F302715

General Info

Members Datasets Scaffolds Average Seq Length
197 141 394 249

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100010197|Ga0070699_1000101972
Length 279
Sequence LGRLGEVKASAEHRSLASPNLHAIFTRVFPYKDENPTELTPLSTVGLIAINVLAWLFVQGAGATDQALAQSVCHYGLIPGEVLRTVAPGTAVPVGPNMQCVIDAAPHWWTLLTSMFMHGGWFHLITNMWFFWVFGNNIEDSMGHGRFVVFYLLCGLAAAATQMLVSPKSAVPMVGASGAISGVMGAYVLLYPRVRVHTLVFLGFFVTTIALPAYVMLGYWFLLQLLGGTASALSQVEGGVAFWAHVGGFVAGMILIKLFANAEFLERRRAGVLIAPRGA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.12
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 6.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100010197 3300005518 Bacteria 8126
2 JGI25406J46586_10000171 3300003203 Bacteria 29089
3 JGI25406J46586_10000339 3300003203 Bacteria 21110
4 rootH1_10101961 3300003316 Unclassified 2455
5 Ga0065707_10011584 3300005295 Bacteria 2114
6 Ga0065707_10282796 3300005295 Unclassified 1043
7 Ga0070670_100056204 3300005331 Bacteria 3377
8 Ga0070691_10038501 3300005341 Bacteria 2258
9 Ga0070691_10085079 3300005341 Bacteria 1553
10 Ga0070692_10356766 3300005345 Bacteria 910
11 Ga0070671_100157128 3300005355 Bacteria 1921
12 Ga0070709_10067141 3300005434 Bacteria 2302
13 Ga0070714_100004452 3300005435 Bacteria 10552
14 Ga0070714_100243296 3300005435 Bacteria 1661
15 Ga0070714_100435991 3300005435 Bacteria 1243
16 Ga0070713_100004313 3300005436 Bacteria 9532
17 Ga0070713_100317629 3300005436 Bacteria 1438
18 Ga0070711_100000029 3300005439 Bacteria 101028
19 Ga0070700_100127167 3300005441 Bacteria 1715
20 Ga0070694_100070276 3300005444 Bacteria 2410
21 Ga0070694_100102418 3300005444 Bacteria 2027
22 Ga0070708_100012263 3300005445 Bacteria 6988
23 Ga0070708_100079385 3300005445 Bacteria 2969
24 Ga0070662_100490340 3300005457 Bacteria 1024
25 Ga0068867_100437076 3300005459 Bacteria 1112
26 Ga0068867_100544113 3300005459 Bacteria 1005
27 Ga0070706_100087375 3300005467 Bacteria 2890
28 Ga0070707_100388688 3300005468 Bacteria 1355
29 Ga0070699_100087365 3300005518 Bacteria 2722
30 Ga0070699_100106017 3300005518 Bacteria 2465
31 Ga0070679_100498650 3300005530 Bacteria 1161
32 Ga0070697_100230182 3300005536 Bacteria 1581
33 Ga0070672_100369919 3300005543 Bacteria 1224
34 Ga0070695_100003742 3300005545 Bacteria 8874
35 Ga0070695_100033341 3300005545 Bacteria 3222
36 Ga0070695_100566229 3300005545 Bacteria 888
37 Ga0070696_100170293 3300005546 Bacteria 1609
38 Ga0070696_100472988 3300005546 Bacteria 992
39 Ga0070704_100029837 3300005549 Bacteria 3646
40 Ga0070704_100030126 3300005549 Bacteria 3632
41 Ga0068855_100089825 3300005563 Bacteria 3546
42 Ga0068855_100435995 3300005563 Bacteria 1432
43 Ga0070664_100671338 3300005564 Bacteria 964
44 Ga0068856_100021117 3300005614 Bacteria 6327
45 Ga0068852_100639733 3300005616 Bacteria 1070
46 Ga0068864_100021979 3300005618 Bacteria 5347
47 Ga0068860_100113546 3300005843 Bacteria 2590
48 Ga0081538_10020884 3300005981 Bacteria 4803
49 Ga0081539_10000548 3300005985 Bacteria 77496
50 Ga0070716_100026475 3300006173 Bacteria 3107
51 Ga0070716_100133482 3300006173 Bacteria 1573
52 Ga0097621_100384490 3300006237 Unclassified 1254
53 Ga0075428_100006272 3300006844 Bacteria 13222
54 Ga0075428_100021983 3300006844 Bacteria 7063
