F303100

General Info

Members Datasets Scaffolds Average Seq Length
197 155 186 128

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10093738|Ga0207647_100937382
Length 148
Sequence MPWSKDELERIAATDDLHISPLRDDGVTLGTPTWIWSVVADGALYVRGYNGQQSRWYQAAITQKAGRITAAGMTRDVTFEAVEGSVNARIDDAYRAKYKASPYLAPMIAARARAATVRIIDPKTSIFSVIEYAAPPPRFRKLMRVIWS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
6 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
7 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
8 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
9 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
10 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
11 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0
Isolates 5.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.66
Nodule 3.05
Rhizoplane 5.58
Rhizosphere 70.56
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10130777 3300001989 Bacteria 747
2 JGI25152J39213_1000045 3300002773 Bacteria 86127
3 JGI25151J46595_10040562 3300003187 Bacteria 1703
4 rootH2_10347491 3300003320 Unclassified 1670
5 Ga0055539_1031681 3300003752 Bacteria 597
6 Ga0055529_1019606 3300003763 Bacteria 845
7 Ga0070658_10066277 3300005327 Bacteria 2950
8 Ga0070658_10073179 3300005327 Bacteria 2810
9 Ga0070660_100143682 3300005339 Bacteria 1916
10 Ga0070660_100954859 3300005339 Bacteria 724
11 Ga0070709_10988922 3300005434 Bacteria 669
12 Ga0070678_100932802 3300005456 Bacteria 795
13 Ga0070679_100023165 3300005530 Bacteria 6076
14 Ga0070684_100600628 3300005535 Unclassified 1023
15 Ga0068853_100145807 3300005539 Bacteria 2127
16 Ga0070665_100005484 3300005548 Bacteria 13076
17 Ga0070665_100959026 3300005548 Bacteria 868
18 Ga0070665_102615231 3300005548 Unclassified 505
19 Ga0068855_100462251 3300005563 Bacteria 1384
20 Ga0068857_102454158 3300005577 Bacteria 512
21 Ga0068854_100342770 3300005578 Bacteria 1221
22 Ga0068852_100633671 3300005616 Bacteria 1075
23 Ga0068852_100848872 3300005616 Bacteria 929
24 Ga0068851_10482950 3300005834 Bacteria 741
25 Ga0068863_100124345 3300005841 Bacteria 2461
26 Ga0081455_10234985 3300005937 Bacteria 1350
27 Ga0081455_10607827 3300005937 Bacteria 711
28 Ga0070717_10849417 3300006028 Bacteria 831
29 Ga0075365_10025388 3300006038 Bacteria 3750
30 Ga0075363_100030989 3300006048 Bacteria 2771
31 Ga0075364_10049081 3300006051 Bacteria 2752
32 Ga0075367_10029533 3300006178 Bacteria 3137
33 Ga0075370_10080732 3300006353 Bacteria 1869
34 Ga0075431_100001447 3300006847 Bacteria 21867
35 Ga0105251_10193094 3300009011 Bacteria 917
36 Ga0105240_10240224 3300009093 Bacteria 2100
37 Ga0105240_10819964 3300009093 Bacteria 1006
38 Ga0105240_11199141 3300009093 Bacteria 804
39 Ga0105240_11557651 3300009093 Bacteria 692
40 Ga0105247_11480908 3300009101 Bacteria 553
41 Ga0105248_10773675 3300009177 Bacteria 1083
42 Ga0105248_10917782 3300009177 Bacteria 989
