F303325

General Info

Members Datasets Scaffolds Average Seq Length
197 159 197 278

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0626203|Ga0436362_0626203_75_953
Length 292
Sequence MLIAEEILSSPKRENASSGKQENLFDLSGRVVLITGGAGLLGEQHARAIAGAGGIPVLLDIADLAAQKAETLAAEYGVPAFSRRTDITQASDLAGCLEDVLARFGRIDILINNAANNPMMESPGRVNFSRFENFPQEQWDADLSVGLTGAFLCSQVFGAEMARRGRGVIVNIASDLALIAPDQRIYRQPGVPEHLQPVKPVGYSVVKSGLIGLTRYLATYWADRGVRVNAISPGGVYNGQPDEFVAKLARLIPLGRMAKLNEYQGAILFLCSDASSYMTGANLVVDGGRTCW

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 1.02
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1802195 2162886012 Bacteria 3898
2 Ga0065715_10099534 3300005293 Bacteria 3391
3 Ga0065707_10092334 3300005295 Bacteria 3787
4 Ga0070676_10001108 3300005328 Bacteria 13459
5 Ga0070683_100038263 3300005329 Unclassified 4396
6 Ga0070670_100086794 3300005331 Bacteria 2689
7 Ga0070666_10181269 3300005335 Bacteria 1477
8 Ga0070682_100125137 3300005337 Bacteria 1731
9 Ga0068868_100031937 3300005338 Bacteria 4048
10 Ga0070689_100021620 3300005340 Unclassified 4792
11 Ga0070661_100002545 3300005344 Bacteria 12487
12 Ga0070692_10009951 3300005345 Bacteria 4308
13 Ga0070669_100020118 3300005353 Bacteria 4765
14 Ga0070675_100018308 3300005354 Bacteria 5575
15 Ga0070667_100021086 3300005367 Bacteria 5414
16 Ga0070709_10063550 3300005434 Bacteria 2358
17 Ga0070714_100177203 3300005435 Unclassified 1938
18 Ga0070714_100383965 3300005435 Unclassified 1325
19 Ga0070713_100353364 3300005436 Bacteria 1364
20 Ga0070710_10264477 3300005437 Bacteria 1110
21 Ga0070701_10002415 3300005438 Bacteria 7196
22 Ga0070694_100275772 3300005444 Bacteria 1280
23 Ga0070708_100015842 3300005445 Bacteria 6235
24 Ga0070662_100149760 3300005457 Bacteria 1815
25 Ga0070685_10235224 3300005466 Bacteria 1207
26 Ga0070707_100065504 3300005468 Unclassified 3490
27 Ga0070707_100317477 3300005468 Bacteria 1514
28 Ga0070698_100013315 3300005471 Bacteria 8704
29 Ga0070698_100114002 3300005471 Bacteria 2668
30 Ga0070699_100002944 3300005518 Bacteria 15139
31 Ga0070699_100127666 3300005518 Bacteria 2240
32 Ga0070679_100000142 3300005530 Bacteria 58286
33 Ga0070684_100021916 3300005535 Bacteria 5322
34 Ga0070697_100040172 3300005536 Bacteria 3784
35 Ga0070697_100056156 3300005536 Bacteria 3203
36 Ga0068853_100028748 3300005539 Bacteria 4679
37 Ga0068853_100569378 3300005539 Bacteria 1074
38 Ga0070672_100014740 3300005543 Bacteria 5545
39 Ga0070695_100082180 3300005545 Bacteria 2133
40 Ga0070695_100172344 3300005545 Bacteria 1527
41 Ga0070704_100004702 3300005549 Bacteria 7895
42 Ga0068855_100208531 3300005563 Bacteria 2197
43 Ga0070664_100014000 3300005564 Bacteria 6541
44 Ga0068856_100053360 3300005614 Unclassified 3985
45 Ga0068856_100054798 3300005614 Bacteria 3934
46 Ga0068859_100147087 3300005617 Bacteria 2431
47 Ga0068859_100387027 3300005617 Bacteria 1494
48 Ga0068859_100477775 3300005617 Bacteria 1342