55 Ga0075428_100282503 3300006844 Bacteria 1786
56 Ga0075430_100000656 3300006846 Bacteria 26394
57 Ga0075430_100099315 3300006846 Bacteria 2431
58 Ga0075431_100007021 3300006847 Bacteria 11188
59 Ga0075431_100024542 3300006847 Bacteria 6179
60 Ga0075431_100040772 3300006847 Bacteria 4786
61 Ga0075434_100013506 3300006871 Bacteria 7777
62 Ga0075436_100010244 3300006914 Bacteria 6419
63 Ga0075435_100494776 3300007076 Bacteria 1057
64 Ga0111539_10698902 3300009094 Unclassified 1180
65 Ga0105245_10183462 3300009098 Bacteria 2001
66 Ga0114129_10001648 3300009147 Bacteria 30350
67 Ga0114129_10023947 3300009147 Bacteria 8652
68 Ga0114129_10140294 3300009147 Bacteria 3314
69 Ga0105248_11127709 3300009177 Bacteria 886
70 Ga0105237_10244476 3300009545 Bacteria 1796
71 Ga0105237_11015064 3300009545 Unclassified 836
72 Ga0105238_10217377 3300009551 Unclassified 1887
73 Ga0105239_10066924 3300010375 Bacteria 3946
74 Ga0157373_10312470 3300013100 Bacteria 1117
75 Ga0157370_10032276 3300013104 Bacteria 5114
76 Ga0157370_10669227 3300013104 Bacteria 948
77 Ga0157369_10025606 3300013105 Bacteria 6547
78 Ga0157378_10153304 3300013297 Unclassified 2148
79 Ga0157372_10196104 3300013307 Unclassified 2339
80 Ga0163163_10001095 3300014325 Bacteria 23004
81 Ga0157380_10907827 3300014326 Bacteria 907
82 Ga0207699_10227107 3300025906 Bacteria 1277
83 Ga0207695_10106045 3300025913 Bacteria 2797
84 Ga0207671_10281925 3300025914 Bacteria 1311
85 Ga0207693_10571894 3300025915 Bacteria 881
86 Ga0207693_10590287 3300025915 Bacteria 865
87 Ga0207663_10000050 3300025916 Bacteria 63105
88 Ga0207660_10080104 3300025917 Bacteria 2397
89 Ga0207650_10100990 3300025925 Bacteria 2220
90 Ga0207700_10019823 3300025928 Bacteria 4551
91 Ga0207664_10157283 3300025929 Bacteria 1936
92 Ga0207664_10183611 3300025929 Bacteria 1797
93 Ga0207644_10607605 3300025931 Unclassified 908
94 Ga0207706_10179471 3300025933 Bacteria 1860
95 Ga0207679_10561651 3300025945 Bacteria 1025
96 Ga0207667_10479204 3300025949 Bacteria 1263
97 Ga0207639_10198953 3300026041 Bacteria 1717
98 Ga0207702_10493175 3300026078 Bacteria 1193
99 Ga0207648_10403773 3300026089 Bacteria 1239
100 Ga0210002_1032779 3300027617 Bacteria 867
101 Ga0209974_10067847 3300027876 Bacteria 1214
102 Ga0268266_10260203 3300028379 Bacteria 1608
103 Ga0307509_10316185 3300031507 Bacteria 1301
104 Ga0307413_10376553 3300031824 Bacteria 1104
105 Ga0307409_100050360 3300031995 Bacteria 3181
106 Ga0307416_100035038 3300032002 Bacteria 3828
107 Ga0307411_10005635 3300032005 Bacteria 6175
108 Ga0395900_0822479 3300037418 Bacteria 856
109 Ga0439453_0006344 3300041408 Bacteria 1838
110 Ga0439448_0056390 3300042005 Bacteria 1293
111 Ga0439435_0010407 3300042436 Bacteria 2208
112 Ga0453683_0028280 3300044673 Bacteria 3551
113 Ga0466963_0221067 3300044694 Bacteria 1326
114 Ga0466967_0435870 3300045976 Bacteria 1279
115 Ga0495603_0152324 3300046455 Bacteria 1343
116 Ga0495629_0298960 3300046459 Bacteria 1102
117 Ga0495582_0216173 3300046473 Bacteria 1096
118 Ga0495618_0399370 3300046514 Unclassified 841
119 Ga0495634_0028082 3300046642 Bacteria 3909
120 Ga0495613_0015995 3300046689 Bacteria 5585
121 Ga0495613_0149959 3300046689 Unclassified 1663
122 Ga0495613_0308947 3300046689 Bacteria 1093
