F302645

General Info

Members Datasets Scaffolds Average Seq Length
197 129 197 137

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100006647|Ga0070713_1000066477
Length 142
Sequence MRAAMANRTFTIIKPDSVRKGNFGKIISRIESEGFRILGIKKTNLSTRQAQAFYAVHRERPFFPALVEYMTSGPVYVAALERDGAVPYLRKVMGATDPKKADAGTIRADYGESIEQNAIHGSDSDENAAIEIAFFFAESELL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 5.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10174922 3300005293 Bacteria 1519
2 Ga0065715_10493252 3300005293 Bacteria 786
3 Ga0065707_10187185 3300005295 Bacteria 1382
4 Ga0070658_10325839 3300005327 Bacteria 1312
5 Ga0070676_10363416 3300005328 Bacteria 998
6 Ga0070683_100000020 3300005329 Bacteria 189501
7 Ga0070683_100659212 3300005329 Bacteria 1002
8 Ga0070690_101563065 3300005330 Bacteria 534
9 Ga0070670_100048976 3300005331 Unclassified 3635
10 Ga0070670_101114114 3300005331 Bacteria 720
11 Ga0068869_100434381 3300005334 Unclassified 1085
12 Ga0070680_100000916 3300005336 Bacteria 20852
13 Ga0070680_100334853 3300005336 Bacteria 1286
14 Ga0068868_100000622 3300005338 Bacteria 23835
15 Ga0070689_100002749 3300005340 Bacteria 11541
16 Ga0070692_10013305 3300005345 Bacteria 3832
17 Ga0070675_100000010 3300005354 Bacteria 243396
18 Ga0070671_100700154 3300005355 Bacteria 879
19 Ga0070674_100192311 3300005356 Bacteria 1570
20 Ga0070674_100451424 3300005356 Bacteria 1061
21 Ga0070673_100245915 3300005364 Bacteria 1557
22 Ga0070673_100384506 3300005364 Bacteria 1252
23 Ga0070673_100906199 3300005364 Bacteria 818
24 Ga0070713_100006647 3300005436 Bacteria 8043
25 Ga0070701_10000476 3300005438 Bacteria 13745
26 Ga0070700_100000182 3300005441 Bacteria 35745
27 Ga0068867_100167840 3300005459 Bacteria 1736
28 Ga0068867_100466493 3300005459 Bacteria 1079
29 Ga0070685_10008388 3300005466 Bacteria 5304
30 Ga0070706_100101228 3300005467 Bacteria 2678
31 Ga0070706_100651801 3300005467 Unclassified 977
32 Ga0070707_100007633 3300005468 Bacteria 10045
33 Ga0070707_100228344 3300005468 Bacteria 1812
34 Ga0070698_100035843 3300005471 Bacteria 5128
35 Ga0070698_100693468 3300005471 Bacteria 960
36 Ga0070699_100077530 3300005518 Bacteria 2893
37 Ga0070684_100003083 3300005535 Bacteria 12438
38 Ga0070684_100324114 3300005535 Bacteria 1415
39 Ga0070684_100732121 3300005535 Bacteria 923
40 Ga0068853_100067051 3300005539 Bacteria 3117
41 Ga0068853_100149734 3300005539 Bacteria 2100
42 Ga0068853_101607360 3300005539 Bacteria 630
43 Ga0070672_100031557 3300005543 Bacteria 3989
44 Ga0070672_100183354 3300005543 Bacteria 1745
45 Ga0070693_100027615 3300005547 Bacteria 3078
46 Ga0068857_100087243 3300005577 Bacteria 2791
47 Ga0068857_100982951 3300005577 Bacteria 812
48 Ga0070702_100039936 3300005615 Bacteria 2622
49 Ga0070702_100040001 3300005615 Bacteria 2620
50 Ga0070702_100318306 3300005615 Bacteria 1083
51 Ga0070702_101422712 3300005615 Bacteria 568
52 Ga0068852_100423166 3300005616 Bacteria 1314
53 Ga0068864_100000007 3300005618 Bacteria 392187
54 Ga0068870_10008463 3300005840 Bacteria 4630
55 Ga0068870_10018755 3300005840 Bacteria 3346
56 Ga0068858_100001722 3300005842 Bacteria 22354
57 Ga0068858_101199992 3300005842 Bacteria 746
58 Ga0070717_10000034 3300006028 Bacteria 127047
59 Ga0070716_100145892 3300006173 Bacteria 1516
60 Ga0070716_100146580 3300006173 Bacteria 1513
