F302645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 197 | 129 | 197 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100006647|Ga0070713_1000066477 |
| Length | 142 |
| Sequence | MRAAMANRTFTIIKPDSVRKGNFGKIISRIESEGFRILGIKKTNLSTRQAQAFYAVHRERPFFPALVEYMTSGPVYVAALERDGAVPYLRKVMGATDPKKADAGTIRADYGESIEQNAIHGSDSDENAAIEIAFFFAESELL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 107 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10174922 | 3300005293 | Bacteria | 1519 |
| 2 | Ga0065715_10493252 | 3300005293 | Bacteria | 786 |
| 3 | Ga0065707_10187185 | 3300005295 | Bacteria | 1382 |
| 4 | Ga0070658_10325839 | 3300005327 | Bacteria | 1312 |
| 5 | Ga0070676_10363416 | 3300005328 | Bacteria | 998 |
| 6 | Ga0070683_100000020 | 3300005329 | Bacteria | 189501 |
| 7 | Ga0070683_100659212 | 3300005329 | Bacteria | 1002 |
| 8 | Ga0070690_101563065 | 3300005330 | Bacteria | 534 |
| 9 | Ga0070670_100048976 | 3300005331 | Unclassified | 3635 |
| 10 | Ga0070670_101114114 | 3300005331 | Bacteria | 720 |
| 11 | Ga0068869_100434381 | 3300005334 | Unclassified | 1085 |
| 12 | Ga0070680_100000916 | 3300005336 | Bacteria | 20852 |
| 13 | Ga0070680_100334853 | 3300005336 | Bacteria | 1286 |
| 14 | Ga0068868_100000622 | 3300005338 | Bacteria | 23835 |
| 15 | Ga0070689_100002749 | 3300005340 | Bacteria | 11541 |
| 16 | Ga0070692_10013305 | 3300005345 | Bacteria | 3832 |
| 17 | Ga0070675_100000010 | 3300005354 | Bacteria | 243396 |
| 18 | Ga0070671_100700154 | 3300005355 | Bacteria | 879 |
| 19 | Ga0070674_100192311 | 3300005356 | Bacteria | 1570 |
| 20 | Ga0070674_100451424 | 3300005356 | Bacteria | 1061 |
| 21 | Ga0070673_100245915 | 3300005364 | Bacteria | 1557 |
| 22 | Ga0070673_100384506 | 3300005364 | Bacteria | 1252 |
| 23 | Ga0070673_100906199 | 3300005364 | Bacteria | 818 |
| 24 | Ga0070713_100006647 | 3300005436 | Bacteria | 8043 |
| 25 | Ga0070701_10000476 | 3300005438 | Bacteria | 13745 |
| 26 | Ga0070700_100000182 | 3300005441 | Bacteria | 35745 |
| 27 | Ga0068867_100167840 | 3300005459 | Bacteria | 1736 |
| 28 | Ga0068867_100466493 | 3300005459 | Bacteria | 1079 |
| 29 | Ga0070685_10008388 | 3300005466 | Bacteria | 5304 |
| 30 | Ga0070706_100101228 | 3300005467 | Bacteria | 2678 |
| 31 | Ga0070706_100651801 | 3300005467 | Unclassified | 977 |
| 32 | Ga0070707_100007633 | 3300005468 | Bacteria | 10045 |
| 33 | Ga0070707_100228344 | 3300005468 | Bacteria | 1812 |
| 34 | Ga0070698_100035843 | 3300005471 | Bacteria | 5128 |
| 35 | Ga0070698_100693468 | 3300005471 | Bacteria | 960 |
| 36 | Ga0070699_100077530 | 3300005518 | Bacteria | 2893 |
| 37 | Ga0070684_100003083 | 3300005535 | Bacteria | 12438 |
| 38 | Ga0070684_100324114 | 3300005535 | Bacteria | 1415 |
| 39 | Ga0070684_100732121 | 3300005535 | Bacteria | 923 |
| 40 | Ga0068853_100067051 | 3300005539 | Bacteria | 3117 |
| 41 | Ga0068853_100149734 | 3300005539 | Bacteria | 2100 |
| 42 | Ga0068853_101607360 | 3300005539 | Bacteria | 630 |
| 43 | Ga0070672_100031557 | 3300005543 | Bacteria | 3989 |
| 44 | Ga0070672_100183354 | 3300005543 | Bacteria | 1745 |
| 45 | Ga0070693_100027615 | 3300005547 | Bacteria | 3078 |
| 46 | Ga0068857_100087243 | 3300005577 | Bacteria | 2791 |
| 47 | Ga0068857_100982951 | 3300005577 | Bacteria | 812 |
| 48 | Ga0070702_100039936 | 3300005615 | Bacteria | 2622 |
| 49 | Ga0070702_100040001 | 3300005615 | Bacteria | 2620 |
| 50 | Ga0070702_100318306 | 3300005615 | Bacteria | 1083 |
| 51 | Ga0070702_101422712 | 3300005615 | Bacteria | 568 |
| 52 | Ga0068852_100423166 | 3300005616 | Bacteria | 1314 |