43 Ga0105237_10660514 3300009545 Bacteria 1052
44 Ga0105238_10018239 3300009551 Bacteria 7138
45 Ga0105238_12109569 3300009551 Bacteria 598
46 Ga0105239_10096067 3300010375 Bacteria 3274
47 Ga0105239_10104298 3300010375 Bacteria 3139
48 Ga0105239_10264216 3300010375 Bacteria 1935
49 Ga0105239_10476269 3300010375 Bacteria 1418
50 Ga0105246_11007134 3300011119 Bacteria 755
51 Ga0157373_10013388 3300013100 Bacteria 6017
52 Ga0157370_10212316 3300013104 Bacteria 1794
53 Ga0157369_10056600 3300013105 Bacteria 4231
54 Ga0157369_10341141 3300013105 Bacteria 1556
55 Ga0157374_10055961 3300013296 Bacteria 3682
56 Ga0157374_10447114 3300013296 Bacteria 1293
57 Ga0163162_10166968 3300013306 Bacteria 2325
58 Ga0163162_12414055 3300013306 Bacteria 604
59 Ga0157372_10288304 3300013307 Bacteria 1909
60 Ga0157372_10791627 3300013307 Unclassified 1102
61 Ga0157372_11558452 3300013307 Bacteria 761
62 Ga0157375_10140732 3300013308 Bacteria 2540
63 Ga0157375_11978641 3300013308 Bacteria 692
64 Ga0163163_10323394 3300014325 Bacteria 1596
65 Ga0157379_10021548 3300014968 Bacteria 5706
66 Ga0157376_10834021 3300014969 Bacteria 936
67 Ga0182006_1021205 3300015261 Bacteria 2712
68 Ga0182007_10035742 3300015262 Bacteria 1674
69 Ga0163161_10444513 3300017792 Bacteria 1047
70 Ga0213872_10280912 3300021361 Bacteria 695
71 Ga0207425_1002275 3300025245 Bacteria 6917
72 Ga0209026_1001055 3300025250 Bacteria 13416
73 Ga0209677_100582 3300025253 Bacteria 19990
74 Ga0209148_1007992 3300025254 Bacteria 2155
75 Ga0209129_1000068 3300025258 Bacteria 217385
76 Ga0209233_1003460 3300025261 Bacteria 5561
77 Ga0209455_1003568 3300025272 Bacteria 5433
78 Ga0209025_1000045 3300025294 Bacteria 349118
79 Ga0207426_1104337 3300025302 Bacteria 726
80 Ga0207656_10420069 3300025321 Bacteria 674
81 Ga0207680_10792515 3300025903 Bacteria 679
82 Ga0207647_10093738 3300025904 Bacteria 1789
83 Ga0207705_10047330 3300025909 Bacteria 3093
84 Ga0207705_10312956 3300025909 Bacteria 1205
85 Ga0207654_10165814 3300025911 Bacteria 1430
86 Ga0207707_11406846 3300025912 Unclassified 556
87 Ga0207695_10411608 3300025913 Bacteria 1237
88 Ga0207695_10445719 3300025913 Bacteria 1178
89 Ga0207695_11012978 3300025913 Bacteria 710
90 Ga0207695_11425268 3300025913 Bacteria 573
91 Ga0207657_10605837 3300025919 Bacteria 854
92 Ga0207652_10723293 3300025921 Unclassified 887
93 Ga0207694_10171266 3300025924 Bacteria 1758
94 Ga0207694_11127918 3300025924 Bacteria 664
95 Ga0207644_11089944 3300025931 Bacteria 671
96 Ga0207658_10756983 3300025986 Bacteria 880
97 Ga0207658_11594083 3300025986 Bacteria 597
98 Ga0207639_10085752 3300026041 Bacteria 2505
99 Ga0207678_10203713 3300026067 Bacteria 1692
100 Ga0207702_10331517 3300026078 Bacteria 1452
101 Ga0207702_10995795 3300026078 Bacteria 831
102 Ga0207641_10180529 3300026088 Bacteria 1933
103 Ga0207674_10195840 3300026116 Bacteria 1970
104 Ga0268266_10020062 3300028379 Bacteria 5698