61 Ga0070716_100186766 3300006173 Bacteria 1366
62 Ga0068871_100508437 3300006358 Bacteria 1087
63 Ga0075428_100004048 3300006844 Bacteria 16111
64 Ga0075428_100866345 3300006844 Bacteria 959
65 Ga0075431_100002808 3300006847 Bacteria 16867
66 Ga0075429_100389638 3300006880 Bacteria 1220
67 Ga0068865_100712139 3300006881 Bacteria 859
68 Ga0075436_100001342 3300006914 Bacteria 16755
69 Ga0075435_100007166 3300007076 Bacteria 7929
70 Ga0075435_100018208 3300007076 Bacteria 5334
71 Ga0075435_100020452 3300007076 Bacteria 5073
72 Ga0105244_10061875 3300009036 Bacteria 1883
73 Ga0105240_10014643 3300009093 Bacteria 10701
74 Ga0105245_10000035 3300009098 Bacteria 147165
75 Ga0105245_10000163 3300009098 Bacteria 62999
76 Ga0105245_10000397 3300009098 Bacteria 40390
77 Ga0105245_10056359 3300009098 Bacteria 3532
78 Ga0105245_11749311 3300009098 Bacteria 674
79 Ga0114129_10469473 3300009147 Bacteria 1648
80 Ga0114129_10555765 3300009147 Bacteria 1492
81 Ga0114129_10875808 3300009147 Bacteria 1140
82 Ga0114129_13085597 3300009147 Unclassified 545
83 Ga0105242_10003299 3300009176 Bacteria 12568
84 Ga0105248_10561206 3300009177 Bacteria 1288
85 Ga0105238_10000010 3300009551 Bacteria 271274
86 Ga0105239_10030438 3300010375 Bacteria 5936
87 Ga0105246_10092183 3300011119 Unclassified 2186
88 Ga0105246_10303229 3300011119 Bacteria 1291
89 Ga0157369_10724343 3300013105 Unclassified 1024
90 Ga0157374_10990164 3300013296 Unclassified 860
91 Ga0157378_10000891 3300013297 Bacteria 27532
92 Ga0157378_10001004 3300013297 Bacteria 25854
93 Ga0157378_10135591 3300013297 Bacteria 2282
94 Ga0157378_11595399 3300013297 Bacteria 698
95 Ga0157378_12513558 3300013297 Bacteria 567
96 Ga0163162_10080292 3300013306 Bacteria 3329
97 Ga0163162_10655653 3300013306 Bacteria 1173
98 Ga0157372_11091021 3300013307 Bacteria 923
99 Ga0157375_10000003 3300013308 Bacteria 476325
100 Ga0157375_10000066 3300013308 Bacteria 111876
101 Ga0157375_11245451 3300013308 Bacteria 874
102 Ga0163163_11037990 3300014325 Bacteria 883
103 Ga0157380_10002981 3300014326 Bacteria 11524
104 Ga0157377_10000108 3300014745 Bacteria 56604
105 Ga0157377_10129996 3300014745 Bacteria 1537
106 Ga0213873_10000001 3300021358 Bacteria 1657979
107 Ga0213876_10000015 3300021384 Bacteria 304025
108 Ga0213876_10001360 3300021384 Bacteria 15283
109 Ga0207655_1106920 3300025728 Bacteria 952
110 Ga0207682_10090707 3300025893 Bacteria 1324
111 Ga0207645_10472184 3300025907 Bacteria 848
112 Ga0207643_10023575 3300025908 Bacteria 3393
113 Ga0207643_10062579 3300025908 Bacteria 2126
114 Ga0207684_10030588 3300025910 Bacteria 4582
115 Ga0207684_10106500 3300025910 Unclassified 2398
116 Ga0207684_10444654 3300025910 Bacteria 1113
117 Ga0207695_10007115 3300025913 Bacteria 14332
118 Ga0207663_10443567 3300025916 Bacteria 1000
119 Ga0207660_10001362 3300025917 Bacteria 16372
120 Ga0207662_10370256 3300025918 Bacteria 966
121 Ga0207646_10947782 3300025922 Unclassified 762
122 Ga0207694_10000002 3300025924 Bacteria 1165763
123 Ga0207694_10000003 3300025924 Bacteria 1165533
124 Ga0207694_11732709 3300025924 Bacteria 526
125 Ga0207650_10167877 3300025925 Bacteria 1742
126 Ga0207659_10000001 3300025926 Bacteria 660958
127 Ga0207687_10000009 3300025927 Bacteria 443946
128 Ga0207687_10000251 3300025927 Bacteria 36320
129 Ga0207687_10000374 3300025927 Bacteria 29972