| 53 | Ga0068864_100000007 | 3300005618 | Bacteria | 392187 |
| 54 | Ga0068870_10008463 | 3300005840 | Bacteria | 4630 |
| 55 | Ga0068870_10018755 | 3300005840 | Bacteria | 3346 |
| 56 | Ga0068858_100001722 | 3300005842 | Bacteria | 22354 |
| 57 | Ga0068858_101199992 | 3300005842 | Bacteria | 746 |
| 58 | Ga0070717_10000034 | 3300006028 | Bacteria | 127047 |
| 59 | Ga0070716_100145892 | 3300006173 | Bacteria | 1516 |
| 60 | Ga0070716_100146580 | 3300006173 | Bacteria | 1513 |
| 61 | Ga0070716_100186766 | 3300006173 | Bacteria | 1366 |
| 62 | Ga0068871_100508437 | 3300006358 | Bacteria | 1087 |
| 63 | Ga0075428_100004048 | 3300006844 | Bacteria | 16111 |
| 64 | Ga0075428_100866345 | 3300006844 | Bacteria | 959 |
| 65 | Ga0075431_100002808 | 3300006847 | Bacteria | 16867 |
| 66 | Ga0075429_100389638 | 3300006880 | Bacteria | 1220 |
| 67 | Ga0068865_100712139 | 3300006881 | Bacteria | 859 |
| 68 | Ga0075436_100001342 | 3300006914 | Bacteria | 16755 |
| 69 | Ga0075435_100007166 | 3300007076 | Bacteria | 7929 |
| 70 | Ga0075435_100018208 | 3300007076 | Bacteria | 5334 |
| 71 | Ga0075435_100020452 | 3300007076 | Bacteria | 5073 |
| 72 | Ga0105244_10061875 | 3300009036 | Bacteria | 1883 |
| 73 | Ga0105240_10014643 | 3300009093 | Bacteria | 10701 |
| 74 | Ga0105245_10000035 | 3300009098 | Bacteria | 147165 |
| 75 | Ga0105245_10000163 | 3300009098 | Bacteria | 62999 |
| 76 | Ga0105245_10000397 | 3300009098 | Bacteria | 40390 |
| 77 | Ga0105245_10056359 | 3300009098 | Bacteria | 3532 |
| 78 | Ga0105245_11749311 | 3300009098 | Bacteria | 674 |
| 79 | Ga0114129_10469473 | 3300009147 | Bacteria | 1648 |
| 80 | Ga0114129_10555765 | 3300009147 | Bacteria | 1492 |
| 81 | Ga0114129_10875808 | 3300009147 | Bacteria | 1140 |
| 82 | Ga0114129_13085597 | 3300009147 | Unclassified | 545 |
| 83 | Ga0105242_10003299 | 3300009176 | Bacteria | 12568 |
| 84 | Ga0105248_10561206 | 3300009177 | Bacteria | 1288 |
| 85 | Ga0105238_10000010 | 3300009551 | Bacteria | 271274 |
| 86 | Ga0105239_10030438 | 3300010375 | Bacteria | 5936 |
| 87 | Ga0105246_10092183 | 3300011119 | Unclassified | 2186 |
| 88 | Ga0105246_10303229 | 3300011119 | Bacteria | 1291 |
| 89 | Ga0157369_10724343 | 3300013105 | Unclassified | 1024 |
| 90 | Ga0157374_10990164 | 3300013296 | Unclassified | 860 |
| 91 | Ga0157378_10000891 | 3300013297 | Bacteria | 27532 |
| 92 | Ga0157378_10001004 | 3300013297 | Bacteria | 25854 |
| 93 | Ga0157378_10135591 | 3300013297 | Bacteria | 2282 |
| 94 | Ga0157378_11595399 | 3300013297 | Bacteria | 698 |
| 95 | Ga0157378_12513558 | 3300013297 | Bacteria | 567 |
| 96 | Ga0163162_10080292 | 3300013306 | Bacteria | 3329 |
| 97 | Ga0163162_10655653 | 3300013306 | Bacteria | 1173 |
| 98 | Ga0157372_11091021 | 3300013307 | Bacteria | 923 |
| 99 | Ga0157375_10000003 | 3300013308 | Bacteria | 476325 |
| 100 | Ga0157375_10000066 | 3300013308 | Bacteria | 111876 |
| 101 | Ga0157375_11245451 | 3300013308 | Bacteria | 874 |
| 102 | Ga0163163_11037990 | 3300014325 | Bacteria | 883 |
| 103 | Ga0157380_10002981 | 3300014326 | Bacteria | 11524 |
| 104 | Ga0157377_10000108 | 3300014745 | Bacteria | 56604 |
| 105 | Ga0157377_10129996 | 3300014745 | Bacteria | 1537 |
| 106 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 107 | Ga0213876_10000015 | 3300021384 | Bacteria | 304025 |
| 108 | Ga0213876_10001360 | 3300021384 | Bacteria | 15283 |
| 109 | Ga0207655_1106920 | 3300025728 | Bacteria | 952 |
| 110 | Ga0207682_10090707 | 3300025893 | Bacteria | 1324 |
| 111 | Ga0207645_10472184 | 3300025907 | Bacteria | 848 |