123 Ga0495581_0030512 3300047315 Bacteria 3124
124 Ga0495674_0011219 3300047319 Bacteria 8460
125 Ga0495674_0015140 3300047319 Bacteria 7214
126 Ga0495676_0025059 3300047321 Bacteria 5154
127 Ga0495684_0051936 3300047471 Bacteria 3128
128 Ga0496101_0268574 3300048904 Bacteria 1331
129 Ga0496102_0233499 3300048905 Bacteria 1734
130 Ga0496103_0254579 3300048906 Bacteria 1130
131 Ga0496104_0031089 3300048907 Bacteria 4964
132 Ga0496104_0326961 3300048907 Bacteria 1446
133 Ga0496105_0028118 3300048908 Bacteria 4598
134 Ga0496106_0027465 3300048909 Bacteria 4239
135 Ga0496106_0362300 3300048909 Bacteria 1165
136 Ga0496106_0366041 3300048909 Bacteria 1158
137 Ga0496108_0142716 3300048911 Bacteria 2063
138 Ga0496109_0015511 3300048912 Bacteria 6642
139 Ga0496109_0048097 3300048912 Bacteria 3880
140 Ga0496111_0010301 3300048914 Bacteria 6265
141 Ga0496112_0028476 3300048915 Bacteria 5392
142 Ga0496112_0326161 3300048915 Bacteria 1479
143 Ga0496113_0001236 3300048916 Bacteria 14070
144 Ga0501033_0062470 3300049570 Bacteria 2743
145 Ga0501036_0178465 3300049572 Bacteria 1788
146 Ga0501038_0012472 3300049574 Bacteria 7766
147 Ga0501040_0001271 3300049576 Bacteria 16030
148 Ga0501041_0003602 3300049577 Bacteria 8908
149 Ga0501041_0066627 3300049577 Bacteria 2207
150 Ga0501042_0004684 3300049578 Bacteria 8725
151 Ga0501042_0049954 3300049578 Bacteria 2984
152 Ga0501042_0433969 3300049578 Bacteria 952
153 Ga0501043_0028368 3300049579 Bacteria 4394
154 Ga0501046_0012201 3300049580 Bacteria 7323
155 Ga0501046_0252462 3300049580 Bacteria 1298
156 Ga0501067_0006905 3300049583 Bacteria 6299
157 Ga0501068_0100635 3300049584 Bacteria 1791
158 Ga0501069_0054214 3300049585 Bacteria 2234
159 Ga0501071_0002876 3300049587 Bacteria 10612
160 Ga0501071_0083786 3300049587 Bacteria 2336
161 Ga0501072_0097133 3300049588 Bacteria 2341
162 Ga0501074_0025514 3300049590 Bacteria 4292
163 Ga0501074_0441770 3300049590 Bacteria 923
164 Ga0501075_0003948 3300049591 Bacteria 9991
165 Ga0501075_0090809 3300049591 Bacteria 2317
166 Ga0501076_0018059 3300049592 Bacteria 5369
167 Ga0501076_0046403 3300049592 Bacteria 3433
168 Ga0501076_0275593 3300049592 Bacteria 1378
169 Ga0501076_0323657 3300049592 Bacteria 1264
170 Ga0501077_0189526 3300049593 Bacteria 1306
171 Ga0501079_0008031 3300049741 Bacteria 7997
172 Ga0501079_0111743 3300049741 Bacteria 2123
173 Ga0501080_0054927 3300049742 Unclassified 3709
174 Ga0501080_0097200 3300049742 Bacteria 2734
175 Ga0501080_0198328 3300049742 Bacteria 1843
176 Ga0501081_0006370 3300049743 Bacteria 7656
177 Ga0501081_0069866 3300049743 Bacteria 2447
178 Ga0501045_0003119 3300049824 Bacteria 11333
179 Ga0501045_0017533 3300049824 Bacteria 5085
180 nmdc:mga05p37_1805_c1 3300050507 Bacteria 24956
181 nmdc:mga0qj67_144475_c1 3300050509 Bacteria 1929
182 nmdc:mga0qj67_2118_c1 3300050509 Bacteria 14146
183 nmdc:mga06r32_133625_c1 3300050510 Unclassified 2455
184 nmdc:mga06r32_24503_c1 3300050510 Bacteria 5602
185 nmdc:mga06r32_54101_c1 3300050510 Bacteria 3849
186 nmdc:mga08y16_512129_c1 3300050511 Bacteria 1218
187 nmdc:mga0n895_39102_c1 3300050512 Bacteria 4600
188 nmdc:mga0rr50_509824_c1 3300050513 Bacteria 1023
189 nmdc:mga08x19_169165_c1 3300050514 Bacteria 1488