130 Ga0207700_10051438 3300025928 Bacteria 3075
131 Ga0207686_10005802 3300025934 Bacteria 6624
132 Ga0207709_11511512 3300025935 Unclassified 557
133 Ga0207670_10141375 3300025936 Bacteria 1775
134 Ga0207669_10367966 3300025937 Bacteria 1116
135 Ga0207704_10188252 3300025938 Bacteria 1499
136 Ga0207665_10078909 3300025939 Bacteria 2262
137 Ga0207665_10434649 3300025939 Bacteria 1005
138 Ga0207691_10046113 3300025940 Bacteria 4007
139 Ga0207691_10181618 3300025940 Bacteria 1838
140 Ga0207711_10400291 3300025941 Bacteria 1276
141 Ga0207689_10010625 3300025942 Bacteria 7924
142 Ga0207689_10240465 3300025942 Bacteria 1496
143 Ga0207661_10000002 3300025944 Bacteria 816104
144 Ga0207661_10073935 3300025944 Bacteria 2793
145 Ga0207679_10343587 3300025945 Bacteria 1299
146 Ga0207651_10381572 3300025960 Bacteria 1194
147 Ga0207651_10800770 3300025960 Bacteria 835
148 Ga0207651_11837442 3300025960 Bacteria 545
149 Ga0207677_10000001 3300026023 Bacteria 534789
150 Ga0207703_10000069 3300026035 Bacteria 124592
151 Ga0207703_10833089 3300026035 Bacteria 882
152 Ga0207639_10000013 3300026041 Bacteria 293084
153 Ga0207639_10017415 3300026041 Bacteria 5094
154 Ga0207708_10000027 3300026075 Bacteria 166457
155 Ga0207641_11868204 3300026088 Bacteria 602
156 Ga0207648_10024384 3300026089 Bacteria 5400
157 Ga0207676_10000015 3300026095 Bacteria 329100
158 Ga0207674_10119078 3300026116 Bacteria 2610
159 Ga0207675_100024474 3300026118 Bacteria 5614
160 Ga0207698_10426093 3300026142 Bacteria 1274
161 Ga0307511_10014004 3300030521 Bacteria 7812
162 Ga0307412_10814564 3300031911 Unclassified 812
163 Ga0307414_11953032 3300032004 Unclassified 548
164 Ga0307411_12150818 3300032005 Bacteria 523
165 Ga0307415_100352251 3300032126 Bacteria 1240
166 Ga0307415_101384388 3300032126 Bacteria 669
167 Ga0373932_0000936 3300035112 Bacteria 8544
168 Ga0373941_0002292 3300035115 Unclassified 4192
169 Ga0373943_0227390 3300035170 Bacteria 1041
170 Ga0373943_0567329 3300035170 Bacteria 667
171 Ga0436364_1208653 3300037853 Unclassified 803
172 Ga0395901_0801627 3300038443 Bacteria 931
173 Ga0436365_0161434 3300039437 Bacteria 117675
174 Ga0436365_1019701 3300039437 Bacteria 4345
175 Ga0436365_1897728 3300039437 Bacteria 14063
176 Ga0436363_0917321 3300039450 Bacteria 1288
177 Ga0436363_1254729 3300039450 Bacteria 1141
178 Ga0436362_1305298 3300039453 Bacteria 131464
179 Ga0451851_0962458 3300041507 Bacteria 809
180 Ga0451576_0154482 3300045051 Bacteria 2394
181 Ga0495620_0006286 3300046515 Bacteria 6535
182 Ga0495621_0190378 3300046539 Bacteria 822
183 Ga0495679_016046 3300047446 Bacteria 2720
184 Ga0501073_0005530 3300049589 Bacteria 9463
185 Ga0501079_0633058 3300049741 Bacteria 842
186 Ga0501080_0018466 3300049742 Bacteria 6454
187 nmdc:mga05p37_358096_c1 3300050507 Bacteria 1716
188 nmdc:mga09592_1471786_c1 3300050508 Bacteria 555
189 nmdc:mga06r32_1830_c1 3300050510 Bacteria 18991
190 nmdc:mga0n895_1671738_c1 3300050512 Bacteria 600
191 nmdc:mga0n895_1757687_c1 3300050512 Bacteria 582
192 nmdc:mga0n895_2015636_c1 3300050512 Unclassified 535
193 nmdc:mga0rr50_2212_c1 3300050513 Bacteria 10916
194 nmdc:mga0rr50_49105_c1 3300050513 Bacteria 3123
195 nmdc:mga0rr50_49_c1 3300050513 Bacteria 71590
196 nmdc:mga08x19_636_c1 3300050514 Bacteria 22696
197 Ga0495655_0000672 3300053083 Bacteria 5488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100866345 Ga0075428_1008663451 128
2 3300006880 Ga0075429_100389638 Ga0075429_1003896382 128
3 3300005336 Ga0070680_100000916 Ga0070680_1000009167 130
4 3300005615 Ga0070702_100040001 Ga0070702_1000400013 130
5 3300005840 Ga0068870_10018755 Ga0068870_100187553 130
6 3300009176 Ga0105242_10003299 Ga0105242_100032998 130
7 3300013297 Ga0157378_10135591 Ga0157378_101355912 130
8 3300025908 Ga0207643_10023575 Ga0207643_100235752 130
9 3300025917 Ga0207660_10001362 Ga0207660_1000136212 130
10 3300025934 Ga0207686_10005802 Ga0207686_100058023 130
11 3300026118 Ga0207675_100024474 Ga0207675_1000244742 130
12 3300039450 Ga0436363_1254729 Ga0436363_1254729_637_1053 130
13 3300005329 Ga0070683_100659212 Ga0070683_1006592122 133
14 3300005338 Ga0068868_100000622 Ga0068868_10000062215 133
15 3300005842 Ga0068858_101199992 Ga0068858_1011999922 133
16 3300013297 Ga0157378_11595399 Ga0157378_115953992 133
17 3300025944 Ga0207661_10073935 Ga0207661_100739352 133
18 3300026023 Ga0207677_10000001 Ga0207677_10000001388 133
19 3300026035 Ga0207703_10833089 Ga0207703_108330892 133
20 3300035115 Ga0373941_0002292 Ga0373941_0002292_502_906 133
21 3300005293 Ga0065715_10174922 Ga0065715_101749222 138
22 3300005293 Ga0065715_10493252 Ga0065715_104932521 138
23 3300005295 Ga0065707_10187185 Ga0065707_101871852 138
24 3300005327 Ga0070658_10325839 Ga0070658_103258392 138
25 3300005328 Ga0070676_10363416 Ga0070676_103634161 138
26 3300005329 Ga0070683_100000020 Ga0070683_100000020130 138
27 3300005330 Ga0070690_101563065 Ga0070690_1015630651 138
28 3300005331 Ga0070670_100048976 Ga0070670_1000489763 138
29 3300005331 Ga0070670_101114114 Ga0070670_1011141142 138
30 3300005334 Ga0068869_100434381 Ga0068869_1004343812 138
31 3300005336 Ga0070680_100334853 Ga0070680_1003348532 138
32 3300005340 Ga0070689_100002749 Ga0070689_10000274912 138
33 3300005345 Ga0070692_10013305 Ga0070692_100133053 138
34 3300005354 Ga0070675_100000010 Ga0070675_10000001028 138
35 3300005355 Ga0070671_100700154 Ga0070671_1007001541 138
36 3300005356 Ga0070674_100192311 Ga0070674_1001923112 138
37 3300005356 Ga0070674_100451424 Ga0070674_1004514242 138
38 3300005364 Ga0070673_100245915 Ga0070673_1002459152 138
39 3300005364 Ga0070673_100384506 Ga0070673_1003845062 138
40 3300005364 Ga0070673_100906199 Ga0070673_1009061992 138
41 3300005436 Ga0070713_100006647 Ga0070713_1000066477 138
42 3300005438 Ga0070701_10000476 Ga0070701_100004762 138
43 3300005441 Ga0070700_100000182 Ga0070700_10000018230 138
44 3300005459 Ga0068867_100167840 Ga0068867_1001678401 138
45 3300005459 Ga0068867_100466493 Ga0068867_1004664932 138
46 3300005466 Ga0070685_10008388 Ga0070685_100083883 138
47 3300005467 Ga0070706_100101228 Ga0070706_1001012284 138
48 3300005467 Ga0070706_100651801 Ga0070706_1006518012 138
49 3300005468 Ga0070707_100007633 Ga0070707_1000076336 138
50 3300005468 Ga0070707_100228344 Ga0070707_1002283442 138
51 3300005471 Ga0070698_100035843 Ga0070698_1000358432 138
52 3300005471 Ga0070698_100693468 Ga0070698_1006934681 138
53 3300005518 Ga0070699_100077530 Ga0070699_1000775302 138
54 3300005535 Ga0070684_100003083 Ga0070684_1000030832 138
55 3300005535 Ga0070684_100324114 Ga0070684_1003241142 138
56 3300005535 Ga0070684_100732121 Ga0070684_1007321212 138