| 112 | Ga0207643_10023575 | 3300025908 | Bacteria | 3393 |
| 113 | Ga0207643_10062579 | 3300025908 | Bacteria | 2126 |
| 114 | Ga0207684_10030588 | 3300025910 | Bacteria | 4582 |
| 115 | Ga0207684_10106500 | 3300025910 | Unclassified | 2398 |
| 116 | Ga0207684_10444654 | 3300025910 | Bacteria | 1113 |
| 117 | Ga0207695_10007115 | 3300025913 | Bacteria | 14332 |
| 118 | Ga0207663_10443567 | 3300025916 | Bacteria | 1000 |
| 119 | Ga0207660_10001362 | 3300025917 | Bacteria | 16372 |
| 120 | Ga0207662_10370256 | 3300025918 | Bacteria | 966 |
| 121 | Ga0207646_10947782 | 3300025922 | Unclassified | 762 |
| 122 | Ga0207694_10000002 | 3300025924 | Bacteria | 1165763 |
| 123 | Ga0207694_10000003 | 3300025924 | Bacteria | 1165533 |
| 124 | Ga0207694_11732709 | 3300025924 | Bacteria | 526 |
| 125 | Ga0207650_10167877 | 3300025925 | Bacteria | 1742 |
| 126 | Ga0207659_10000001 | 3300025926 | Bacteria | 660958 |
| 127 | Ga0207687_10000009 | 3300025927 | Bacteria | 443946 |
| 128 | Ga0207687_10000251 | 3300025927 | Bacteria | 36320 |
| 129 | Ga0207687_10000374 | 3300025927 | Bacteria | 29972 |
| 130 | Ga0207700_10051438 | 3300025928 | Bacteria | 3075 |
| 131 | Ga0207686_10005802 | 3300025934 | Bacteria | 6624 |
| 132 | Ga0207709_11511512 | 3300025935 | Unclassified | 557 |
| 133 | Ga0207670_10141375 | 3300025936 | Bacteria | 1775 |
| 134 | Ga0207669_10367966 | 3300025937 | Bacteria | 1116 |
| 135 | Ga0207704_10188252 | 3300025938 | Bacteria | 1499 |
| 136 | Ga0207665_10078909 | 3300025939 | Bacteria | 2262 |
| 137 | Ga0207665_10434649 | 3300025939 | Bacteria | 1005 |
| 138 | Ga0207691_10046113 | 3300025940 | Bacteria | 4007 |
| 139 | Ga0207691_10181618 | 3300025940 | Bacteria | 1838 |
| 140 | Ga0207711_10400291 | 3300025941 | Bacteria | 1276 |
| 141 | Ga0207689_10010625 | 3300025942 | Bacteria | 7924 |
| 142 | Ga0207689_10240465 | 3300025942 | Bacteria | 1496 |
| 143 | Ga0207661_10000002 | 3300025944 | Bacteria | 816104 |
| 144 | Ga0207661_10073935 | 3300025944 | Bacteria | 2793 |
| 145 | Ga0207679_10343587 | 3300025945 | Bacteria | 1299 |
| 146 | Ga0207651_10381572 | 3300025960 | Bacteria | 1194 |
| 147 | Ga0207651_10800770 | 3300025960 | Bacteria | 835 |
| 148 | Ga0207651_11837442 | 3300025960 | Bacteria | 545 |
| 149 | Ga0207677_10000001 | 3300026023 | Bacteria | 534789 |
| 150 | Ga0207703_10000069 | 3300026035 | Bacteria | 124592 |
| 151 | Ga0207703_10833089 | 3300026035 | Bacteria | 882 |
| 152 | Ga0207639_10000013 | 3300026041 | Bacteria | 293084 |
| 153 | Ga0207639_10017415 | 3300026041 | Bacteria | 5094 |
| 154 | Ga0207708_10000027 | 3300026075 | Bacteria | 166457 |
| 155 | Ga0207641_11868204 | 3300026088 | Bacteria | 602 |
| 156 | Ga0207648_10024384 | 3300026089 | Bacteria | 5400 |
| 157 | Ga0207676_10000015 | 3300026095 | Bacteria | 329100 |
| 158 | Ga0207674_10119078 | 3300026116 | Bacteria | 2610 |
| 159 | Ga0207675_100024474 | 3300026118 | Bacteria | 5614 |
| 160 | Ga0207698_10426093 | 3300026142 | Bacteria | 1274 |
| 161 | Ga0307511_10014004 | 3300030521 | Bacteria | 7812 |
| 162 | Ga0307412_10814564 | 3300031911 | Unclassified | 812 |
| 163 | Ga0307414_11953032 | 3300032004 | Unclassified | 548 |
| 164 | Ga0307411_12150818 | 3300032005 | Bacteria | 523 |
| 165 | Ga0307415_100352251 | 3300032126 | Bacteria | 1240 |
| 166 | Ga0307415_101384388 | 3300032126 | Bacteria | 669 |
| 167 | Ga0373932_0000936 | 3300035112 | Bacteria | 8544 |
| 168 | Ga0373941_0002292 | 3300035115 | Unclassified | 4192 |
| 169 | Ga0373943_0227390 | 3300035170 | Bacteria | 1041 |