105 Ga0268266_10093780 3300028379 Bacteria 2634
106 Ga0268266_10322220 3300028379 Bacteria 1447
107 Ga0268266_10655929 3300028379 Bacteria 1010
108 Ga0265318_10049103 3300028577 Bacteria 1588
109 Ga0265320_10021815 3300031240 Bacteria 3439
110 Ga0265339_10317758 3300031249 Bacteria 739
111 Ga0265331_10024889 3300031250 Bacteria 3025
112 Ga0265313_10177511 3300031595 Bacteria 896
113 Ga0373955_0860050 3300035172 Bacteria 558
114 Ga0316574_0234143 3300035398 Bacteria 1175
115 Ga0373927_0116313 3300035695 Bacteria 1744
116 Ga0373927_0133038 3300035695 Bacteria 1625
117 Ga0373933_0014606 3300035724 Bacteria 4371
118 Ga0373947_0091114 3300035725 Bacteria 1902
119 Ga0373937_0020755 3300036401 Bacteria 5892
120 Ga0373925_1177429 3300037068 Unclassified 630
121 Ga0395898_1663186 3300037466 Bacteria 562
122 Ga0436364_0646369 3300037853 Unclassified 988
123 Ga0436364_1335582 3300037853 Unclassified 1649
124 Ga0395901_0001632 3300038443 Bacteria 23197
125 Ga0436365_0187654 3300039437 Unclassified 818
126 Ga0436361_0758217 3300039447 Bacteria 836
127 Ga0436361_0847404 3300039447 Bacteria 1605
128 Ga0436361_0888716 3300039447 Bacteria 733
129 Ga0436363_0638191 3300039450 Unclassified 976
130 Ga0436363_1349028 3300039450 Bacteria 3063
131 Ga0451789_0515792 3300041443 Bacteria 667
132 Ga0451839_0916273 3300041496 Bacteria 607
133 Ga0451577_0723860 3300042876 Bacteria 901
134 Ga0466972_0340194 3300044658 Bacteria 702
135 Ga0466965_0132917 3300044683 Bacteria 1291
136 Ga0466966_0088752 3300044684 Bacteria 1921
137 Ga0466957_1026714 3300044842 Bacteria 593
138 Ga0466957_1255290 3300044842 Bacteria 537
139 Ga0466960_0598529 3300044901 Bacteria 654
140 Ga0466959_0040624 3300045049 Bacteria 3436
141 Ga0466958_0718706 3300045836 Bacteria 651
142 Ga0466967_0336803 3300045976 Bacteria 1458
143 Ga0495638_0215228 3300046460 Bacteria 1077
144 Ga0495583_0009925 3300046506 Bacteria 5628
145 Ga0495610_0014857 3300046512 Bacteria 4554
146 Ga0495610_0074804 3300046512 Bacteria 1570
147 Ga0495610_0076407 3300046512 Bacteria 1549
148 Ga0495643_0036381 3300046522 Bacteria 2705
149 Ga0495668_0092760 3300046616 Bacteria 1654
150 Ga0495625_0042383 3300046660 Bacteria 3308
151 Ga0495658_0493657 3300046683 Bacteria 783
152 Ga0495671_0071503 3300046692 Bacteria 1704
153 Ga0495649_0033809 3300046694 Bacteria 2814
154 Ga0495687_057948 3300047443 Bacteria 1609
155 Ga0495673_0219342 3300047469 Bacteria 704
156 Ga0495684_0632276 3300047471 Unclassified 718
157 Ga0496100_0416729 3300048903 Bacteria 1025
158 Ga0496101_0856838 3300048904 Bacteria 716
159 Ga0496104_1339170 3300048907 Bacteria 619
160 Ga0496105_0866566 3300048908 Bacteria 683
161 Ga0496107_1008936 3300048910 Bacteria 604
162 Ga0496109_1054373 3300048912 Bacteria 750
163 Ga0496112_0024321 3300048915 Bacteria 5798
164 Ga0496113_0135623 3300048916 Bacteria 1934
165 Ga0496113_0655653 3300048916 Bacteria 839
