga0207659_10035801 3300025926 Bacteria 3434
69 Ga0207690_10065197 3300025932 Bacteria 2490
70 Ga0207691_10178415 3300025940 Bacteria 1857
71 Ga0207689_10101045 3300025942 Bacteria 2369
72 Ga0207668_10227067 3300025972 Bacteria 1503
73 Ga0207658_10169790 3300025986 Bacteria 1796
74 Ga0268266_10177041 3300028379 Bacteria 1940
75 Ga0268264_10313269 3300028381 Bacteria 1481
76 Ga0265334_10005584 3300028573 Bacteria 5495
77 Ga0307515_10000029 3300028794 Bacteria 365410
78 Ga0307515_10011406 3300028794 Bacteria 16865
79 Ga0265340_10031569 3300031247 Bacteria 2648
80 Ga0265327_10107766 3300031251 Bacteria 1335
81 Ga0265316_10066922 3300031344 Bacteria 2779
82 Ga0307513_10000259 3300031456 Bacteria 76155
83 Ga0265314_10074302 3300031711 Bacteria 2265
84 Ga0307516_10013265 3300031730 Bacteria 8794
85 Ga0307410_10231588 3300031852 Bacteria 1427
86 Ga0307414_10232634 3300032004 Bacteria 1520
87 Ga0373943_0180525 3300035170 Bacteria 1160
88 Ga0373931_0029392 3300035691 Bacteria 2821
89 Ga0373937_0230294 3300036401 Bacteria 1745
90 Ga0373925_0202726 3300037068 Bacteria 1578
91 Ga0395900_0186081 3300037418 Bacteria 2108
92 Ga0436361_0272905 3300039447 Bacteria 8081
93 Ga0436361_0684730 3300039447 Bacteria 6512
94 Ga0436361_0802941 3300039447 Bacteria 44636
95 Ga0439436_0019662 3300041404 Bacteria 2014
96 Ga0439466_0017765 3300041411 Bacteria 2558
97 Ga0439465_0018664 3300041413 Bacteria 2167
98 Ga0451576_0000728 3300045051 Bacteria 66112
99 Ga0451576_0277281 3300045051 Bacteria 1753
100 Ga0496121_0023381 3300048924 Bacteria 5954
101 Ga0496126_0230296 3300048929 Unclassified 1552
102 Ga0501031_0004927 3300049568 Bacteria 8677
103 Ga0501032_0058410 3300049569 Bacteria 2590
104 Ga0501033_0003346 3300049570 Bacteria 13239
105 Ga0501034_0001155 3300049571 Bacteria 36610
106 Ga0501034_0001184 3300049571 Bacteria 36033
107 Ga0501034_0015199 3300049571 Bacteria 7912
108 Ga0501034_0108091 3300049571 Bacteria 2773
109 Ga0501034_0144422 3300049571 Bacteria 2357
110 Ga0501034_0188536 3300049571 Bacteria 2025
111 Ga0501034_0255636 3300049571 Bacteria 1696
112 Ga0501038_0027793 3300049574 Bacteria 5028
113 Ga0501038_0127986 3300049574 Bacteria 2088
114 Ga0501039_0006724 3300049575 Bacteria 8749
115 Ga0501046_0006691 3300049580 Bacteria 10178
116 Ga0501067_0016987 3300049583 Bacteria 4020
117 Ga0501068_0002617 3300049584 Bacteria 9531
118 Ga0501068_0003406 3300049584 Bacteria 8553
119 Ga0501069_0001256 3300049585 Bacteria 12419
120 Ga0501070_0007366 3300049586 Bacteria 9343
121 Ga0501070_0181153 3300049586 Bacteria 1734
122 Ga0501072_0072490 3300049588 Bacteria 2722
123 Ga0501073_0003357 3300049589 Bacteria 12035
124 Ga0501073_0049146 3300049589 Bacteria 2958
125 Ga0501074_0039118 3300049590 Bacteria 3435
126 Ga0501080_0002543 3300049742 Bacteria 15958
127 Ga0501080_0046745 3300049742 Bacteria 4029
128 Ga0501080_0208343 3300049742 Bacteria 1792
129 Ga0501083_0000789 3300049744 Bacteria 20775
130 Ga0501083_0061235 3300049744 Bacteria 2513
131 Ga0501035_0008588 3300049822 Bacteria 9507
132 Ga0501035_0339021 3300049822 Bacteria 1260
133 Ga0501044_0008176 3300049823 Bacteria 11483
134 Ga0501044_0097045 3300049823 Bacteria 2969
135 nmdc:mga0yw44_14916_c1 3300050492 Bacteria 4144
136 nmdc:mga06z11_49426_c1 3300050494 Bacteria 2145
137 Ga0501082_0003890 3300060353 Bacteria 13040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0277281 Ga0451576_0277281_293_1420 313
2 3300006195 Ga0075366_10030211 Ga0075366_100302114 326
3 3300049583 Ga0501067_0016987 Ga0501067_0016987_13_1035 327
4 3300048929 Ga0496126_0230296 Ga0496126_0230296_15_1022 335
5 3300025923 Ga0207681_10266893 Ga0207681_102668932 337
6 3300025926 Ga0207659_10035801 Ga0207659_100358012 337
7 3300025940 Ga0207691_10178415 Ga0207691_101784152 337
8 3300006038 Ga0075365_10009158 Ga0075365_100091583 338
9 3300049571 Ga0501034_0001155 Ga0501034_0001155_7272_8342 338
10 3300049571 Ga0501034_0001184 Ga0501034_0001184_7689_8759 338
11 3300049584 Ga0501068_0003406 Ga0501068_0003406_2668_3738 338
12 3300049589 Ga0501073_0003357 Ga0501073_0003357_1364_2482 338
13 3300050492 nmdc:mga0yw44_14916_c1 nmdc:mga0yw44_14916_c1_1473_2540 338
14 3300050494 nmdc:mga06z11_49426_c1 nmdc:mga06z11_49426_c1_940_2007 338
15 3300025942 Ga0207689_10101045 Ga0207689_101010452 339
16 3300013104 Ga0157370_10302805 Ga0157370_103028051 341
17 3300049744 Ga0501083_0061235 Ga0501083_0061235_1153_2271 341
18 3300005530 Ga0070679_100047110 Ga0070679_1000471103 345
19 3300045051 Ga0451576_0000728 Ga0451576_0000728_54019_55119 345
20 3300005536 Ga0070697_100010490 Ga0070697_1000104905 346
21 3300049571 Ga0501034_0144422 Ga0501034_0144422_1082_2167 346
22 3300049586 Ga0501070_0181153 Ga0501070_0181153_452_1537 346
23 3300049589 Ga0501073_0049146 Ga0501073_0049146_1358_2443 346
24 3300002987 JGI25159J45721_1016567 JGI25159J45721_10165672 347
25 3300003187 JGI25151J46595_10000166 JGI25151J46595_1000016685 347
26 3300003187 JGI25151J46595_10002653 JGI25151J46595_100026536 347
27 3300005467 Ga0070706_100293316 Ga0070706_1002933162 347
28 3300025284 Ga0209130_1000422 Ga0209130_100042222 347
29 3300025294 Ga0209025_1000053 Ga0209025_1000053116 347
30 3300025297 Ga0209758_1002556 Ga0209758_10025567 347
31 3300025302 Ga0207426_1000198 Ga0207426_100019896 347
32 3300037068 Ga0373925_0202726 Ga0373925_0202726_59_1150 348
33 3300048924 Ga0496121_0023381 Ga0496121_0023381_4766_5812 348
34 3300025917 Ga0207660_10261125 Ga0207660_102611252 350
35 3300031852 Ga0307410_10231588 Ga0307410_102315882 350
36 3300006846 Ga0075430_100066162 Ga0075430_1000661622 351
37 3300039447 Ga0436361_0684730 Ga0436361_0684730_2749_3840 351
38 3300005458 Ga0070681_10031374 Ga0070681_100313742 356
39 3300025912 Ga0207707_10098987 Ga0207707_100989872 357
40 3300035170 Ga0373943_0180525 Ga0373943_0180525_20_1096 358
41 3300036401 Ga0373937_0230294 Ga0373937_0230294_518_1618 358
42 3300049742 Ga0501080_0046745 Ga0501080_0046745_2321_3724 360
43 iso_pu_bacteria 2919493220 2919496512 360
44 iso_pu_bacteria 2919543075 2919546892 360
45 iso_pu_bacteria 2923525760 2923526551 360
46 3300049570 Ga0501033_0003346 Ga0501033_0003346_6692_7822 363
47 3300049571 Ga0501034_0015199 Ga0501034_0015199_4406_5536 363
48 3300049571 Ga0501034_0255636 Ga0501034_0255636_533_1636 363
49 3300049574 Ga0501038_0027793 Ga0501038_0027793_3525_4655 363
50 3300049575 Ga0501039_0006724 Ga0501039_0006724_1245_2375 363
51 3300049580 Ga0501046_0006691 Ga0501046_0006691_2940_4070 363
52 3300049584 Ga0501068_0002617 Ga0501068_0002617_294_1424 363
53 3300049585 Ga0501069_0001256 Ga0501069_0001256_2570_3700 363
54 3300049586 Ga0501070_0007366 Ga0501070_0007366_4447_5577 363
55 3300049588 Ga0501072_0072490 Ga0501072_0072490_1393_2523 363
56 3300049742 Ga0501080_0002543 Ga0501080_0002543_8719_9849 363
57 3300049744 Ga0501083_0000789 Ga0501083_0000789_2249_3379 363
58 3300049822 Ga0501035_0008588 Ga0501035_0008588_6129_7259 363
59 3300049823 Ga0501044_0008176 Ga0501044_0008176_5204_6334 363
60 3300060353 Ga0501082_0003890 Ga0501082_0003890_1772_2902 363
61 iso_pu_bacteria 2510917030 2511200525 363
62 iso_pu_bacteria 2511231027 2511392154 363
63 iso_pu_bacteria 2512047086 2512534862 363
64 iso_pu_bacteria 2513237159 2513996268 363
65 iso_pu_bacteria 2582581283 2585164439 363
66 iso_pu_bacteria 2582581306 2585264737 363
67 iso_pu_bacteria 2582581865 2585386194 363
68 iso_pu_bacteria 2582581866 2585394806 363
69 iso_pu_bacteria 2643221607 2644051604 363
70 iso_pu_bacteria 2643221623 2644133874 363
71 iso_pu_bacteria 2643221636 2644200102 363
72 iso_pu_bacteria 2643221637 2644207254 363
73 iso_pu_bacteria 2643221686 2644480473 363
74 iso_pu_bacteria 2643221688 2644495433 363
75 iso_pu_bacteria 2643221689 2644498797 363
76 iso_pu_bacteria 2643221718 2644650902 363
77 iso_pu_bacteria 2738543024 2739307799 363
78 iso_pu_bacteria 2791355253 2793283111 363
79 iso_pu_bacteria 2791355263 2793341033 363
80 iso_pu_bacteria 2791355266 2793358534 363
81 iso_pu_bacteria 2802429606 2805934531 363
82 iso_pu_bacteria 2837678835 2837679254 363
83 iso_pu_bacteria 2838074704 2838074755 363
84 iso_pu_bacteria 2838680041 2838685581 363
85 iso_pu_bacteria 2838694306 2838695963 363
86 iso_pu_bacteria 2838707686 2838713362 363
87 iso_pu_bacteria 2842077413 2842082596 363
88 iso_pu_bacteria 2842118031 2842123845 363
89 iso_pu_bacteria 2842237096 2842242900 363
90 iso_pu_bacteria 2842285085 2842290057 363
91 iso_pu_bacteria 2842291075 2842296973 363
92 iso_pu_bacteria 2842370503 2842376033 363
93 iso_pu_bacteria 2842377471 2842383243 363
94 iso_pu_bacteria 2842384541 2842390376 363
95 iso_pu_bacteria 2842402390 2842407667 363
96 iso_pu_bacteria 2842409023 2842414298 363
97 iso_pu_bacteria 2842415677 2842420842 363
98 iso_pu_bacteria 2842482326 2842487258 363
99 iso_pu_bacteria 2842495871 2842501250 363
100 iso_pu_bacteria 2842521101 2842521226 363
101 iso_pu_bacteria 2894817345 2894817383 363
102 iso_pu_bacteria 2896384573 2896386091 363
103 iso_pu_bacteria 2919100787 2919101865 363
104 iso_pu_bacteria 2935894831 2935899981 363
105 iso_pu_bacteria 2936381700 2936385258 363
106 iso_pu_bacteria 8002285264 8002291076 363
107 iso_pu_bacteria 8005289223 8005291651 363
108 iso_pu_bacteria 8005395548 8005399611 363
109 iso_pu_bacteria 8045864390 8045866131 363
110 3300031251 Ga0265327_10107766 Ga0265327_101077662 364
111 3300031344 Ga0265316_10066922 Ga0265316_100669222 364
112 3300031730 Ga0307516_10013265 Ga0307516_100132655 364
113 iso_pu_bacteria 2524023250 2524612526 364
114 iso_pu_bacteria 2821443989 2821444387 364
115 iso_pu_bacteria 2844533157 2844539644 364
116 3300005289 Ga0065704_10118510 Ga0065704_101185102 366
117 3300005293 Ga0065715_10096064 Ga0065715_100960643 366
118 3300005437 Ga0070710_10018447 Ga0070710_100184473 366
119 3300005578 Ga0068854_100065337 Ga0068854_1000653372 366
120 3300005719 Ga0068861_100055804 Ga0068861_1000558043 366
121 3300005843 Ga0068860_100115623 Ga0068860_1001156232 366
122 3300005843 Ga0068860_100295280 Ga0068860_1002952802 366
123 3300005937 Ga0081455_10046690 Ga0081455_100466904 366
124 3300005983 Ga0081540_1009139 Ga0081540_10091392 366
125 3300009101 Ga0105247_10208323 Ga0105247_102083232 366
126 3300009148 Ga0105243_10059372 Ga0105243_100593722 366
127 3300010375 Ga0105239_10470429 Ga0105239_104704291 366
128 3300021361 Ga0213872_10000039 Ga0213872_1000003923 366
129 3300025986 Ga0207658_10169790 Ga0207658_101697902 366
130 3300028381 Ga0268264_10313269 Ga0268264_103132691 366
131 3300028573 Ga0265334_10005584 Ga0265334_100055844 366
132 3300031247 Ga0265340_10031569 Ga0265340_100315693 366
133 3300031711 Ga0265314_10074302 Ga0265314_100743022 366
134 3300035691 Ga0373931_0029392 Ga0373931_0029392_301_1413 366
135 3300039447 Ga0436361_0272905 Ga0436361_0272905_5132_6244 366
136 3300039447 Ga0436361_0802941 Ga0436361_0802941_18073_19185 366
137 iso_pu_bacteria 2511231221 2512036317 366
138 iso_pu_bacteria 2597490356 2599101554 366
139 iso_pu_bacteria 2842333319 2842338711 366
140 iso_pu_bacteria 2846952575 2846953721 366
141 iso_pu_bacteria 2848858292 2848860095 366
142 iso_pu_bacteria 8054002106 8054008454 366
143 3300002739 JGI25158J39367_1001549 JGI25158J39367_10015492 367
144 3300002773 JGI25152J39213_1008695 JGI25152J39213_10086951 367
145 3300002774 JGI25150J39212_1001258 JGI25150J39212_10012585 367
146 3300002987 JGI25159J45721_1000023 JGI25159J45721_1000023115 367
147 3300002987 JGI25159J45721_1001258 JGI25159J45721_10012589 367
148 3300003187 JGI25151J46595_10038753 JGI25151J46595_100387532 367
149 3300003203 JGI25406J46586_10019776 JGI25406J46586_100197762 367
150 3300003215 JGI25153J46596_10011407 JGI25153J46596_100114072 367
151 3300003215 JGI25153J46596_10020573 JGI25153J46596_100205731 367
152 3300003215 JGI25153J46596_10048083 JGI25153J46596_100480831 367
153 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007834 367
154 3300003775 Ga0055524_1004996 Ga0055524_10049963 367
155 3300003775 Ga0055524_1026541 Ga0055524_10265412 367
156 3300003790 Ga0055528_1020921 Ga0055528_10209212 367
157 3300004625 Ga0055543_1000069 Ga0055543_100006980 367
158 3300005262 Ga0065165_1028173 Ga0065165_10281731 367
159 3300005334 Ga0068869_100213316 Ga0068869_1002133162 367
160 3300005353 Ga0070669_100035500 Ga0070669_1000355002 367
161 3300005548 Ga0070665_100246844 Ga0070665_1002468442 367
162 3300006038 Ga0075365_10055511 Ga0075365_100555112 367
163 3300006178 Ga0075367_10115930 Ga0075367_101159302 367
164 3300021321 Ga0214542_1017381 Ga0214542_10173812 367
165 3300025208 Ga0209436_100268 Ga0209436_10026822 367
166 3300025245 Ga0207425_1003693 Ga0207425_10036934 367
167 3300025245 Ga0207425_1006012 Ga0207425_10060124 367
168 3300025258 Ga0209129_1001099 Ga0209129_10010996 367
169 3300025258 Ga0209129_1001848 Ga0209129_10018483 367
170 3300025258 Ga0209129_1002246 Ga0209129_10022469 367
171 3300025273 Ga0209673_1003397 Ga0209673_10033972 367
172 3300025284 Ga0209130_1000002 Ga0209130_1000002589 367
173 3300025294 Ga0209025_1022982 Ga0209025_10229822 367
174 3300025295 Ga0209564_1000262 Ga0209564_100026287 367
175 3300025297 Ga0209758_1000466 Ga0209758_100046613 367
176 3300025297 Ga0209758_1003684 Ga0209758_100368413 367
177 3300025302 Ga0207426_1000013 Ga0207426_1000013589 367
178 3300025923 Ga0207681_10093688 Ga0207681_100936882 367
179 3300025932 Ga0207690_10065197 Ga0207690_100651972 367
180 3300025972 Ga0207668_10227067 Ga0207668_102270672 367
181 3300028379 Ga0268266_10177041 Ga0268266_101770412 367
182 3300028794 Ga0307515_10000029 Ga0307515_10000029140 367
183 3300028794 Ga0307515_10011406 Ga0307515_100114066 367
184 3300031456 Ga0307513_10000259 Ga0307513_1000025915 367
185 3300032004 Ga0307414_10232634 Ga0307414_102326342 367
186 3300037418 Ga0395900_0186081 Ga0395900_0186081_935_2071 367
187 3300041404 Ga0439436_0019662 Ga0439436_0019662_69_1199 367
188 3300041411 Ga0439466_0017765 Ga0439466_0017765_1079_2212 367
189 3300041413 Ga0439465_0018664 Ga0439465_0018664_1008_2111 367
190 3300049568 Ga0501031_0004927 Ga0501031_0004927_4358_5497 367
191 3300049569 Ga0501032_0058410 Ga0501032_0058410_375_1511 367
192 3300049571 Ga0501034_0108091 Ga0501034_0108091_607_1746 367
193 3300049571 Ga0501034_0188536 Ga0501034_0188536_586_1725 367
194 3300049574 Ga0501038_0127986 Ga0501038_0127986_394_1533 367
195 3300049590 Ga0501074_0039118 Ga0501074_0039118_1311_2447 367
196 3300049742 Ga0501080_0208343 Ga0501080_0208343_100_1572 367
197 3300049822 Ga0501035_0339021 Ga0501035_0339021_13_1134 367
198 3300049823 Ga0501044_0097045 Ga0501044_0097045_859_1992 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

74

363

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5646 44 346
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5413 44 346
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5235 18 353
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5068 18 353
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5008 59 346
ID Description Score Start End Superfamily
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8169 58 346 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8102 58 346 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8084 58 346 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8065 58 345 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8048 58 346 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A847WW53-F1-model_v4 ABC transporter permease 0.9836 45 366 GO:0005886
GO:0022857
AF-A0A530BW04-F1-model_v4 ABC transporter permease 0.9799 45 364 GO:0005886
GO:0022857
AF-A0A531KKN4-F1-model_v4 ABC transporter permease 0.9757 62 257 GO:0005886
GO:0022857
AF-A0A847WV99-F1-model_v4 ABC transporter permease 0.9733 7 366 GO:0005886
GO:0022857
AF-A0A257AX25-F1-model_v4 Sugar ABC transporter permease 0.9728 19 328 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map