| 170 | Ga0373943_0567329 | 3300035170 | Bacteria | 667 |
| 171 | Ga0436364_1208653 | 3300037853 | Unclassified | 803 |
| 172 | Ga0395901_0801627 | 3300038443 | Bacteria | 931 |
| 173 | Ga0436365_0161434 | 3300039437 | Bacteria | 117675 |
| 174 | Ga0436365_1019701 | 3300039437 | Bacteria | 4345 |
| 175 | Ga0436365_1897728 | 3300039437 | Bacteria | 14063 |
| 176 | Ga0436363_0917321 | 3300039450 | Bacteria | 1288 |
| 177 | Ga0436363_1254729 | 3300039450 | Bacteria | 1141 |
| 178 | Ga0436362_1305298 | 3300039453 | Bacteria | 131464 |
| 179 | Ga0451851_0962458 | 3300041507 | Bacteria | 809 |
| 180 | Ga0451576_0154482 | 3300045051 | Bacteria | 2394 |
| 181 | Ga0495620_0006286 | 3300046515 | Bacteria | 6535 |
| 182 | Ga0495621_0190378 | 3300046539 | Bacteria | 822 |
| 183 | Ga0495679_016046 | 3300047446 | Bacteria | 2720 |
| 184 | Ga0501073_0005530 | 3300049589 | Bacteria | 9463 |
| 185 | Ga0501079_0633058 | 3300049741 | Bacteria | 842 |
| 186 | Ga0501080_0018466 | 3300049742 | Bacteria | 6454 |
| 187 | nmdc:mga05p37_358096_c1 | 3300050507 | Bacteria | 1716 |
| 188 | nmdc:mga09592_1471786_c1 | 3300050508 | Bacteria | 555 |
| 189 | nmdc:mga06r32_1830_c1 | 3300050510 | Bacteria | 18991 |
| 190 | nmdc:mga0n895_1671738_c1 | 3300050512 | Bacteria | 600 |
| 191 | nmdc:mga0n895_1757687_c1 | 3300050512 | Bacteria | 582 |
| 192 | nmdc:mga0n895_2015636_c1 | 3300050512 | Unclassified | 535 |
| 193 | nmdc:mga0rr50_2212_c1 | 3300050513 | Bacteria | 10916 |
| 194 | nmdc:mga0rr50_49105_c1 | 3300050513 | Bacteria | 3123 |
| 195 | nmdc:mga0rr50_49_c1 | 3300050513 | Bacteria | 71590 |
| 196 | nmdc:mga08x19_636_c1 | 3300050514 | Bacteria | 22696 |
| 197 | Ga0495655_0000672 | 3300053083 | Bacteria | 5488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100866345 | Ga0075428_1008663451 | 128 |
| 2 | 3300006880 | Ga0075429_100389638 | Ga0075429_1003896382 | 128 |
| 3 | 3300005336 | Ga0070680_100000916 | Ga0070680_1000009167 | 130 |
| 4 | 3300005615 | Ga0070702_100040001 | Ga0070702_1000400013 | 130 |
| 5 | 3300005840 | Ga0068870_10018755 | Ga0068870_100187553 | 130 |
| 6 | 3300009176 | Ga0105242_10003299 | Ga0105242_100032998 | 130 |
| 7 | 3300013297 | Ga0157378_10135591 | Ga0157378_101355912 | 130 |
| 8 | 3300025908 | Ga0207643_10023575 | Ga0207643_100235752 | 130 |
| 9 | 3300025917 | Ga0207660_10001362 | Ga0207660_1000136212 | 130 |
| 10 | 3300025934 | Ga0207686_10005802 | Ga0207686_100058023 | 130 |
| 11 | 3300026118 | Ga0207675_100024474 | Ga0207675_1000244742 | 130 |
| 12 | 3300039450 | Ga0436363_1254729 | Ga0436363_1254729_637_1053 | 130 |
| 13 | 3300005329 | Ga0070683_100659212 | Ga0070683_1006592122 | 133 |
| 14 | 3300005338 | Ga0068868_100000622 | Ga0068868_10000062215 | 133 |
| 15 | 3300005842 | Ga0068858_101199992 | Ga0068858_1011999922 | 133 |
| 16 | 3300013297 | Ga0157378_11595399 | Ga0157378_115953992 | 133 |
| 17 | 3300025944 | Ga0207661_10073935 | Ga0207661_100739352 | 133 |
| 18 | 3300026023 | Ga0207677_10000001 | Ga0207677_10000001388 | 133 |
| 19 | 3300026035 | Ga0207703_10833089 | Ga0207703_108330892 | 133 |
| 20 | 3300035115 | Ga0373941_0002292 | Ga0373941_0002292_502_906 | 133 |
| 21 | 3300005293 | Ga0065715_10174922 | Ga0065715_101749222 | 138 |
| 22 | 3300005293 | Ga0065715_10493252 | Ga0065715_104932521 | 138 |
| 23 | 3300005295 | Ga0065707_10187185 | Ga0065707_101871852 | 138 |
| 24 | 3300005327 | Ga0070658_10325839 | Ga0070658_103258392 | 138 |
| 25 | 3300005328 | Ga0070676_10363416 | Ga0070676_103634161 | 138 |