166 Ga0496115_0931213 3300048918 Bacteria 668
167 Ga0496116_0032244 3300048919 Bacteria 3738
168 Ga0496119_0228412 3300048922 Bacteria 949
169 Ga0496121_0005986 3300048924 Bacteria 15363
170 Ga0496124_0030317 3300048927 Bacteria 4803
171 Ga0496125_0144643 3300048928 Bacteria 1646
172 Ga0496125_0287337 3300048928 Bacteria 1015
173 Ga0496126_0500664 3300048929 Bacteria 971
174 Ga0495682_0046745 3300049460 Bacteria 1579
175 Ga0501047_0090679 3300049581 Bacteria 2934
176 Ga0501075_1474122 3300049591 Unclassified 515
177 Ga0501044_0063489 3300049823 Bacteria 3773
178 Ga0501044_0206631 3300049823 Bacteria 1920
179 Ga0501044_0250538 3300049823 Bacteria 1712
180 nmdc:mga00v17_34749_c1 3300050491 Bacteria 2996
181 nmdc:mga0yw44_9545_c2 3300050492 Bacteria 4619
182 nmdc:mga06z11_40744_c1 3300050494 Bacteria 2320
183 nmdc:mga09592_1116488_c1 3300050508 Bacteria 655
184 nmdc:mga0qj67_411998_c1 3300050509 Bacteria 1090
185 nmdc:mga06r32_11381_c1 3300050510 Bacteria 8012
186 Ga0500622_0000265 3300053156 Bacteria 53529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10066277 Ga0070658_100662772 115
2 3300013307 Ga0157372_10791627 Ga0157372_107916272 115
3 3300025909 Ga0207705_10312956 Ga0207705_103129562 115
4 iso_pu_bacteria 2503198000 2503201141 118
5 iso_pu_bacteria 2512875024 2512959930 118
6 iso_pu_bacteria 2513237094 2513641260 118
7 iso_pu_bacteria 2513237164 2514036057 118
8 iso_pu_bacteria 2791355123 2792752357 118
9 iso_pu_bacteria 2937822353 2937823286 118
10 iso_pu_bacteria 2937848649 2937852580 118
11 iso_pu_bacteria 3004211236 3004211930 118
12 iso_pu_bacteria 3004218560 3004224595 118
13 3300044842 Ga0466957_1026714 Ga0466957_1026714_69_434 119
14 3300048910 Ga0496107_1008936 Ga0496107_1008936_213_578 119
15 iso_pu_bacteria 2508501123 2509119007 119
16 iso_pu_bacteria 2844533157 2844538972 119
17 3300003320 rootH2_10347491 rootH2_103474913 120
18 3300003752 Ga0055539_1031681 Ga0055539_10316811 121
19 3300003763 Ga0055529_1019606 Ga0055529_10196062 121
20 3300005616 Ga0068852_100633671 Ga0068852_1006336712 121
21 3300025253 Ga0209677_100582 Ga0209677_1005828 121
22 3300025254 Ga0209148_1007992 Ga0209148_10079925 121
23 3300025261 Ga0209233_1003460 Ga0209233_10034604 121
24 3300025272 Ga0209455_1003568 Ga0209455_10035684 121
25 3300048903 Ga0496100_0416729 Ga0496100_0416729_475_843 121
26 3300048928 Ga0496125_0144643 Ga0496125_0144643_97_465 121
27 3300005327 Ga0070658_10073179 Ga0070658_100731794 122
28 3300005339 Ga0070660_100143682 Ga0070660_1001436824 122
29 3300005339 Ga0070660_100954859 Ga0070660_1009548591 122
30 3300005456 Ga0070678_100932802 Ga0070678_1009328021 122
31 3300005539 Ga0068853_100145807 Ga0068853_1001458071 122
32 3300005548 Ga0070665_100959026 Ga0070665_1009590262 122
33 3300005563 Ga0068855_100462251 Ga0068855_1004622512 122
34 3300005577 Ga0068857_102454158 Ga0068857_1024541582 122