190 Ga0501084_0005805 3300054114 Bacteria 10159
191 Ga0501084_0018986 3300054114 Bacteria 5724
192 Ga0590071_000394 3300059421 Bacteria 12861
193 Ga0590074_004582 3300059423 Bacteria 2286
194 Ga0590075_005052 3300059424 Bacteria 3118
195 Ga0501082_0006241 3300060353 Bacteria 10347
196 Ga0530510_0004653 3300061734 Bacteria 9493
197 Ga0530510_0141280 3300061734 Bacteria 1774
198 Ga0070699_100010197
199 JGI25406J46586_10000171
200 JGI25406J46586_10000339
201 rootH1_10101961
202 Ga0065707_10011584
203 Ga0065707_10282796
204 Ga0070670_100056204
205 Ga0070691_10038501
206 Ga0070691_10085079
207 Ga0070692_10356766
208 Ga0070671_100157128
209 Ga0070709_10067141
210 Ga0070714_100004452
211 Ga0070714_100243296
212 Ga0070714_100435991
213 Ga0070713_100004313
214 Ga0070713_100317629
215 Ga0070711_100000029
216 Ga0070700_100127167
217 Ga0070694_100070276
218 Ga0070694_100102418
219 Ga0070708_100012263
220 Ga0070708_100079385
221 Ga0070662_100490340
222 Ga0068867_100437076
223 Ga0068867_100544113
224 Ga0070706_100087375
225 Ga0070707_100388688
226 Ga0070699_100087365
227 Ga0070699_100106017
228 Ga0070679_100498650
229 Ga0070697_100230182
230 Ga0070672_100369919
231 Ga0070695_100003742
232 Ga0070695_100033341
233 Ga0070695_100566229
234 Ga0070696_100170293
235 Ga0070696_100472988
236 Ga0070704_100029837
237 Ga0070704_100030126
238 Ga0068855_100089825
239 Ga0068855_100435995
240 Ga0070664_100671338
241 Ga0068856_100021117
242 Ga0068852_100639733
243 Ga0068864_100021979
244 Ga0068860_100113546
245 Ga0081538_10020884
246 Ga0081539_10000548
247 Ga0070716_100026475
248 Ga0070716_100133482
249 Ga0097621_100384490
250 Ga0075428_100006272
251 Ga0075428_100021983
252 Ga0075428_100282503
253 Ga0075430_100000656
254 Ga0075430_100099315
255 Ga0075431_100007021
256 Ga0075431_100024542
257 Ga0075431_100040772
258 Ga0075434_100013506
259 Ga0075436_100010244
260 Ga0075435_100494776
261 Ga0111539_10698902
262 Ga0105245_10183462
263 Ga0114129_10001648
264 Ga0114129_10023947
265 Ga0114129_10140294
266 Ga0105248_11127709
267 Ga0105237_10244476
268 Ga0105237_11015064
269 Ga0105238_10217377
270 Ga0105239_10066924
271 Ga0157373_10312470
272 Ga0157370_10032276
273 Ga0157370_10669227
274 Ga0157369_10025606
275 Ga0157378_10153304
276 Ga0157372_10196104
277 Ga0163163_10001095
278 Ga0157380_10907827
279 Ga0207699_10227107
280 Ga0207695_10106045
281 Ga0207671_10281925
282 Ga0207693_10571894
283 Ga0207693_10590287
284 Ga0207663_10000050
285 Ga0207660_10080104
286 Ga0207650_10100990
287 Ga0207700_10019823
288 Ga0207664_10157283
289 Ga0207664_10183611
290 Ga0207644_10607605
291 Ga0207706_10179471
292 Ga0207679_10561651
293 Ga0207667_10479204
294 Ga0207639_10198953
295 Ga0207702_10493175
296 Ga0207648_10403773
297 Ga0210002_1032779
298 Ga0209974_10067847
299 Ga0268266_10260203
300 Ga0307509_10316185
301 Ga0307413_10376553
302 Ga0307409_100050360
303 Ga0307416_100035038
304 Ga0307411_10005635
305 Ga0395900_0822479
306 Ga0439453_0006344
307 Ga0439448_0056390
308 Ga0439435_0010407
309 Ga0453683_0028280
310 Ga0466963_0221067
311 Ga0466967_0435870
312 Ga0495603_0152324
313 Ga0495629_0298960
314 Ga0495582_0216173
315 Ga0495618_0399370
316 Ga0495634_0028082
317 Ga0495613_0015995
318 Ga0495613_0149959
319 Ga0495613_0308947