| 26 | 3300005329 | Ga0070683_100000020 | Ga0070683_100000020130 | 138 |
| 27 | 3300005330 | Ga0070690_101563065 | Ga0070690_1015630651 | 138 |
| 28 | 3300005331 | Ga0070670_100048976 | Ga0070670_1000489763 | 138 |
| 29 | 3300005331 | Ga0070670_101114114 | Ga0070670_1011141142 | 138 |
| 30 | 3300005334 | Ga0068869_100434381 | Ga0068869_1004343812 | 138 |
| 31 | 3300005336 | Ga0070680_100334853 | Ga0070680_1003348532 | 138 |
| 32 | 3300005340 | Ga0070689_100002749 | Ga0070689_10000274912 | 138 |
| 33 | 3300005345 | Ga0070692_10013305 | Ga0070692_100133053 | 138 |
| 34 | 3300005354 | Ga0070675_100000010 | Ga0070675_10000001028 | 138 |
| 35 | 3300005355 | Ga0070671_100700154 | Ga0070671_1007001541 | 138 |
| 36 | 3300005356 | Ga0070674_100192311 | Ga0070674_1001923112 | 138 |
| 37 | 3300005356 | Ga0070674_100451424 | Ga0070674_1004514242 | 138 |
| 38 | 3300005364 | Ga0070673_100245915 | Ga0070673_1002459152 | 138 |
| 39 | 3300005364 | Ga0070673_100384506 | Ga0070673_1003845062 | 138 |
| 40 | 3300005364 | Ga0070673_100906199 | Ga0070673_1009061992 | 138 |
| 41 | 3300005436 | Ga0070713_100006647 | Ga0070713_1000066477 | 138 |
| 42 | 3300005438 | Ga0070701_10000476 | Ga0070701_100004762 | 138 |
| 43 | 3300005441 | Ga0070700_100000182 | Ga0070700_10000018230 | 138 |
| 44 | 3300005459 | Ga0068867_100167840 | Ga0068867_1001678401 | 138 |
| 45 | 3300005459 | Ga0068867_100466493 | Ga0068867_1004664932 | 138 |
| 46 | 3300005466 | Ga0070685_10008388 | Ga0070685_100083883 | 138 |
| 47 | 3300005467 | Ga0070706_100101228 | Ga0070706_1001012284 | 138 |
| 48 | 3300005467 | Ga0070706_100651801 | Ga0070706_1006518012 | 138 |
| 49 | 3300005468 | Ga0070707_100007633 | Ga0070707_1000076336 | 138 |
| 50 | 3300005468 | Ga0070707_100228344 | Ga0070707_1002283442 | 138 |
| 51 | 3300005471 | Ga0070698_100035843 | Ga0070698_1000358432 | 138 |
| 52 | 3300005471 | Ga0070698_100693468 | Ga0070698_1006934681 | 138 |
| 53 | 3300005518 | Ga0070699_100077530 | Ga0070699_1000775302 | 138 |
| 54 | 3300005535 | Ga0070684_100003083 | Ga0070684_1000030832 | 138 |
| 55 | 3300005535 | Ga0070684_100324114 | Ga0070684_1003241142 | 138 |
| 56 | 3300005535 | Ga0070684_100732121 | Ga0070684_1007321212 | 138 |
| 57 | 3300005539 | Ga0068853_100067051 | Ga0068853_1000670512 | 138 |
| 58 | 3300005539 | Ga0068853_100149734 | Ga0068853_1001497342 | 138 |
| 59 | 3300005539 | Ga0068853_101607360 | Ga0068853_1016073601 | 138 |
| 60 | 3300005543 | Ga0070672_100031557 | Ga0070672_1000315572 | 138 |
| 61 | 3300005543 | Ga0070672_100183354 | Ga0070672_1001833542 | 138 |
| 62 | 3300005547 | Ga0070693_100027615 | Ga0070693_1000276151 | 138 |
| 63 | 3300005577 | Ga0068857_100087243 | Ga0068857_1000872432 | 138 |
| 64 | 3300005577 | Ga0068857_100982951 | Ga0068857_1009829512 | 138 |
| 65 | 3300005615 | Ga0070702_100039936 | Ga0070702_1000399363 | 138 |
| 66 | 3300005615 | Ga0070702_100318306 | Ga0070702_1003183062 | 138 |
| 67 | 3300005615 | Ga0070702_101422712 | Ga0070702_1014227121 | 138 |
| 68 | 3300005616 | Ga0068852_100423166 | Ga0068852_1004231662 | 138 |
| 69 | 3300005618 | Ga0068864_100000007 | Ga0068864_10000000730 | 138 |
| 70 | 3300005840 | Ga0068870_10008463 | Ga0068870_100084632 | 138 |
| 71 | 3300005842 | Ga0068858_100001722 | Ga0068858_1000017224 | 138 |
| 72 | 3300006028 | Ga0070717_10000034 | Ga0070717_1000003468 | 138 |
| 73 | 3300006173 | Ga0070716_100145892 | Ga0070716_1001458923 | 138 |
| 74 | 3300006173 | Ga0070716_100146580 | Ga0070716_1001465803 | 138 |
| 75 | 3300006173 | Ga0070716_100186766 | Ga0070716_1001867662 | 138 |