35 3300005578 Ga0068854_100342770 Ga0068854_1003427703 122
36 3300005616 Ga0068852_100848872 Ga0068852_1008488722 122
37 3300005834 Ga0068851_10482950 Ga0068851_104829502 122
38 3300006038 Ga0075365_10025388 Ga0075365_100253883 122
39 3300006048 Ga0075363_100030989 Ga0075363_1000309892 122
40 3300006051 Ga0075364_10049081 Ga0075364_100490813 122
41 3300006178 Ga0075367_10029533 Ga0075367_100295333 122
42 3300006353 Ga0075370_10080732 Ga0075370_100807322 122
43 3300009093 Ga0105240_10819964 Ga0105240_108199642 122
44 3300009093 Ga0105240_11557651 Ga0105240_115576512 122
45 3300009545 Ga0105237_10660514 Ga0105237_106605141 122
46 3300009551 Ga0105238_12109569 Ga0105238_121095692 122
47 3300010375 Ga0105239_10104298 Ga0105239_101042982 122
48 3300010375 Ga0105239_10264216 Ga0105239_102642163 122
49 3300011119 Ga0105246_11007134 Ga0105246_110071342 122
50 3300013104 Ga0157370_10212316 Ga0157370_102123163 122
51 3300013105 Ga0157369_10341141 Ga0157369_103411414 122
52 3300013296 Ga0157374_10447114 Ga0157374_104471143 122
53 3300013306 Ga0163162_12414055 Ga0163162_124140552 122
54 3300013307 Ga0157372_11558452 Ga0157372_115584522 122
55 3300014325 Ga0163163_10323394 Ga0163163_103233942 122
56 3300015261 Ga0182006_1021205 Ga0182006_10212053 122
57 3300015262 Ga0182007_10035742 Ga0182007_100357422 122
58 3300017792 Ga0163161_10444513 Ga0163161_104445132 122
59 3300025903 Ga0207680_10792515 Ga0207680_107925152 122
60 3300025904 Ga0207647_10093738 Ga0207647_100937382 122
61 3300025909 Ga0207705_10047330 Ga0207705_100473302 122
62 3300025911 Ga0207654_10165814 Ga0207654_101658143 122
63 3300025913 Ga0207695_10411608 Ga0207695_104116082 122
64 3300025913 Ga0207695_11425268 Ga0207695_114252681 122
65 3300025919 Ga0207657_10605837 Ga0207657_106058372 122
66 3300025924 Ga0207694_10171266 Ga0207694_101712662 122
67 3300025924 Ga0207694_11127918 Ga0207694_111279182 122
68 3300025986 Ga0207658_11594083 Ga0207658_115940831 122
69 3300026041 Ga0207639_10085752 Ga0207639_100857523 122
70 3300026067 Ga0207678_10203713 Ga0207678_102037132 122
71 3300026078 Ga0207702_10331517 Ga0207702_103315173 122
72 3300028379 Ga0268266_10655929 Ga0268266_106559292 122
73 3300045836 Ga0466958_0718706 Ga0466958_0718706_106_486 122
74 3300046460 Ga0495638_0215228 Ga0495638_0215228_58_429 122
75 3300048904 Ga0496101_0856838 Ga0496101_0856838_335_706 122
76 3300048907 Ga0496104_1339170 Ga0496104_1339170_178_549 122
77 3300048912 Ga0496109_1054373 Ga0496109_1054373_257_628 122
78 3300048915 Ga0496112_0024321 Ga0496112_0024321_3093_3467 122
79 3300048916 Ga0496113_0135623 Ga0496113_0135623_1092_1466 122
80 3300048916 Ga0496113_0655653 Ga0496113_0655653_43_414 122
81 3300048918 Ga0496115_0931213 Ga0496115_0931213_173_544 122
82 3300048922 Ga0496119_0228412 Ga0496119_0228412_451_822 122
83 3300048928 Ga0496125_0287337 Ga0496125_0287337_544_918 122
84 3300048929 Ga0496126_0500664 Ga0496126_0500664_430_804 122
85 3300050491 nmdc:mga00v17_34749_c1 nmdc:mga00v17_34749_c1_2041_2415 122
86 3300050492 nmdc:mga0yw44_9545_c2 nmdc:mga0yw44_9545_c2_3349_3723 122
87 3300050494 nmdc:mga06z11_40744_c1 nmdc:mga06z11_40744_c1_98_472 122
88 3300002773 JGI25152J39213_1000045 JGI25152J39213_10000456 123
89 3300003187 JGI25151J46595_10040562 JGI25151J46595_100405622 123
90 3300005434 Ga0070709_10988922 Ga0070709_109889221 123
91 3300005548 Ga0070665_102615231 Ga0070665_1026152311 123
92 3300005937 Ga0081455_10607827 Ga0081455_106078272 123
93 3300006028 Ga0070717_10849417 Ga0070717_108494172 123
94 3300009093 Ga0105240_11199141 Ga0105240_111991413 123
95 3300009101 Ga0105247_11480908 Ga0105247_114809081 123
96 3300009177 Ga0105248_10773675 Ga0105248_107736752 123
97 3300009177 Ga0105248_10917782 Ga0105248_109177822 123
98 3300010375 Ga0105239_10096067 Ga0105239_100960674 123
99 3300013296 Ga0157374_10055961 Ga0157374_100559612 123
100 3300013308 Ga0157375_11978641 Ga0157375_119786412 123
101 3300014968 Ga0157379_10021548 Ga0157379_100215485 123
102 3300014969 Ga0157376_10834021 Ga0157376_108340212 123
103 3300021361 Ga0213872_10280912 Ga0213872_102809121 123
104 3300025245 Ga0207425_1002275 Ga0207425_10022754 123
105 3300025250 Ga0209026_1001055 Ga0209026_10010554 123
106 3300025258 Ga0209129_1000068 Ga0209129_1000068149 123
107 3300025294 Ga0209025_1000045 Ga0209025_1000045175 123
108 3300025302 Ga0207426_1104337 Ga0207426_11043371 123
109 3300025913 Ga0207695_10445719 Ga0207695_104457192 123
110 3300025913 Ga0207695_11012978 Ga0207695_110129783 123
111 3300025986 Ga0207658_10756983 Ga0207658_107569832 123
112 3300026078 Ga0207702_10995795 Ga0207702_109957952 123
113 3300028379 Ga0268266_10020062 Ga0268266_100200626 123
114 3300028577 Ga0265318_10049103 Ga0265318_100491033 123
115 3300031240 Ga0265320_10021815 Ga0265320_100218153 123
116 3300031249 Ga0265339_10317758 Ga0265339_103177582 123
117 3300031250 Ga0265331_10024889 Ga0265331_100248892 123
118 3300031595 Ga0265313_10177511 Ga0265313_101775111 123
119 3300035398 Ga0316574_0234143 Ga0316574_0234143_664_1050 123
120 3300035724 Ga0373933_0014606 Ga0373933_0014606_3762_4133 123
121 3300036401 Ga0373937_0020755 Ga0373937_0020755_387_758 123
122 3300037068 Ga0373925_1177429 Ga0373925_1177429_88_459 123
123 3300037466 Ga0395898_1663186 Ga0395898_1663186_23_412 123
124 3300037853 Ga0436364_0646369 Ga0436364_0646369_385_771 123
125 3300037853 Ga0436364_1335582 Ga0436364_1335582_114_506 123
126 3300038443 Ga0395901_0001632 Ga0395901_0001632_21814_22203 123
127 3300039437 Ga0436365_0187654 Ga0436365_0187654_269_667 123
128 3300039447 Ga0436361_0758217 Ga0436361_0758217_13_396 123
129 3300039447 Ga0436361_0847404 Ga0436361_0847404_521_922 123
130 3300039447 Ga0436361_0888716 Ga0436361_0888716_278_679 123
131 3300039450 Ga0436363_0638191 Ga0436363_0638191_426_818 123
132 3300039450 Ga0436363_1349028 Ga0436363_1349028_1635_2018 123
133 3300041496 Ga0451839_0916273 Ga0451839_0916273_39_428 123
134 3300044683 Ga0466965_0132917 Ga0466965_0132917_50_430 123
135 3300044842 Ga0466957_1255290 Ga0466957_1255290_107_493 123
136 3300044901 Ga0466960_0598529 Ga0466960_0598529_245_625 123
137 3300046506 Ga0495583_0009925 Ga0495583_0009925_728_1102 123
138 3300046616 Ga0495668_0092760 Ga0495668_0092760_33_407 123
139 3300046660 Ga0495625_0042383 Ga0495625_0042383_2523_2897 123
140 3300046692 Ga0495671_0071503 Ga0495671_0071503_1118_1492 123
141 3300046694 Ga0495649_0033809 Ga0495649_0033809_1537_1911 123
142 3300047443 Ga0495687_057948 Ga0495687_057948_869_1240 123
143 3300047469 Ga0495673_0219342 Ga0495673_0219342_189_563 123
144 3300047471 Ga0495684_0632276 Ga0495684_0632276_108_479 123
145 3300048908 Ga0496105_0866566 Ga0496105_0866566_60_449 123
146 3300049460 Ga0495682_0046745 Ga0495682_0046745_580_954 123
147 3300049581 Ga0501047_0090679 Ga0501047_0090679_1825_2196 123
148 3300049591 Ga0501075_1474122 Ga0501075_1474122_112_492 123
149 3300049823 Ga0501044_0063489 Ga0501044_0063489_146_523 123
150 3300049823 Ga0501044_0206631 Ga0501044_0206631_1215_1586 123
151 3300049823 Ga0501044_0250538 Ga0501044_0250538_933_1304 123
152 3300009093 Ga0105240_10240224 Ga0105240_102402243 124
153 3300009551 Ga0105238_10018239 Ga0105238_100182394 124
154 3300013100 Ga0157373_10013388 Ga0157373_100133885 124
155 3300013105 Ga0157369_10056600 Ga0157369_100566004 124
156 3300013307 Ga0157372_10288304 Ga0157372_102883044 124
157 3300041443 Ga0451789_0515792 Ga0451789_0515792_266_643 124
158 3300013306 Ga0163162_10166968 Ga0163162_101669682 125
159 3300013308 Ga0157375_10140732 Ga0157375_101407323 125
160 3300045976 Ga0466967_0336803 Ga0466967_0336803_578_955 125
161 3300005530 Ga0070679_100023165 Ga0070679_1000231655 126
162 3300005535 Ga0070684_100600628 Ga0070684_1006006281 126
163 3300025912 Ga0207707_11406846 Ga0207707_114068462 126
164 3300025921 Ga0207652_10723293 Ga0207652_107232932 126
165 3300026116 Ga0207674_10195840 Ga0207674_101958402 126
166 3300046512 Ga0495610_0076407 Ga0495610_0076407_191_583 126
167 3300035695 Ga0373927_0116313 Ga0373927_0116313_910_1509 129
168 3300005937 Ga0081455_10234985 Ga0081455_102349852 130
169 3300009011 Ga0105251_10193094 Ga0105251_101930941 130
170 3300035172 Ga0373955_0860050 Ga0373955_0860050_74_469 130
171 3300035695 Ga0373927_0133038 Ga0373927_0133038_761_1156 130
172 3300035725 Ga0373947_0091114 Ga0373947_0091114_319_714 130
173 3300042876 Ga0451577_0723860 Ga0451577_0723860_432_824 130
174 3300046683 Ga0495658_0493657 Ga0495658_0493657_356_751 130
175 3300006847 Ga0075431_100001447 Ga0075431_10000144712 131
176 3300050508 nmdc:mga09592_1116488_c1 nmdc:mga09592_1116488_c1_201_623 131
177 3300050509 nmdc:mga0qj67_411998_c1 nmdc:mga0qj67_411998_c1_514_936 131
178 3300050510 nmdc:mga06r32_11381_c1 nmdc:mga06r32_11381_c1_1168_1590 131
179 3300001989 JGI24739J22299_10130777 JGI24739J22299_101307772 132
180 3300005548 Ga0070665_100005484 Ga0070665_1000054849 132
181 3300005841 Ga0068863_100124345 Ga0068863_1001243455 132
182 3300010375 Ga0105239_10476269 Ga0105239_104762691 132
183 3300025321 Ga0207656_10420069 Ga0207656_104200692 132
184 3300025931 Ga0207644_11089944 Ga0207644_110899441 132
185 3300026088 Ga0207641_10180529 Ga0207641_101805294 132
186 3300028379 Ga0268266_10093780 Ga0268266_100937804 132
187 3300028379 Ga0268266_10322220 Ga0268266_103222202 132
188 3300044658 Ga0466972_0340194 Ga0466972_0340194_132_542 132
189 3300044684 Ga0466966_0088752 Ga0466966_0088752_1451_1885 132
190 3300045049 Ga0466959_0040624 Ga0466959_0040624_1485_1919 132
191 3300046512 Ga0495610_0014857 Ga0495610_0014857_1053_1484 132
192 3300046512 Ga0495610_0074804 Ga0495610_0074804_190_600 132
193 3300046522 Ga0495643_0036381 Ga0495643_0036381_355_786 132
194 3300048919 Ga0496116_0032244 Ga0496116_0032244_1226_1657 132
195 3300048924 Ga0496121_0005986 Ga0496121_0005986_10781_11212 132
196 3300048927 Ga0496124_0030317 Ga0496124_0030317_975_1406 132
197 3300053156 Ga0500622_0000265 Ga0500622_0000265_39850_40281 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10012

DUF2255

Uncharacterized protein conserved in bacteria (DUF2255)

7

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2arz-assembly1.cif.gz_A crystal structure of protein of unknown function from pseudomonas aeruginosa 0.6918 16 125
3r5y-assembly3.cif.gz_C structure of a deazaflavin-dependent nitroreductase from nocardia farcinica, with co-factor f420 0.6804 26 126
3swj-assembly1.cif.gz_A crystal structure of campylobacter jejuni chuz 0.6686 15 126
6m09-assembly1.cif.gz_B the ligand-free structure of the chloroplast protein at3g03890 0.6558 13 126
7kl8-assembly1.cif.gz_B structure of f420 binding protein rv1558 from mycobacterium tuberculosis with f420 bound 0.6512 26 126
ID Description Score Start End Superfamily
af_O86340_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6972 21 113 2.30.110.10
af_P95144_3_116_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6871 25 100 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6854 26 126 2.30.110.10
af_O50398_10_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6812 13 126 2.30.110.10
af_Q9UUK0_9_180_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6798 13 126 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3N7Z0V1-F1-model_v4 DUF2255 family protein 0.9959 11 126
AF-A0A502MVV6-F1-model_v4 DUF2255 family protein 0.994 26 126
AF-A0A839ERV3-F1-model_v4 DUF2255 domain-containing protein 0.9932 11 126
AF-A0A0U5D2D0-F1-model_v4 Maltose O-acetyltransferase (EC 2.3.1.79) 0.9928 11 126 GO:0008925
AF-A0A839R236-F1-model_v4 deleted 0.9917 11 126

Feature Viewer

pLDDT pTM Quality
91.91 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map