320 Ga0495581_0030512
321 Ga0495674_0011219
322 Ga0495674_0015140
323 Ga0495676_0025059
324 Ga0495684_0051936
325 Ga0496101_0268574
326 Ga0496102_0233499
327 Ga0496103_0254579
328 Ga0496104_0031089
329 Ga0496104_0326961
330 Ga0496105_0028118
331 Ga0496106_0027465
332 Ga0496106_0362300
333 Ga0496106_0366041
334 Ga0496108_0142716
335 Ga0496109_0015511
336 Ga0496109_0048097
337 Ga0496111_0010301
338 Ga0496112_0028476
339 Ga0496112_0326161
340 Ga0496113_0001236
341 Ga0501033_0062470
342 Ga0501036_0178465
343 Ga0501038_0012472
344 Ga0501040_0001271
345 Ga0501041_0003602
346 Ga0501041_0066627
347 Ga0501042_0004684
348 Ga0501042_0049954
349 Ga0501042_0433969
350 Ga0501043_0028368
351 Ga0501046_0012201
352 Ga0501046_0252462
353 Ga0501067_0006905
354 Ga0501068_0100635
355 Ga0501069_0054214
356 Ga0501071_0002876
357 Ga0501071_0083786
358 Ga0501072_0097133
359 Ga0501074_0025514
360 Ga0501074_0441770
361 Ga0501075_0003948
362 Ga0501075_0090809
363 Ga0501076_0018059
364 Ga0501076_0046403
365 Ga0501076_0275593
366 Ga0501076_0323657
367 Ga0501077_0189526
368 Ga0501079_0008031
369 Ga0501079_0111743
370 Ga0501080_0054927
371 Ga0501080_0097200
372 Ga0501080_0198328
373 Ga0501081_0006370
374 Ga0501081_0069866
375 Ga0501045_0003119
376 Ga0501045_0017533
377 nmdc:mga05p37_1805_c1
378 nmdc:mga0qj67_144475_c1
379 nmdc:mga0qj67_2118_c1
380 nmdc:mga06r32_133625_c1
381 nmdc:mga06r32_24503_c1
382 nmdc:mga06r32_54101_c1
383 nmdc:mga08y16_512129_c1
384 nmdc:mga0n895_39102_c1
385 nmdc:mga0rr50_509824_c1
386 nmdc:mga08x19_169165_c1
387 Ga0501084_0005805
388 Ga0501084_0018986
389 Ga0590071_000394
390 Ga0590074_004582
391 Ga0590075_005052
392 Ga0501082_0006241
393 Ga0530510_0004653
394 Ga0530510_0141280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

105

262

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3odj-assembly1.cif.gz_A crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 0.8106 16 223
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7901 16 223
6pjq-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7629 16 223
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7572 16 223
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7492 16 223
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8469 11 226 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8378 11 226 1.20.1540.10
3odjA00 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8106 16 223 1.20.1540.10
af_Q67UY4_137_320_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8095 17 224 1.20.1540.10
af_A0A0P0VIC0_209_332_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8015 15 148 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A1F2WDI7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9773 1 202 GO:0004252
GO:0006508
GO:0016020
AF-A0A2V7GC26-F1-model_v4 Rhomboid family intramembrane serine protease 0.9672 1 229 GO:0004252
GO:0006508
GO:0016020
AF-A0A2V7JZV8-F1-model_v4 Rhomboid family intramembrane serine protease 0.9604 16 235 GO:0004252
GO:0006508
GO:0016020
AF-A0A2E7LHG2-F1-model_v4 Rhomboid family intramembrane serine protease 0.9588 2 227 GO:0004252
GO:0006508
GO:0016020
AF-A0A3B0YYD5-F1-model_v4 FIG056164: rhomboid family serine protease 0.9494 91 227 GO:0004252
GO:0006508
GO:0016020

Map