| 76 | 3300006358 | Ga0068871_100508437 | Ga0068871_1005084372 | 138 |
| 77 | 3300006844 | Ga0075428_100004048 | Ga0075428_1000040487 | 138 |
| 78 | 3300006847 | Ga0075431_100002808 | Ga0075431_1000028086 | 138 |
| 79 | 3300006881 | Ga0068865_100712139 | Ga0068865_1007121392 | 138 |
| 80 | 3300006914 | Ga0075436_100001342 | Ga0075436_1000013424 | 138 |
| 81 | 3300007076 | Ga0075435_100007166 | Ga0075435_1000071662 | 138 |
| 82 | 3300007076 | Ga0075435_100018208 | Ga0075435_1000182086 | 138 |
| 83 | 3300007076 | Ga0075435_100020452 | Ga0075435_1000204522 | 138 |
| 84 | 3300009036 | Ga0105244_10061875 | Ga0105244_100618752 | 138 |
| 85 | 3300009093 | Ga0105240_10014643 | Ga0105240_100146439 | 138 |
| 86 | 3300009098 | Ga0105245_10000035 | Ga0105245_1000003539 | 138 |
| 87 | 3300009098 | Ga0105245_10000163 | Ga0105245_1000016339 | 138 |
| 88 | 3300009098 | Ga0105245_10000397 | Ga0105245_1000039714 | 138 |
| 89 | 3300009098 | Ga0105245_10056359 | Ga0105245_100563594 | 138 |
| 90 | 3300009098 | Ga0105245_11749311 | Ga0105245_117493112 | 138 |
| 91 | 3300009147 | Ga0114129_10469473 | Ga0114129_104694732 | 138 |
| 92 | 3300009147 | Ga0114129_10555765 | Ga0114129_105557652 | 138 |
| 93 | 3300009147 | Ga0114129_10875808 | Ga0114129_108758082 | 138 |
| 94 | 3300009147 | Ga0114129_13085597 | Ga0114129_130855971 | 138 |
| 95 | 3300009177 | Ga0105248_10561206 | Ga0105248_105612062 | 138 |
| 96 | 3300009551 | Ga0105238_10000010 | Ga0105238_1000001054 | 138 |
| 97 | 3300010375 | Ga0105239_10030438 | Ga0105239_100304384 | 138 |
| 98 | 3300011119 | Ga0105246_10092183 | Ga0105246_100921832 | 138 |
| 99 | 3300011119 | Ga0105246_10303229 | Ga0105246_103032292 | 138 |
| 100 | 3300013105 | Ga0157369_10724343 | Ga0157369_107243432 | 138 |
| 101 | 3300013296 | Ga0157374_10990164 | Ga0157374_109901641 | 138 |
| 102 | 3300013297 | Ga0157378_10000891 | Ga0157378_1000089118 | 138 |
| 103 | 3300013297 | Ga0157378_10001004 | Ga0157378_1000100419 | 138 |
| 104 | 3300013297 | Ga0157378_12513558 | Ga0157378_125135581 | 138 |
| 105 | 3300013306 | Ga0163162_10080292 | Ga0163162_100802923 | 138 |
| 106 | 3300013306 | Ga0163162_10655653 | Ga0163162_106556532 | 138 |
| 107 | 3300013307 | Ga0157372_11091021 | Ga0157372_110910212 | 138 |
| 108 | 3300013308 | Ga0157375_10000003 | Ga0157375_10000003354 | 138 |
| 109 | 3300013308 | Ga0157375_10000066 | Ga0157375_1000006667 | 138 |
| 110 | 3300013308 | Ga0157375_11245451 | Ga0157375_112454512 | 138 |
| 111 | 3300014325 | Ga0163163_11037990 | Ga0163163_110379901 | 138 |
| 112 | 3300014326 | Ga0157380_10002981 | Ga0157380_100029814 | 138 |
| 113 | 3300014745 | Ga0157377_10000108 | Ga0157377_1000010848 | 138 |
| 114 | 3300014745 | Ga0157377_10129996 | Ga0157377_101299962 | 138 |
| 115 | 3300021358 | Ga0213873_10000001 | Ga0213873_10000001200 | 138 |
| 116 | 3300021384 | Ga0213876_10000015 | Ga0213876_100000158 | 138 |
| 117 | 3300021384 | Ga0213876_10001360 | Ga0213876_100013603 | 138 |
| 118 | 3300025728 | Ga0207655_1106920 | Ga0207655_11069202 | 138 |
| 119 | 3300025893 | Ga0207682_10090707 | Ga0207682_100907072 | 138 |
| 120 | 3300025907 | Ga0207645_10472184 | Ga0207645_104721842 | 138 |
| 121 | 3300025908 | Ga0207643_10062579 | Ga0207643_100625793 | 138 |
| 122 | 3300025910 | Ga0207684_10030588 | Ga0207684_100305884 | 138 |
| 123 | 3300025910 | Ga0207684_10106500 | Ga0207684_101065002 | 138 |
| 124 | 3300025910 | Ga0207684_10444654 | Ga0207684_104446542 | 138 |
| 125 | 3300025913 | Ga0207695_10007115 | Ga0207695_1000711514 | 138 |
| 126 | 3300025916 | Ga0207663_10443567 | Ga0207663_104435672 | 138 |