57 3300005539 Ga0068853_100067051 Ga0068853_1000670512 138
58 3300005539 Ga0068853_100149734 Ga0068853_1001497342 138
59 3300005539 Ga0068853_101607360 Ga0068853_1016073601 138
60 3300005543 Ga0070672_100031557 Ga0070672_1000315572 138
61 3300005543 Ga0070672_100183354 Ga0070672_1001833542 138
62 3300005547 Ga0070693_100027615 Ga0070693_1000276151 138
63 3300005577 Ga0068857_100087243 Ga0068857_1000872432 138
64 3300005577 Ga0068857_100982951 Ga0068857_1009829512 138
65 3300005615 Ga0070702_100039936 Ga0070702_1000399363 138
66 3300005615 Ga0070702_100318306 Ga0070702_1003183062 138
67 3300005615 Ga0070702_101422712 Ga0070702_1014227121 138
68 3300005616 Ga0068852_100423166 Ga0068852_1004231662 138
69 3300005618 Ga0068864_100000007 Ga0068864_10000000730 138
70 3300005840 Ga0068870_10008463 Ga0068870_100084632 138
71 3300005842 Ga0068858_100001722 Ga0068858_1000017224 138
72 3300006028 Ga0070717_10000034 Ga0070717_1000003468 138
73 3300006173 Ga0070716_100145892 Ga0070716_1001458923 138
74 3300006173 Ga0070716_100146580 Ga0070716_1001465803 138
75 3300006173 Ga0070716_100186766 Ga0070716_1001867662 138
76 3300006358 Ga0068871_100508437 Ga0068871_1005084372 138
77 3300006844 Ga0075428_100004048 Ga0075428_1000040487 138
78 3300006847 Ga0075431_100002808 Ga0075431_1000028086 138
79 3300006881 Ga0068865_100712139 Ga0068865_1007121392 138
80 3300006914 Ga0075436_100001342 Ga0075436_1000013424 138
81 3300007076 Ga0075435_100007166 Ga0075435_1000071662 138
82 3300007076 Ga0075435_100018208 Ga0075435_1000182086 138
83 3300007076 Ga0075435_100020452 Ga0075435_1000204522 138
84 3300009036 Ga0105244_10061875 Ga0105244_100618752 138
85 3300009093 Ga0105240_10014643 Ga0105240_100146439 138
86 3300009098 Ga0105245_10000035 Ga0105245_1000003539 138
87 3300009098 Ga0105245_10000163 Ga0105245_1000016339 138
88 3300009098 Ga0105245_10000397 Ga0105245_1000039714 138
89 3300009098 Ga0105245_10056359 Ga0105245_100563594 138
90 3300009098 Ga0105245_11749311 Ga0105245_117493112 138
91 3300009147 Ga0114129_10469473 Ga0114129_104694732 138
92 3300009147 Ga0114129_10555765 Ga0114129_105557652 138
93 3300009147 Ga0114129_10875808 Ga0114129_108758082 138
94 3300009147 Ga0114129_13085597 Ga0114129_130855971 138
95 3300009177 Ga0105248_10561206 Ga0105248_105612062 138
96 3300009551 Ga0105238_10000010 Ga0105238_1000001054 138
97 3300010375 Ga0105239_10030438 Ga0105239_100304384 138
98 3300011119 Ga0105246_10092183 Ga0105246_100921832 138
99 3300011119 Ga0105246_10303229 Ga0105246_103032292 138
100 3300013105 Ga0157369_10724343 Ga0157369_107243432 138
101 3300013296 Ga0157374_10990164 Ga0157374_109901641 138
102 3300013297 Ga0157378_10000891 Ga0157378_1000089118 138
103 3300013297 Ga0157378_10001004 Ga0157378_1000100419 138
104 3300013297 Ga0157378_12513558 Ga0157378_125135581 138
105 3300013306 Ga0163162_10080292 Ga0163162_100802923 138
106 3300013306 Ga0163162_10655653 Ga0163162_106556532 138
107 3300013307 Ga0157372_11091021 Ga0157372_110910212 138
108 3300013308 Ga0157375_10000003 Ga0157375_10000003354 138
109 3300013308 Ga0157375_10000066 Ga0157375_1000006667 138
110 3300013308 Ga0157375_11245451 Ga0157375_112454512 138
111 3300014325 Ga0163163_11037990 Ga0163163_110379901 138
112 3300014326 Ga0157380_10002981 Ga0157380_100029814 138
113 3300014745 Ga0157377_10000108 Ga0157377_1000010848 138
114 3300014745 Ga0157377_10129996 Ga0157377_101299962 138
115 3300021358 Ga0213873_10000001 Ga0213873_10000001200 138
116 3300021384 Ga0213876_10000015 Ga0213876_100000158 138
117 3300021384 Ga0213876_10001360 Ga0213876_100013603 138
118 3300025728 Ga0207655_1106920 Ga0207655_11069202 138
119 3300025893 Ga0207682_10090707 Ga0207682_100907072 138
120 3300025907 Ga0207645_10472184 Ga0207645_104721842 138
121 3300025908 Ga0207643_10062579 Ga0207643_100625793 138
122 3300025910 Ga0207684_10030588 Ga0207684_100305884 138
123 3300025910 Ga0207684_10106500 Ga0207684_101065002 138
124 3300025910 Ga0207684_10444654 Ga0207684_104446542 138
125 3300025913 Ga0207695_10007115 Ga0207695_1000711514 138
126 3300025916 Ga0207663_10443567 Ga0207663_104435672 138
127 3300025918 Ga0207662_10370256 Ga0207662_103702561 138
128 3300025922 Ga0207646_10947782 Ga0207646_109477822 138
129 3300025924 Ga0207694_10000002 Ga0207694_10000002229 138
130 3300025924 Ga0207694_10000003 Ga0207694_10000003871 138
131 3300025924 Ga0207694_11732709 Ga0207694_117327092 138
132 3300025925 Ga0207650_10167877 Ga0207650_101678772 138
133 3300025926 Ga0207659_10000001 Ga0207659_10000001213 138
134 3300025927 Ga0207687_10000009 Ga0207687_10000009298 138
135 3300025927 Ga0207687_10000251 Ga0207687_1000025122 138
136 3300025927 Ga0207687_10000374 Ga0207687_100003749 138
137 3300025928 Ga0207700_10051438 Ga0207700_100514383 138
138 3300025935 Ga0207709_11511512 Ga0207709_115115121 138
139 3300025936 Ga0207670_10141375 Ga0207670_101413752 138
140 3300025937 Ga0207669_10367966 Ga0207669_103679662 138
141 3300025938 Ga0207704_10188252 Ga0207704_101882522 138
142 3300025939 Ga0207665_10078909 Ga0207665_100789093 138
143 3300025939 Ga0207665_10434649 Ga0207665_104346492 138
144 3300025940 Ga0207691_10046113 Ga0207691_100461133 138
145 3300025940 Ga0207691_10181618 Ga0207691_101816182 138
146 3300025941 Ga0207711_10400291 Ga0207711_104002912 138
147 3300025942 Ga0207689_10010625 Ga0207689_100106254 138
148 3300025942 Ga0207689_10240465 Ga0207689_102404652 138
149 3300025944 Ga0207661_10000002 Ga0207661_10000002265 138
150 3300025945 Ga0207679_10343587 Ga0207679_103435872 138
151 3300025960 Ga0207651_10381572 Ga0207651_103815722 138
152 3300025960 Ga0207651_10800770 Ga0207651_108007702 138
153 3300025960 Ga0207651_11837442 Ga0207651_118374421 138
154 3300026035 Ga0207703_10000069 Ga0207703_1000006919 138
155 3300026041 Ga0207639_10000013 Ga0207639_10000013286 138
156 3300026041 Ga0207639_10017415 Ga0207639_100174153 138
157 3300026075 Ga0207708_10000027 Ga0207708_1000002780 138
158 3300026088 Ga0207641_11868204 Ga0207641_118682041 138
159 3300026089 Ga0207648_10024384 Ga0207648_100243845 138
160 3300026095 Ga0207676_10000015 Ga0207676_10000015300 138
161 3300026116 Ga0207674_10119078 Ga0207674_101190782 138
162 3300026142 Ga0207698_10426093 Ga0207698_104260932 138
163 3300030521 Ga0307511_10014004 Ga0307511_100140047 138
164 3300031911 Ga0307412_10814564 Ga0307412_108145641 138
165 3300032004 Ga0307414_11953032 Ga0307414_119530322 138
166 3300032005 Ga0307411_12150818 Ga0307411_121508181 138
167 3300032126 Ga0307415_100352251 Ga0307415_1003522512 138
168 3300032126 Ga0307415_101384388 Ga0307415_1013843881 138
169 3300035112 Ga0373932_0000936 Ga0373932_0000936_1216_1632 138
170 3300035170 Ga0373943_0227390 Ga0373943_0227390_115_531 138
171 3300035170 Ga0373943_0567329 Ga0373943_0567329_196_612 138
172 3300037853 Ga0436364_1208653 Ga0436364_1208653_140_559 138
173 3300038443 Ga0395901_0801627 Ga0395901_0801627_466_882 138
174 3300039437 Ga0436365_0161434 Ga0436365_0161434_80620_81036 138
175 3300039437 Ga0436365_1019701 Ga0436365_1019701_1208_1636 138
176 3300039437 Ga0436365_1897728 Ga0436365_1897728_4784_5203 138
177 3300039450 Ga0436363_0917321 Ga0436363_0917321_22_438 138
178 3300039453 Ga0436362_1305298 Ga0436362_1305298_80586_81002 138
179 3300041507 Ga0451851_0962458 Ga0451851_0962458_189_611 138
180 3300045051 Ga0451576_0154482 Ga0451576_0154482_1868_2284 138
181 3300046515 Ga0495620_0006286 Ga0495620_0006286_575_991 138
182 3300046539 Ga0495621_0190378 Ga0495621_0190378_174_590 138
183 3300047446 Ga0495679_016046 Ga0495679_016046_778_1194 138
184 3300049589 Ga0501073_0005530 Ga0501073_0005530_2876_3292 138
185 3300049741 Ga0501079_0633058 Ga0501079_0633058_101_517 138
186 3300049742 Ga0501080_0018466 Ga0501080_0018466_2904_3320 138
187 3300050507 nmdc:mga05p37_358096_c1 nmdc:mga05p37_358096_c1_1126_1542 138
188 3300050508 nmdc:mga09592_1471786_c1 nmdc:mga09592_1471786_c1_18_434 138
189 3300050510 nmdc:mga06r32_1830_c1 nmdc:mga06r32_1830_c1_11104_11520 138
190 3300050512 nmdc:mga0n895_1671738_c1 nmdc:mga0n895_1671738_c1_107_523 138
191 3300050512 nmdc:mga0n895_1757687_c1 nmdc:mga0n895_1757687_c1_144_560 138
192 3300050512 nmdc:mga0n895_2015636_c1 nmdc:mga0n895_2015636_c1_12_428 138
193 3300050513 nmdc:mga0rr50_2212_c1 nmdc:mga0rr50_2212_c1_7019_7438 138
194 3300050513 nmdc:mga0rr50_49105_c1 nmdc:mga0rr50_49105_c1_874_1290 138
195 3300050513 nmdc:mga0rr50_49_c1 nmdc:mga0rr50_49_c1_26044_26460 138
196 3300050514 nmdc:mga08x19_636_c1 nmdc:mga08x19_636_c1_8232_8648 138
197 3300053083 Ga0495655_0000672 Ga0495655_0000672_2010_2426 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

7

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9916 3 137
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9881 3 137
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9878 3 137
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9857 3 137
3vgv-assembly6.cif.gz_L e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 0.9852 4 138
ID Description Score Start End Superfamily
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9829 3 137 3.30.70.141
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9814 3 132 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9774 3 138 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9773 3 137 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9771 20 138 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A6B1FGR7-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9987 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A0F9ZAZ5-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9968 3 132 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A5M4B4V4-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9961 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A661AA30-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.996 3 133 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-W6I8A5-F1-model_v4 deleted 0.9959 3 138

Feature Viewer

pLDDT pTM Quality
95.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map