49 Ga0068861_100007988 3300005719 Bacteria 7283
50 Ga0068863_100022939 3300005841 Bacteria 5965
51 Ga0068858_100023588 3300005842 Bacteria 5732
52 Ga0068860_100026507 3300005843 Bacteria 5587
53 Ga0068862_100038855 3300005844 Bacteria 4039
54 Ga0081539_10000001 3300005985 Bacteria 808331
55 Ga0070717_10000264 3300006028 Bacteria 35633
56 Ga0070717_10001184 3300006028 Bacteria 17662
57 Ga0070717_10009870 3300006028 Bacteria 7189
58 Ga0070717_10435276 3300006028 Bacteria 1181
59 Ga0075365_10093062 3300006038 Bacteria 2056
60 Ga0070716_100153643 3300006173 Unclassified 1483
61 Ga0070716_100186565 3300006173 Unclassified 1366
62 Ga0075428_100008166 3300006844 Bacteria 11616
63 Ga0075430_100040057 3300006846 Bacteria 3966
64 Ga0075433_10002584 3300006852 Bacteria 13799
65 Ga0075434_100008199 3300006871 Bacteria 9693
66 Ga0075434_100008612 3300006871 Bacteria 9498
67 Ga0075429_100224510 3300006880 Bacteria 1645
68 Ga0097620_100147093 3300006931 Bacteria 2431
69 Ga0097620_100387069 3300006931 Bacteria 1494
70 Ga0097620_100477749 3300006931 Bacteria 1342
71 Ga0111539_10169218 3300009094 Bacteria 2553
72 Ga0105245_10536668 3300009098 Unclassified 1190
73 Ga0114129_10448054 3300009147 Bacteria 1693
74 Ga0114129_10684474 3300009147 Bacteria 1320
75 Ga0105242_10101451 3300009176 Bacteria 2439
76 Ga0105248_10020778 3300009177 Bacteria 7274
77 Ga0105237_10000132 3300009545 Bacteria 104708
78 Ga0105237_10015694 3300009545 Bacteria 7875
79 Ga0105237_10071390 3300009545 Unclassified 3467
80 Ga0105238_10015666 3300009551 Bacteria 7675
81 Ga0105238_10222216 3300009551 Bacteria 1865
82 Ga0105249_10066543 3300009553 Bacteria 3318
83 Ga0105239_10102670 3300010375 Bacteria 3164
84 Ga0157373_10094441 3300013100 Bacteria 2106
85 Ga0157371_10010922 3300013102 Bacteria 7040
86 Ga0157370_10532002 3300013104 Bacteria 1078
87 Ga0157369_10929921 3300013105 Bacteria 891
88 Ga0157374_10020968 3300013296 Bacteria 5807
89 Ga0157374_10189456 3300013296 Bacteria 2012
90 Ga0157374_10738241 3300013296 Bacteria 999
91 Ga0163162_10008635 3300013306 Bacteria 9925
92 Ga0163162_10073837 3300013306 Bacteria 3468
93 Ga0157372_10115282 3300013307 Bacteria 3080
94 Ga0157372_10133358 3300013307 Unclassified 2859
95 Ga0157375_10001760 3300013308 Bacteria 18571
96 Ga0163163_10004771 3300014325 Bacteria 11633
97 Ga0157380_10013894 3300014326 Bacteria 5880
98 Ga0157379_10004432 3300014968 Bacteria 12034
99 Ga0213876_10011530 3300021384 Bacteria 4717
100 Ga0209233_1022174 3300025261 Bacteria 1630
101 Ga0207697_10019561 3300025315 Bacteria 2774
102 Ga0207647_10062311 3300025904 Bacteria 2273
103 Ga0207699_10063817 3300025906 Unclassified 2226
104 Ga0207645_10001194 3300025907 Bacteria 21429
105 Ga0207671_10000086 3300025914 Bacteria 142010
106 Ga0207671_10044232 3300025914 Unclassified 3293
107 Ga0207671_10108046 3300025914 Bacteria 2114
108 Ga0207649_10064482 3300025920 Bacteria 2316
109 Ga0207652_10001034 3300025921 Bacteria 25483
110 Ga0207646_10037585 3300025922 Bacteria 4365
111 Ga0207646_10111508 3300025922 Unclassified 2455
112 Ga0207681_10201229 3300025923 Bacteria 1529
113 Ga0207694_10008863 3300025924 Bacteria 7589
114 Ga0207687_10232317 3300025927 Bacteria 1457
115 Ga0207700_10133751 3300025928 Bacteria 2028
116 Ga0207700_10543267 3300025928 Bacteria 1031
117 Ga0207664_10085460 3300025929 Bacteria 2575
118 Ga0207664_10101571 3300025929 Bacteria 2377
119 Ga0207690_10067814 3300025932 Bacteria 2448
120 Ga0207706_10004481 3300025933 Bacteria 13124
121 Ga0207704_10040468 3300025938 Bacteria 2725
122 Ga0207665_10057513 3300025939 Unclassified 2627
123 Ga0207691_10002857 3300025940 Bacteria 16817
124 Ga0207711_10421009 3300025941 Bacteria 1242
125 Ga0207689_10028787 3300025942 Bacteria 4645
126 Ga0207661_10089524 3300025944 Unclassified 2561
127 Ga0207679_10002195 3300025945 Bacteria 12075
128 Ga0207712_10031456 3300025961 Bacteria 3575
129 Ga0207712_10106433 3300025961 Bacteria 2095
130 Ga0207677_10076303 3300026023 Bacteria 2385
131 Ga0207703_10068615 3300026035 Bacteria 2922
132 Ga0207639_10060278 3300026041 Bacteria 2927
133 Ga0207702_10030763 3300026078 Unclassified 4472
134 Ga0207641_10440657 3300026088 Bacteria 1257
135 Ga0207674_10002355 3300026116 Bacteria 23898
136 Ga0207675_100000197 3300026118 Bacteria 55600
137 Ga0207428_10256384 3300027907 Bacteria 1303
138 Ga0268264_10255653 3300028381 Bacteria 1629
139 Ga0265338_10040850 3300028800 Bacteria 4350
140 Ga0265325_10009391 3300031241 Bacteria 5710
141 Ga0265339_10202125 3300031249 Bacteria 980
142 Ga0265331_10080465 3300031250 Bacteria 1514
143 Ga0265316_10044182 3300031344 Unclassified 3545
144 Ga0265316_10139125 3300031344 Bacteria 1825
145 Ga0307408_100020455 3300031548 Bacteria 4468
146 Ga0307408_100068335 3300031548 Bacteria 2616
147 Ga0307516_10004692 3300031730 Bacteria 16719
148 Ga0307413_10078663 3300031824 Bacteria 2105
149 Ga0307410_10031030 3300031852 Bacteria 3424
150 Ga0307406_10007451 3300031901 Bacteria 6067
151 Ga0307406_10078758 3300031901 Bacteria 2184
152 Ga0307409_100069002 3300031995 Bacteria 2798
153 Ga0307414_10206014 3300032004 Bacteria 1604
154 Ga0373947_0112796 3300035725 Bacteria 1720
155 Ga0373925_0048054 3300037068 Bacteria 3178
156 Ga0395899_0033832 3300037312 Bacteria 3838
157 Ga0395899_0063404 3300037312 Bacteria 2719
158 Ga0395898_0420181 3300037466 Bacteria 1274
159 Ga0436364_1414125 3300037853 Bacteria 18149
160 Ga0436365_0857793 3300039437 Bacteria 7840
161 Ga0436362_0626203 3300039453 Bacteria 1015
162 Ga0439431_0004629 3300041997 Bacteria 3023
163 Ga0439433_0020129 3300041999 Bacteria 1489
164 Ga0439446_0026910 3300042156 Bacteria 1649
165 Ga0439434_0013604 3300042435 Bacteria 2416
166 Ga0439435_0000921 3300042436 Bacteria 5091
167 Ga0453684_0051652 3300044712 Bacteria 5386
168 Ga0451576_0141120 3300045051 Bacteria 2512
169 Ga0466967_0114247 3300045976 Bacteria 2485
170 Ga0495623_0102129 3300046679 Unclassified 1746
171 Ga0495647_0044408 3300046681 Bacteria 1704
172 Ga0495613_0010359 3300046689 Bacteria 6926
173 Ga0495613_0308070 3300046689 Bacteria 1095
174 Ga0495674_0078668 3300047319 Bacteria 2833
175 Ga0495684_0040500 3300047471 Unclassified 3571
176 Ga0495684_0336396 3300047471 Bacteria 1076
177 Ga0495686_0007082 3300047472 Bacteria 8453
178 Ga0496104_0213205 3300048907 Bacteria 1843
179 Ga0496112_0334684 3300048915 Bacteria 1458
180 Ga0496119_0061203 3300048922 Bacteria 2250
181 Ga0496122_0210656 3300048925 Bacteria 1126
182 Ga0501031_0057465 3300049568 Bacteria 2535
183 Ga0501032_0041906 3300049569 Unclassified 3107
184 Ga0501032_0080335 3300049569 Bacteria 2170
185 Ga0501033_0072947 3300049570 Bacteria 2520
186 Ga0501036_0127625 3300049572 Bacteria 2148
187 Ga0501037_0002765 3300049573 Bacteria 12685
188 Ga0501039_0019653 3300049575 Bacteria 5179
189 Ga0501041_0004584 3300049577 Bacteria 8017
190 Ga0501070_0157761 3300049586 Bacteria 1871
191 Ga0501080_0370567 3300049742 Bacteria 1291
192 Ga0501035_0147149 3300049822 Bacteria 2045
193 Ga0501044_0038811 3300049823 Bacteria 4972
194 nmdc:mga06r32_317710_c1 3300050510 Bacteria 1543
195 nmdc:mga08y16_129029_c1 3300050511 Bacteria 2630
196 nmdc:mga0n895_126948_c1 3300050512 Bacteria 2575
197 nmdc:mga0a205_8771_c1 3300050515 Bacteria 9211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0020129 Ga0439433_0020129_766_1395 209
2 3300025928 Ga0207700_10543267 Ga0207700_105432672 228
3 3300047471 Ga0495684_0336396 Ga0495684_0336396_11_739 242
4 3300009098 Ga0105245_10536668 Ga0105245_105366681 250
5 3300031548 Ga0307408_100020455 Ga0307408_1000204552 253
6 3300031901 Ga0307406_10007451 Ga0307406_100074513 253
7 3300005471 Ga0070698_100114002 Ga0070698_1001140022 254
8 3300009147 Ga0114129_10684474 Ga0114129_106844741 255
9 3300037466 Ga0395898_0420181 Ga0395898_0420181_452_1222 255
10 3300005617 Ga0068859_100477775 Ga0068859_1004777752 257
11 3300006931 Ga0097620_100477749 Ga0097620_1004777492 257
12 3300009553 Ga0105249_10066543 Ga0105249_100665432 257
13 3300041997 Ga0439431_0004629 Ga0439431_0004629_462_1286 258
14 3300048907 Ga0496104_0213205 Ga0496104_0213205_730_1569 260
15 3300006038 Ga0075365_10093062 Ga0075365_100930622 265
16 3300037068 Ga0373925_0048054 Ga0373925_0048054_863_1663 266
17 3300049569 Ga0501032_0041906 Ga0501032_0041906_625_1428 267
18 3300049573 Ga0501037_0002765 Ga0501037_0002765_11315_12118 267
19 3300049575 Ga0501039_0019653 Ga0501039_0019653_3862_4665 267
20 3300049577 Ga0501041_0004584 Ga0501041_0004584_2409_3212 267
21 3300049822 Ga0501035_0147149 Ga0501035_0147149_961_1764 267
22 3300005444 Ga0070694_100275772 Ga0070694_1002757722 268
23 3300005549 Ga0070704_100004702 Ga0070704_1000047027 268
24 3300005536 Ga0070697_100056156 Ga0070697_1000561563 269
25 3300031249 Ga0265339_10202125 Ga0265339_102021252 270
26 3300005445 Ga0070708_100015842 Ga0070708_1000158422 271
27 3300005545 Ga0070695_100082180 Ga0070695_1000821802 271
28 3300005617 Ga0068859_100387027 Ga0068859_1003870272 271
29 3300006931 Ga0097620_100387069 Ga0097620_1003870692 271
30 3300009545 Ga0105237_10015694 Ga0105237_100156944 271
31 3300014325 Ga0163163_10004771 Ga0163163_100047719 271
32 3300025914 Ga0207671_10044232 Ga0207671_100442322 271
33 3300046679 Ga0495623_0102129 Ga0495623_0102129_853_1683 271
34 3300047319 Ga0495674_0078668 Ga0495674_0078668_1992_2822 271
35 3300047471 Ga0495684_0040500 Ga0495684_0040500_881_1711 271
36 3300049568 Ga0501031_0057465 Ga0501031_0057465_1490_2314 271
37 3300049569 Ga0501032_0080335 Ga0501032_0080335_547_1371 271
38 3300049570 Ga0501033_0072947 Ga0501033_0072947_23_847 271
39 3300049572 Ga0501036_0127625 Ga0501036_0127625_465_1289 271
40 3300049586 Ga0501070_0157761 Ga0501070_0157761_458_1282 271
41 3300049823 Ga0501044_0038811 Ga0501044_0038811_1766_2590 271
42 3300005337 Ga0070682_100125137 Ga0070682_1001251371 272
43 3300005518 Ga0070699_100127666 Ga0070699_1001276663 273
44 3300009545 Ga0105237_10000132 Ga0105237_1000013256 273
45 3300009551 Ga0105238_10015666 Ga0105238_100156665 273
46 3300013296 Ga0157374_10020968 Ga0157374_100209683 273
47 3300025914 Ga0207671_10000086 Ga0207671_1000008694 273
48 3300025924 Ga0207694_10008863 Ga0207694_100088635 273
49 3300037312 Ga0395899_0063404 Ga0395899_0063404_560_1381 273
50 3300045976 Ga0466967_0114247 Ga0466967_0114247_1113_1934 273
51 3300049742 Ga0501080_0370567 Ga0501080_0370567_318_1145 273
52 3300005471 Ga0070698_100013315 Ga0070698_1000133154 274
53 3300005518 Ga0070699_100002944 Ga0070699_1000029445 274
54 3300025961 Ga0207712_10106433 Ga0207712_101064332 274
55 3300031730 Ga0307516_10004692 Ga0307516_1000469213 274
56 3300045051 Ga0451576_0141120 Ga0451576_0141120_1107_1937 274
57 3300048915 Ga0496112_0334684 Ga0496112_0334684_77_901 274
58 3300005293 Ga0065715_10099534 Ga0065715_100995341 275
59 3300005536 Ga0070697_100040172 Ga0070697_1000401722 275
60 3300031344 Ga0265316_10044182 Ga0265316_100441822 275
61 3300042156 Ga0439446_0026910 Ga0439446_0026910_98_928 275
62 3300042435 Ga0439434_0013604 Ga0439434_0013604_659_1489 275
63 3300042436 Ga0439435_0000921 Ga0439435_0000921_451_1281 275
64 3300005468 Ga0070707_100317477 Ga0070707_1003174772 276
65 3300005985 Ga0081539_10000001 Ga0081539_10000001318 276
66 3300025922 Ga0207646_10037585 Ga0207646_100375852 276
67 3300037312 Ga0395899_0033832 Ga0395899_0033832_2347_3186 276
68 3300037853 Ga0436364_1414125 Ga0436364_1414125_16340_17236 276
69 3300044712 Ga0453684_0051652 Ga0453684_0051652_1404_2237 276
70 3300046681 Ga0495647_0044408 Ga0495647_0044408_295_1125 276
71 3300046689 Ga0495613_0308070 Ga0495613_0308070_169_999 276
72 3300005435 Ga0070714_100383965 Ga0070714_1003839652 277
73 3300006028 Ga0070717_10001184 Ga0070717_1000118410 277
74 3300006173 Ga0070716_100186565 Ga0070716_1001865651 277
75 3300013104 Ga0157370_10532002 Ga0157370_105320021 277
76 3300013105 Ga0157369_10929921 Ga0157369_109299211 277
77 3300014968 Ga0157379_10004432 Ga0157379_100044328 277
78 3300025939 Ga0207665_10057513 Ga0207665_100575133 277
79 3300048922 Ga0496119_0061203 Ga0496119_0061203_1020_1853 277
80 3300048925 Ga0496122_0210656 Ga0496122_0210656_27_866 277
81 3300006028 Ga0070717_10000264 Ga0070717_1000026417 278
82 3300009551 Ga0105238_10222216 Ga0105238_102222162 278
83 3300031548 Ga0307408_100068335 Ga0307408_1000683352 278
84 3300031824 Ga0307413_10078663 Ga0307413_100786632 278
85 3300031852 Ga0307410_10031030 Ga0307410_100310303 278
86 3300031901 Ga0307406_10078758 Ga0307406_100787582 278
87 3300031995 Ga0307409_100069002 Ga0307409_1000690022 278
88 3300032004 Ga0307414_10206014 Ga0307414_102060142 278
89 3300021384 Ga0213876_10011530 Ga0213876_100115304 279
90 3300039437 Ga0436365_0857793 Ga0436365_0857793_407_1246 279
91 3300025261 Ga0209233_1022174 Ga0209233_10221742 280
92 3300028800 Ga0265338_10040850 Ga0265338_100408504 280
93 3300031241 Ga0265325_10009391 Ga0265325_100093912 280
94 3300047472 Ga0495686_0007082 Ga0495686_0007082_3635_4480 280
95 3300005530 Ga0070679_100000142 Ga0070679_1000001428 281
96 3300006028 Ga0070717_10009870 Ga0070717_100098705 281
97 3300025921 Ga0207652_10001034 Ga0207652_1000103421 281
98 3300031250 Ga0265331_10080465 Ga0265331_100804652 281
99 3300005435 Ga0070714_100177203 Ga0070714_1001772032 282
100 3300009176 Ga0105242_10101451 Ga0105242_101014512 282
101 3300005329 Ga0070683_100038263 Ga0070683_1000382634 283
102 3300005434 Ga0070709_10063550 Ga0070709_100635502 283
103 3300005436 Ga0070713_100353364 Ga0070713_1003533642 283
104 3300005437 Ga0070710_10264477 Ga0070710_102644771 283
105 3300005539 Ga0068853_100569378 Ga0068853_1005693782 283
106 3300005614 Ga0068856_100054798 Ga0068856_1000547984 283
107 3300009545 Ga0105237_10071390 Ga0105237_100713901 283
108 3300013296 Ga0157374_10738241 Ga0157374_107382411 283
109 3300013306 Ga0163162_10073837 Ga0163162_100738372 283
110 3300013307 Ga0157372_10115282 Ga0157372_101152822 283
111 3300013307 Ga0157372_10133358 Ga0157372_101333582 283
112 3300025906 Ga0207699_10063817 Ga0207699_100638172 283
113 3300025914 Ga0207671_10108046 Ga0207671_101080463 283
114 3300025928 Ga0207700_10133751 Ga0207700_101337512 283
115 3300025929 Ga0207664_10085460 Ga0207664_100854602 283
116 3300025929 Ga0207664_10101571 Ga0207664_101015713 283
117 3300025944 Ga0207661_10089524 Ga0207661_100895243 283
118 3300031344 Ga0265316_10139125 Ga0265316_101391252 283
119 3300039453 Ga0436362_0626203 Ga0436362_0626203_75_953 283
120 2162886012 MBSR1b_contig_1802195 MBSR1b_0342.00003320 284
121 3300005295 Ga0065707_10092334 Ga0065707_100923343 284
122 3300005328 Ga0070676_10001108 Ga0070676_100011086 284
123 3300005331 Ga0070670_100086794 Ga0070670_1000867942 284
124 3300005335 Ga0070666_10181269 Ga0070666_101812692 284
125 3300005338 Ga0068868_100031937 Ga0068868_1000319372 284
126 3300005340 Ga0070689_100021620 Ga0070689_1000216202 284
127 3300005344 Ga0070661_100002545 Ga0070661_1000025456 284
128 3300005345 Ga0070692_10009951 Ga0070692_100099513 284
129 3300005353 Ga0070669_100020118 Ga0070669_1000201183 284
130 3300005354 Ga0070675_100018308 Ga0070675_1000183084 284
131 3300005367 Ga0070667_100021086 Ga0070667_1000210864 284
132 3300005438 Ga0070701_10002415 Ga0070701_100024153 284
133 3300005457 Ga0070662_100149760 Ga0070662_1001497602 284
134 3300005466 Ga0070685_10235224 Ga0070685_102352241 284
135 3300005468 Ga0070707_100065504 Ga0070707_1000655043 284
136 3300005535 Ga0070684_100021916 Ga0070684_1000219164 284
137 3300005539 Ga0068853_100028748 Ga0068853_1000287482 284
138 3300005543 Ga0070672_100014740 Ga0070672_1000147405 284
139 3300005545 Ga0070695_100172344 Ga0070695_1001723442 284
140 3300005563 Ga0068855_100208531 Ga0068855_1002085311 284
141 3300005564 Ga0070664_100014000 Ga0070664_1000140006 284
142 3300005614 Ga0068856_100053360 Ga0068856_1000533604 284
143 3300005617 Ga0068859_100147087 Ga0068859_1001470872 284
144 3300005719 Ga0068861_100007988 Ga0068861_1000079884 284
145 3300005841 Ga0068863_100022939 Ga0068863_1000229392 284
146 3300005842 Ga0068858_100023588 Ga0068858_1000235884 284
147 3300005843 Ga0068860_100026507 Ga0068860_1000265074 284
148 3300005844 Ga0068862_100038855 Ga0068862_1000388553 284
149 3300006028 Ga0070717_10435276 Ga0070717_104352762 284
150 3300006173 Ga0070716_100153643 Ga0070716_1001536432 284
151 3300006844 Ga0075428_100008166 Ga0075428_1000081662 284
152 3300006846 Ga0075430_100040057 Ga0075430_1000400572 284
153 3300006852 Ga0075433_10002584 Ga0075433_100025846 284
154 3300006871 Ga0075434_100008199 Ga0075434_1000081994 284
155 3300006871 Ga0075434_100008612 Ga0075434_1000086122 284
156 3300006880 Ga0075429_100224510 Ga0075429_1002245102 284
157 3300006931 Ga0097620_100147093 Ga0097620_1001470932 284
158 3300009094 Ga0111539_10169218 Ga0111539_101692182 284
159 3300009147 Ga0114129_10448054 Ga0114129_104480542 284
160 3300009177 Ga0105248_10020778 Ga0105248_100207784 284
161 3300010375 Ga0105239_10102670 Ga0105239_101026703 284
162 3300013100 Ga0157373_10094441 Ga0157373_100944412 284
163 3300013102 Ga0157371_10010922 Ga0157371_100109223 284
164 3300013296 Ga0157374_10189456 Ga0157374_101894562 284
165 3300013306 Ga0163162_10008635 Ga0163162_100086352 284
166 3300013308 Ga0157375_10001760 Ga0157375_100017606 284
167 3300014326 Ga0157380_10013894 Ga0157380_100138944 284
168 3300025315 Ga0207697_10019561 Ga0207697_100195613 284
169 3300025904 Ga0207647_10062311 Ga0207647_100623112 284
170 3300025907 Ga0207645_10001194 Ga0207645_100011948 284
171 3300025920 Ga0207649_10064482 Ga0207649_100644822 284
172 3300025922 Ga0207646_10111508 Ga0207646_101115082 284
173 3300025923 Ga0207681_10201229 Ga0207681_102012292 284
174 3300025927 Ga0207687_10232317 Ga0207687_102323172 284
175 3300025932 Ga0207690_10067814 Ga0207690_100678142 284
176 3300025933 Ga0207706_10004481 Ga0207706_100044812 284
177 3300025938 Ga0207704_10040468 Ga0207704_100404682 284
178 3300025940 Ga0207691_10002857 Ga0207691_100028577 284
179 3300025941 Ga0207711_10421009 Ga0207711_104210092 284
180 3300025942 Ga0207689_10028787 Ga0207689_100287872 284
181 3300025945 Ga0207679_10002195 Ga0207679_100021958 284
182 3300025961 Ga0207712_10031456 Ga0207712_100314563 284
183 3300026023 Ga0207677_10076303 Ga0207677_100763032 284
184 3300026035 Ga0207703_10068615 Ga0207703_100686153 284
185 3300026041 Ga0207639_10060278 Ga0207639_100602782 284
186 3300026078 Ga0207702_10030763 Ga0207702_100307632 284
187 3300026088 Ga0207641_10440657 Ga0207641_104406571 284
188 3300026116 Ga0207674_10002355 Ga0207674_100023559 284
189 3300026118 Ga0207675_100000197 Ga0207675_10000019734 284
190 3300027907 Ga0207428_10256384 Ga0207428_102563841 284
191 3300028381 Ga0268264_10255653 Ga0268264_102556532 284
192 3300035725 Ga0373947_0112796 Ga0373947_0112796_281_1147 284
193 3300046689 Ga0495613_0010359 Ga0495613_0010359_5633_6499 284
194 3300050510 nmdc:mga06r32_317710_c1 nmdc:mga06r32_317710_c1_190_1044 284
195 3300050511 nmdc:mga08y16_129029_c1 nmdc:mga08y16_129029_c1_937_1791 284
196 3300050512 nmdc:mga0n895_126948_c1 nmdc:mga0n895_126948_c1_703_1557 284
197 3300050515 nmdc:mga0a205_8771_c1 nmdc:mga0a205_8771_c1_826_1680 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

193

290

0.93

PF00106

adh_short

short chain dehydrogenase

30

186

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

188

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ucw-assembly1.cif.gz_B structure of mouse decr1 in complex with 2'-5' oligoadenylate 0.9571 18 283
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.952 18 284
3sj7-assembly1.cif.gz_A-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9502 21 281
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9482 18 284
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9481 18 281
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 18 284 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 18 282 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 19 281 3.40.50.720
3r1iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 15 284 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9386 21 52 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A380F3U9-F1-model_v4 deleted 0.9772 11 100
AF-A0A2V9XNX9-F1-model_v4 Methyltransferase FkbM domain-containing protein 0.9679 105 283 GO:0016616
AF-A0A2D4QZQ0-F1-model_v4 Short-chain dehydrogenase 0.962 16 107 GO:0016491
AF-A0A4Q3Q7C0-F1-model_v4 deleted 0.9548 6 222
AF-A0A7X8U852-F1-model_v4 SDR family oxidoreductase 0.9537 9 284 GO:0016616

Feature Viewer

pLDDT pTM Quality
91.93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map