| 127 | 3300025918 | Ga0207662_10370256 | Ga0207662_103702561 | 138 |
| 128 | 3300025922 | Ga0207646_10947782 | Ga0207646_109477822 | 138 |
| 129 | 3300025924 | Ga0207694_10000002 | Ga0207694_10000002229 | 138 |
| 130 | 3300025924 | Ga0207694_10000003 | Ga0207694_10000003871 | 138 |
| 131 | 3300025924 | Ga0207694_11732709 | Ga0207694_117327092 | 138 |
| 132 | 3300025925 | Ga0207650_10167877 | Ga0207650_101678772 | 138 |
| 133 | 3300025926 | Ga0207659_10000001 | Ga0207659_10000001213 | 138 |
| 134 | 3300025927 | Ga0207687_10000009 | Ga0207687_10000009298 | 138 |
| 135 | 3300025927 | Ga0207687_10000251 | Ga0207687_1000025122 | 138 |
| 136 | 3300025927 | Ga0207687_10000374 | Ga0207687_100003749 | 138 |
| 137 | 3300025928 | Ga0207700_10051438 | Ga0207700_100514383 | 138 |
| 138 | 3300025935 | Ga0207709_11511512 | Ga0207709_115115121 | 138 |
| 139 | 3300025936 | Ga0207670_10141375 | Ga0207670_101413752 | 138 |
| 140 | 3300025937 | Ga0207669_10367966 | Ga0207669_103679662 | 138 |
| 141 | 3300025938 | Ga0207704_10188252 | Ga0207704_101882522 | 138 |
| 142 | 3300025939 | Ga0207665_10078909 | Ga0207665_100789093 | 138 |
| 143 | 3300025939 | Ga0207665_10434649 | Ga0207665_104346492 | 138 |
| 144 | 3300025940 | Ga0207691_10046113 | Ga0207691_100461133 | 138 |
| 145 | 3300025940 | Ga0207691_10181618 | Ga0207691_101816182 | 138 |
| 146 | 3300025941 | Ga0207711_10400291 | Ga0207711_104002912 | 138 |
| 147 | 3300025942 | Ga0207689_10010625 | Ga0207689_100106254 | 138 |
| 148 | 3300025942 | Ga0207689_10240465 | Ga0207689_102404652 | 138 |
| 149 | 3300025944 | Ga0207661_10000002 | Ga0207661_10000002265 | 138 |
| 150 | 3300025945 | Ga0207679_10343587 | Ga0207679_103435872 | 138 |
| 151 | 3300025960 | Ga0207651_10381572 | Ga0207651_103815722 | 138 |
| 152 | 3300025960 | Ga0207651_10800770 | Ga0207651_108007702 | 138 |
| 153 | 3300025960 | Ga0207651_11837442 | Ga0207651_118374421 | 138 |
| 154 | 3300026035 | Ga0207703_10000069 | Ga0207703_1000006919 | 138 |
| 155 | 3300026041 | Ga0207639_10000013 | Ga0207639_10000013286 | 138 |
| 156 | 3300026041 | Ga0207639_10017415 | Ga0207639_100174153 | 138 |
| 157 | 3300026075 | Ga0207708_10000027 | Ga0207708_1000002780 | 138 |
| 158 | 3300026088 | Ga0207641_11868204 | Ga0207641_118682041 | 138 |
| 159 | 3300026089 | Ga0207648_10024384 | Ga0207648_100243845 | 138 |
| 160 | 3300026095 | Ga0207676_10000015 | Ga0207676_10000015300 | 138 |
| 161 | 3300026116 | Ga0207674_10119078 | Ga0207674_101190782 | 138 |
| 162 | 3300026142 | Ga0207698_10426093 | Ga0207698_104260932 | 138 |
| 163 | 3300030521 | Ga0307511_10014004 | Ga0307511_100140047 | 138 |
| 164 | 3300031911 | Ga0307412_10814564 | Ga0307412_108145641 | 138 |
| 165 | 3300032004 | Ga0307414_11953032 | Ga0307414_119530322 | 138 |
| 166 | 3300032005 | Ga0307411_12150818 | Ga0307411_121508181 | 138 |
| 167 | 3300032126 | Ga0307415_100352251 | Ga0307415_1003522512 | 138 |
| 168 | 3300032126 | Ga0307415_101384388 | Ga0307415_1013843881 | 138 |
| 169 | 3300035112 | Ga0373932_0000936 | Ga0373932_0000936_1216_1632 | 138 |
| 170 | 3300035170 | Ga0373943_0227390 | Ga0373943_0227390_115_531 | 138 |
| 171 | 3300035170 | Ga0373943_0567329 | Ga0373943_0567329_196_612 | 138 |
| 172 | 3300037853 | Ga0436364_1208653 | Ga0436364_1208653_140_559 | 138 |
| 173 | 3300038443 | Ga0395901_0801627 | Ga0395901_0801627_466_882 | 138 |
| 174 | 3300039437 | Ga0436365_0161434 | Ga0436365_0161434_80620_81036 | 138 |
| 175 | 3300039437 | Ga0436365_1019701 | Ga0436365_1019701_1208_1636 | 138 |
| 176 | 3300039437 | Ga0436365_1897728 | Ga0436365_1897728_4784_5203 | 138 |
| 177 | 3300039450 | Ga0436363_0917321 | Ga0436363_0917321_22_438 | 138 |
| 178 | 3300039453 | Ga0436362_1305298 | Ga0436362_1305298_80586_81002 | 138 |
| 179 | 3300041507 | Ga0451851_0962458 | Ga0451851_0962458_189_611 | 138 |
| 180 | 3300045051 | Ga0451576_0154482 | Ga0451576_0154482_1868_2284 | 138 |
| 181 | 3300046515 | Ga0495620_0006286 | Ga0495620_0006286_575_991 | 138 |
| 182 | 3300046539 | Ga0495621_0190378 | Ga0495621_0190378_174_590 | 138 |
| 183 | 3300047446 | Ga0495679_016046 | Ga0495679_016046_778_1194 | 138 |
| 184 | 3300049589 | Ga0501073_0005530 | Ga0501073_0005530_2876_3292 | 138 |
| 185 | 3300049741 | Ga0501079_0633058 | Ga0501079_0633058_101_517 | 138 |
| 186 | 3300049742 | Ga0501080_0018466 | Ga0501080_0018466_2904_3320 | 138 |
| 187 | 3300050507 | nmdc:mga05p37_358096_c1 | nmdc:mga05p37_358096_c1_1126_1542 | 138 |
| 188 | 3300050508 | nmdc:mga09592_1471786_c1 | nmdc:mga09592_1471786_c1_18_434 | 138 |
| 189 | 3300050510 | nmdc:mga06r32_1830_c1 | nmdc:mga06r32_1830_c1_11104_11520 | 138 |
| 190 | 3300050512 | nmdc:mga0n895_1671738_c1 | nmdc:mga0n895_1671738_c1_107_523 | 138 |
| 191 | 3300050512 | nmdc:mga0n895_1757687_c1 | nmdc:mga0n895_1757687_c1_144_560 | 138 |
| 192 | 3300050512 | nmdc:mga0n895_2015636_c1 | nmdc:mga0n895_2015636_c1_12_428 | 138 |
| 193 | 3300050513 | nmdc:mga0rr50_2212_c1 | nmdc:mga0rr50_2212_c1_7019_7438 | 138 |
| 194 | 3300050513 | nmdc:mga0rr50_49105_c1 | nmdc:mga0rr50_49105_c1_874_1290 | 138 |
| 195 | 3300050513 | nmdc:mga0rr50_49_c1 | nmdc:mga0rr50_49_c1_26044_26460 | 138 |
| 196 | 3300050514 | nmdc:mga08x19_636_c1 | nmdc:mga08x19_636_c1_8232_8648 | 138 |
| 197 | 3300053083 | Ga0495655_0000672 | Ga0495655_0000672_2010_2426 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nck-assembly1.cif.gz_R | crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution | 0.9916 | 3 | 137 |
| 6aes-assembly2.cif.gz_B | crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. | 0.9881 | 3 | 137 |
| 5v6d-assembly3.cif.gz_F | crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate | 0.9878 | 3 | 137 |
| 4ek2-assembly1.cif.gz_A | the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate | 0.9857 | 3 | 137 |
| 3vgv-assembly6.cif.gz_L | e134a mutant nucleoside diphosphate kinase derived from halomonas sp. 593 | 0.9852 | 4 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ay1G00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9829 | 3 | 137 | 3.30.70.141 |
| af_Q6Z7E5_29_180_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9814 | 3 | 132 | 3.30.70.141 |
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9774 | 3 | 138 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9773 | 3 | 137 | 3.30.70.141 |
| af_A0A1D6EH51_54_191_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9771 | 20 | 138 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1FGR7-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9987 | 3 | 138 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A0F9ZAZ5-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 0.9968 | 3 | 132 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A5M4B4V4-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9961 | 3 | 138 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A661AA30-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 0.996 | 3 | 133 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-W6I8A5-F1-model_v4 | deleted | 0.9959 | 3 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar