F302472

General Info

Members Datasets Scaffolds Average Seq Length
197 121 188 151

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000330|Ga0070658_1000033016
Length 151
Sequence MSSAAPSPSPEQTLPSKIIKTRFDSDDFFGHQRAERSELPNPAPLLENLTRCVIEILAGARDLEQISRWVSDDVYRHLLKRVVLSARARQARGQRTVSRPHFTLGATVLTEPSEGVIEAVVMVHSRARSRAVALRLEGMDRRWRATAVNVL

Samples

Sample ID Description Type Environment
1 2643221572 Leifsonia sp. Root60 Isolate Unclassified
2 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
3 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
4 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
5 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
6 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
7 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
8 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
9 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
76 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
77 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
111 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
112 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
117 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
120 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0.51
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.71
Nodule 0
Rhizoplane 2.03
Rhizosphere 68.53
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10082044 3300003316 Bacteria 1377
2 rootH1_10121248 3300003316 Bacteria 1784
3 rootH2_10095711 3300003320 Bacteria 1309
4 Ga0065714_10192921 3300005288 Bacteria 921
5 Ga0070658_10000330 3300005327 Bacteria 40639
6 Ga0070658_10018246 3300005327 Bacteria 5615
7 Ga0070660_100114785 3300005339 Bacteria 2146
8 Ga0070659_100014681 3300005366 Bacteria 5856
9 Ga0070710_10027317 3300005437 Bacteria 3042
10 Ga0070710_10186612 3300005437 Bacteria 1302
11 Ga0070672_100044866 3300005543 Bacteria 3416
12 Ga0068855_100000350 3300005563 Bacteria 57157
13 Ga0068855_100036991 3300005563 Bacteria 5807
14 Ga0068855_100308020 3300005563 Bacteria 1753
15 Ga0068855_100475621 3300005563 Bacteria 1361
16 Ga0068855_100558121 3300005563 Bacteria 1239
17 Ga0068857_100003200 3300005577 Bacteria 13576
18 Ga0068857_100891253 3300005577 Bacteria 853
19 Ga0068856_100474002 3300005614 Bacteria 1272
20 Ga0068852_100016475 3300005616 Bacteria 5765
21 Ga0068852_100075967 3300005616 Bacteria 2965
22 Ga0068864_100012861 3300005618 Bacteria 6923
23 Ga0068851_10000001 3300005834 Bacteria 495512
24 Ga0068858_100000048 3300005842 Bacteria 126360
25 Ga0075370_10418075 3300006353 Bacteria 805
26 Ga0105240_10004542 3300009093 Bacteria 21071
27 Ga0111539_10557965 3300009094 Bacteria 1334
28 Ga0105247_10086921 3300009101 Bacteria 1979
29 Ga0105243_11141130 3300009148 Bacteria 790
30 Ga0105241_10004547 3300009174 Bacteria 10263
31 Ga0105248_10000386 3300009177 Bacteria 50878
32 Ga0105237_10000738 3300009545 Bacteria 45118
33 Ga0105237_10057707 3300009545 Bacteria 3884
34 Ga0105237_10187911 3300009545 Bacteria 2066
35 Ga0105238_10012928 3300009551 Bacteria 8424
36 Ga0157371_11231790 3300013102 Bacteria 577
37 Ga0157370_10006580 3300013104 Bacteria 12794
38 Ga0157369_10000103 3300013105 Bacteria 118273
39 Ga0157374_10229262 3300013296 Bacteria 1824
40 Ga0157374_10323772 3300013296 Bacteria 1528
41 Ga0157375_10555503 3300013308 Bacteria 1309
42 Ga0163163_10006968 3300014325 Bacteria 9936
43 Ga0163163_11346159 3300014325 Bacteria 776
44 Ga0206354_11579587 3300020081 Bacteria 1030
45 Ga0209148_1001081 3300025254 Bacteria 16587
46 Ga0207656_10000002 3300025321 Bacteria 792178
47 Ga0207692_10007058 3300025898 Bacteria 4586
48 Ga0207710_10026621 3300025900 Bacteria 2500
49 Ga0207647_10085408 3300025904 Bacteria 1888
50 Ga0207705_10000001 3300025909 Bacteria 2061880
51 Ga0207705_10852674 3300025909 Bacteria 706
52 Ga0207654_10000001 3300025911 Bacteria 1816198
53 Ga0207695_10001278 3300025913 Bacteria 42811
54 Ga0207671_10000002 3300025914 Bacteria 1144816
55 Ga0207671_10150209 3300025914 Bacteria 1799
56 Ga0207671_10196427 3300025914 Bacteria 1574
57 Ga0207694_10000022 3300025924 Bacteria 288900
58 Ga0207644_10308368 3300025931 Bacteria 1277
59 Ga0207690_10095341 3300025932 Bacteria 2113
60 Ga0207691_10213397 3300025940 Bacteria 1676
61 Ga0207711_10001198 3300025941 Bacteria 24535
62 Ga0207667_10000951 3300025949 Bacteria 36966
63 Ga0207667_10053934 3300025949 Bacteria 4229
64 Ga0207667_10263335 3300025949 Bacteria 1763
65 Ga0207703_10000064 3300026035 Bacteria 126619
66 Ga0207678_10090168 3300026067 Bacteria 2621
67 Ga0207678_11744442 3300026067 Bacteria 546
68 Ga0207702_10175992 3300026078 Bacteria 1966
69 Ga0207702_10623633 3300026078 Bacteria 1059
70 Ga0207641_10088667 3300026088 Bacteria 2702
71 Ga0207641_11225696 3300026088 Bacteria 750
72 Ga0207676_10012058 3300026095 Bacteria 6185
73 Ga0207674_10027907 3300026116 Bacteria 5964
74 Ga0207674_10331085 3300026116 Bacteria 1473
75 Ga0207698_10000063 3300026142 Bacteria 72803
76 Ga0207698_10000323 3300026142 Bacteria 28504
77 Ga0307515_10730143 3300028794 Bacteria 608
78 Ga0307513_10306458 3300031456 Bacteria 1352
79 Ga0307408_101558839 3300031548 Bacteria 626
80 Ga0307514_10007171 3300031649 Bacteria 9618
81 Ga0307514_10077548 3300031649 Unclassified 2471
82 Ga0307414_11501292 3300032004 Bacteria 627
83 Ga0451789_1270319 3300041443 Bacteria 1254
84 Ga0451797_1103579 3300041453 Bacteria 745
85 Ga0451797_1572962 3300041453 Bacteria 764
86 Ga0451795_1589216 3300041456 Bacteria 948
87 Ga0451843_1299647 3300041509 Bacteria 643
88 Ga0466965_0000021 3300044683 Bacteria 62817
89 Ga0466965_0660473 3300044683 Bacteria 597
90 Ga0495590_0000336 3300046457 Bacteria 24394
91 Ga0495656_0052749 3300046615 Bacteria 1745
92 Ga0495626_0047403 3300048091 Bacteria 1998
93 Ga0496117_0043819 3300048920 Bacteria 3249
94 Ga0496117_0104685 3300048920 Bacteria 1780
95 Ga0496118_0482957 3300048921 Bacteria 621
96 Ga0496119_0002554 3300048922 Bacteria 19815
97 Ga0496119_0006102 3300048922 Bacteria 11287
98 Ga0496119_0087333 3300048922 Bacteria 1780
99 Ga0496119_0341890 3300048922 Bacteria 727
100 Ga0496120_0003954 3300048923 Bacteria 12894
101 Ga0496120_0009672 3300048923 Bacteria 6805
102 Ga0496120_0100732 3300048923 Bacteria 1527
103 Ga0496121_0000025 3300048924 Bacteria 453467
104 Ga0496121_0161799 3300048924 Bacteria 1636
105 Ga0496121_0183920 3300048924 Bacteria 1505
106 Ga0496121_0275154 3300048924 Bacteria 1155
107 Ga0496122_0001607 3300048925 Bacteria 35329
108 Ga0496123_0181008 3300048926 Bacteria 1101
109 Ga0496126_0314557 3300048929 Bacteria 1288
110 Ga0496126_0515969 3300048929 Unclassified 953
111 Ga0501031_0200789 3300049568 Bacteria 1301
112 Ga0501032_0030015 3300049569 Bacteria 3730
113 Ga0501032_0045850 3300049569 Bacteria 2955
114 Ga0501032_0121224 3300049569 Bacteria 1729
115 Ga0501032_0632825 3300049569 Bacteria 680
116 Ga0501034_0040697 3300049571 Bacteria 4703
117 Ga0501034_0055510 3300049571 Bacteria 3985
118 Ga0501034_0063596 3300049571 Bacteria 3703
119 Ga0501034_0111556 3300049571 Bacteria 2725
120 Ga0501034_0138502 3300049571 Bacteria 2414
121 Ga0501034_0241730 3300049571 Bacteria 1751
122 Ga0501034_0302398 3300049571 Bacteria 1536
123 Ga0501034_0329108 3300049571 Bacteria 1459
124 Ga0501034_0405863 3300049571 Bacteria 1285
125 Ga0501034_0532669 3300049571 Bacteria 1085
126 Ga0501034_0539666 3300049571 Bacteria 1076
127 Ga0501034_0615151 3300049571 Bacteria 991
128 Ga0501034_0980450 3300049571 Bacteria 730
129 Ga0501036_0306134 3300049572 Bacteria 1329
130 Ga0501036_0365491 3300049572 Bacteria 1204
131 Ga0501037_0003899 3300049573 Bacteria 10824
132 Ga0501037_0061543 3300049573 Bacteria 2737
133 Ga0501037_0076432 3300049573 Bacteria 2431
134 Ga0501038_0182972 3300049574 Bacteria 1690
135 Ga0501039_0689893 3300049575 Bacteria 799
136 Ga0501043_0007770 3300049579 Bacteria 8485
137 Ga0501043_0393163 3300049579 Bacteria 1048
138 Ga0501046_0737761 3300049580 Bacteria 692
139 Ga0501047_0000770 3300049581 Bacteria 33540
140 Ga0501047_0060000 3300049581 Bacteria 3672
141 Ga0501047_0410526 3300049581 Bacteria 1186
142 Ga0501048_0308033 3300049582 Bacteria 1127
143 Ga0501067_0515190 3300049583 Bacteria 669
144 Ga0501068_0197462 3300049584 Bacteria 1276
145 Ga0501069_0015381 3300049585 Bacteria 4100
146 Ga0501069_0085215 3300049585 Bacteria 1783
147 Ga0501070_0000760 3300049586 Bacteria 29426
148 Ga0501070_0009390 3300049586 Bacteria 8269
149 Ga0501070_0108362 3300049586 Bacteria 2295
150 Ga0501070_0671455 3300049586 Bacteria 821
151 Ga0501071_0000109 3300049587 Bacteria 32090
152 Ga0501072_0550331 3300049588 Bacteria 911
153 Ga0501073_0005223 3300049589 Bacteria 9737
154 Ga0501073_0030420 3300049589 Bacteria 3855
155 Ga0501079_0210630 3300049741 Bacteria 1518
156 Ga0501080_0000038 3300049742 Bacteria 82193
157 Ga0501083_0086289 3300049744 Bacteria 2076
158 Ga0501083_0320614 3300049744 Bacteria 1008
159 Ga0501035_0006967 3300049822 Bacteria 10558
160 Ga0501044_0003539 3300049823 Bacteria 17583
161 Ga0501044_0309575 3300049823 Bacteria 1506
162 nmdc:mga06z11_684867_c1 3300050494 Bacteria 624
163 Ga0500651_0000713 3300053093 Bacteria 16369
164 Ga0500650_0045929 3300053098 Bacteria 2023
165 Ga0500554_165714 3300053102 Bacteria 745
166 Ga0500556_0000001 3300053104 Bacteria 1135060
167 Ga0500621_128428 3300053126 Unclassified 974
168 Ga0500559_0004611 3300053136 Bacteria 6511
169 Ga0500559_0005264 3300053136 Bacteria 5963
170 Ga0500559_0225655 3300053136 Bacteria 883
171 Ga0500568_0000003 3300053139 Bacteria 863587
172 Ga0500568_0036409 3300053139 Bacteria 2002
173 Ga0500568_0263327 3300053139 Bacteria 627
174 Ga0500573_0010087 3300053140 Bacteria 5264
175 Ga0500573_0045487 3300053140 Bacteria 2530
176 Ga0500573_0057280 3300053140 Bacteria 2236
177 Ga0500573_0152437 3300053140 Bacteria 1264
178 Ga0500573_0168597 3300053140 Bacteria 1186
179 Ga0500573_0283318 3300053140 Bacteria 837
180 Ga0500577_0041223 3300053142 Bacteria 1683
181 Ga0500577_0085348 3300053142 Bacteria 1266
182 Ga0500577_0172174 3300053142 Bacteria 926
183 Ga0500590_004780 3300053148 Bacteria 6446
184 Ga0500616_0001065 3300053153 Bacteria 28823
185 Ga0500620_022083 3300053155 Bacteria 1912
186 Ga0500636_0457887 3300053177 Bacteria 575
187 Ga0501084_0243685 3300054114 Bacteria 1517
188 Ga0501084_1363424 3300054114 Bacteria 594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10018246 Ga0070658_100182465 132
2 3300005577 Ga0068857_100003200 Ga0068857_1000032009 132
3 3300005614 Ga0068856_100474002 Ga0068856_1004740022 132
4 3300005616 Ga0068852_100075967 Ga0068852_1000759671 132
5 3300005834 Ga0068851_10000001 Ga0068851_10000001310 132
6 3300009148 Ga0105243_11141130 Ga0105243_111411301 132
7 3300009545 Ga0105237_10000738 Ga0105237_1000073836 132
8 3300009551 Ga0105238_10012928 Ga0105238_100129284 132
9 3300025321 Ga0207656_10000002 Ga0207656_10000002618 132
10 3300025909 Ga0207705_10852674 Ga0207705_108526741 132
11 3300025914 Ga0207671_10000002 Ga0207671_10000002912 132
12 3300025924 Ga0207694_10000022 Ga0207694_10000022263 132
13 3300026078 Ga0207702_10623633 Ga0207702_106236331 132
14 3300026088 Ga0207641_11225696 Ga0207641_112256961 132
15 3300026116 Ga0207674_10027907 Ga0207674_100279075 132
16 3300026142 Ga0207698_10000063 Ga0207698_100000631 132
17 3300053148 Ga0500590_004780 Ga0500590_004780_5573_6034 132
18 3300053177 Ga0500636_0457887 Ga0500636_0457887_80_559 132
19 3300005543 Ga0070672_100044866 Ga0070672_1000448663 133
20 3300005563 Ga0068855_100000350 Ga0068855_10000035041 133
21 3300005563 Ga0068855_100475621 Ga0068855_1004756211 133
22 3300005577 Ga0068857_100891253 Ga0068857_1008912531 133
23 3300005616 Ga0068852_100016475 Ga0068852_1000164756 133
24 3300005618 Ga0068864_100012861 Ga0068864_1000128613 133
25 3300009093 Ga0105240_10004542 Ga0105240_100045423 133
26 3300009101 Ga0105247_10086921 Ga0105247_100869212 133
27 3300009174 Ga0105241_10004547 Ga0105241_100045478 133
28 3300009177 Ga0105248_10000386 Ga0105248_100003868 133
29 3300009545 Ga0105237_10057707 Ga0105237_100577075 133
30 3300009545 Ga0105237_10187911 Ga0105237_101879113 133
31 3300013296 Ga0157374_10229262 Ga0157374_102292622 133
32 3300013296 Ga0157374_10323772 Ga0157374_103237722 133
33 3300014325 Ga0163163_10006968 Ga0163163_100069685 133
34 3300025254 Ga0209148_1001081 Ga0209148_100108112 133
35 3300025900 Ga0207710_10026621 Ga0207710_100266212 133
36 3300025911 Ga0207654_10000001 Ga0207654_100000011243 133
37 3300025913 Ga0207695_10001278 Ga0207695_1000127817 133
38 3300025914 Ga0207671_10150209 Ga0207671_101502093 133
39 3300025914 Ga0207671_10196427 Ga0207671_101964271 133
40 3300025931 Ga0207644_10308368 Ga0207644_103083681 133
41 3300025940 Ga0207691_10213397 Ga0207691_102133972 133
42 3300025941 Ga0207711_10001198 Ga0207711_1000119817 133
43 3300025949 Ga0207667_10000951 Ga0207667_1000095123 133
44 3300026078 Ga0207702_10175992 Ga0207702_101759923 133
45 3300026088 Ga0207641_10088667 Ga0207641_100886672 133
46 3300026095 Ga0207676_10012058 Ga0207676_100120582 133
47 3300026116 Ga0207674_10331085 Ga0207674_103310851 133
48 3300026142 Ga0207698_10000323 Ga0207698_1000032322 133
49 3300048923 Ga0496120_0009672 Ga0496120_0009672_6100_6606 133
50 3300048923 Ga0496120_0100732 Ga0496120_0100732_607_1071 133
51 3300049571 Ga0501034_0138502 Ga0501034_0138502_592_1068 133
52 3300049571 Ga0501034_0405863 Ga0501034_0405863_43_540 133
53 3300049571 Ga0501034_0980450 Ga0501034_0980450_202_678 133
54 3300053093 Ga0500651_0000713 Ga0500651_0000713_14995_15474 133
55 3300053136 Ga0500559_0225655 Ga0500559_0225655_242_721 133
56 3300053155 Ga0500620_022083 Ga0500620_022083_935_1417 133
57 3300005563 Ga0068855_100308020 Ga0068855_1003080202 134
58 3300005842 Ga0068858_100000048 Ga0068858_10000004843 134
59 3300025949 Ga0207667_10263335 Ga0207667_102633352 134
60 3300026035 Ga0207703_10000064 Ga0207703_1000006442 134
61 3300026067 Ga0207678_10090168 Ga0207678_100901684 134
62 3300031649 Ga0307514_10077548 Ga0307514_100775481 134
63 3300041456 Ga0451795_1589216 Ga0451795_1589216_91_564 134
64 3300048920 Ga0496117_0104685 Ga0496117_0104685_40_546 134
65 3300048921 Ga0496118_0482957 Ga0496118_0482957_69_575 134
66 3300048922 Ga0496119_0002554 Ga0496119_0002554_10633_11139 134
67 3300048923 Ga0496120_0003954 Ga0496120_0003954_12300_12806 134
68 3300049571 Ga0501034_0302398 Ga0501034_0302398_528_1007 134
69 3300053102 Ga0500554_165714 Ga0500554_165714_196_732 134
70 3300053104 Ga0500556_0000001 Ga0500556_0000001_972126_972539 136
71 3300053126 Ga0500621_128428 Ga0500621_128428_391_804 136
72 3300053139 Ga0500568_0000003 Ga0500568_0000003_652183_652596 136
73 3300048091 Ga0495626_0047403 Ga0495626_0047403_704_1123 137
74 3300013105 Ga0157369_10000103 Ga0157369_1000010398 138
75 3300053140 Ga0500573_0010087 Ga0500573_0010087_4521_4946 139
76 3300053140 Ga0500573_0283318 Ga0500573_0283318_231_656 139
77 3300048924 Ga0496121_0183920 Ga0496121_0183920_410_886 142
78 iso_pu_bacteria 2862993130 2862994758 143
79 3300005437 Ga0070710_10186612 Ga0070710_101866122 144
80 3300032004 Ga0307414_11501292 Ga0307414_115012921 144
81 3300005437 Ga0070710_10027317 Ga0070710_100273173 145
82 3300025898 Ga0207692_10007058 Ga0207692_100070583 145
83 3300031548 Ga0307408_101558839 Ga0307408_1015588391 145
84 3300048929 Ga0496126_0314557 Ga0496126_0314557_668_1111 145
85 3300049571 Ga0501034_0055510 Ga0501034_0055510_1300_1773 145
86 3300049571 Ga0501034_0063596 Ga0501034_0063596_2985_3458 145
87 3300049571 Ga0501034_0111556 Ga0501034_0111556_729_1205 145
88 3300049571 Ga0501034_0532669 Ga0501034_0532669_284_730 145
89 3300049572 Ga0501036_0306134 Ga0501036_0306134_42_530 145
90 3300049579 Ga0501043_0007770 Ga0501043_0007770_5405_5893 145
91 3300049581 Ga0501047_0060000 Ga0501047_0060000_706_1194 145
92 3300049585 Ga0501069_0015381 Ga0501069_0015381_995_1483 145
93 3300049586 Ga0501070_0000760 Ga0501070_0000760_1553_2041 145
94 3300049588 Ga0501072_0550331 Ga0501072_0550331_351_824 145
95 3300049589 Ga0501073_0005223 Ga0501073_0005223_6554_7042 145
96 3300049589 Ga0501073_0030420 Ga0501073_0030420_2084_2557 145
97 3300049741 Ga0501079_0210630 Ga0501079_0210630_770_1243 145
98 3300049742 Ga0501080_0000038 Ga0501080_0000038_66926_67414 145
99 3300049744 Ga0501083_0320614 Ga0501083_0320614_382_870 145
100 3300050494 nmdc:mga06z11_684867_c1 nmdc:mga06z11_684867_c1_15_503 145
101 3300053139 Ga0500568_0263327 Ga0500568_0263327_86_574 145
102 3300053140 Ga0500573_0045487 Ga0500573_0045487_1008_1469 145
103 3300053153 Ga0500616_0001065 Ga0500616_0001065_23545_24033 145
104 3300054114 Ga0501084_0243685 Ga0501084_0243685_588_1076 145
105 iso_pu_bacteria 2643221572 2643874656 145
106 iso_pu_bacteria 2643221632 2644180922 145
107 iso_pu_bacteria 2643221669 2644381712 145
108 iso_pu_bacteria 2857737099 2857740040 145
109 iso_pu_bacteria 2870622029 2870624577 145
110 iso_pu_bacteria 2895660088 2895662973 145
111 iso_pu_bacteria 2939657138 2939660144 145
112 iso_pu_bacteria 2964326757 2964327333 145
113 3300031456 Ga0307513_10306458 Ga0307513_103064581 146
114 3300041453 Ga0451797_1572962 Ga0451797_1572962_203_679 146
115 3300048926 Ga0496123_0181008 Ga0496123_0181008_458_907 146
116 3300049569 Ga0501032_0632825 Ga0501032_0632825_136_633 146
117 3300053136 Ga0500559_0004611 Ga0500559_0004611_2196_2645 146
118 3300053139 Ga0500568_0036409 Ga0500568_0036409_1294_1770 146
119 3300003316 rootH1_10082044 rootH1_100820442 147
120 3300003316 rootH1_10121248 rootH1_101212482 147
121 3300003320 rootH2_10095711 rootH2_100957112 147
122 3300005288 Ga0065714_10192921 Ga0065714_101929211 147
123 3300005327 Ga0070658_10000330 Ga0070658_1000033016 147
124 3300005339 Ga0070660_100114785 Ga0070660_1001147852 147
125 3300005366 Ga0070659_100014681 Ga0070659_1000146814 147
126 3300005563 Ga0068855_100036991 Ga0068855_1000369912 147
127 3300005563 Ga0068855_100558121 Ga0068855_1005581211 147
128 3300006353 Ga0075370_10418075 Ga0075370_104180751 147
129 3300009094 Ga0111539_10557965 Ga0111539_105579652 147
130 3300013102 Ga0157371_11231790 Ga0157371_112317901 147
131 3300013104 Ga0157370_10006580 Ga0157370_1000658017 147
132 3300013308 Ga0157375_10555503 Ga0157375_105555032 147
133 3300014325 Ga0163163_11346159 Ga0163163_113461591 147
134 3300020081 Ga0206354_11579587 Ga0206354_115795872 147
135 3300025904 Ga0207647_10085408 Ga0207647_100854082 147
136 3300025909 Ga0207705_10000001 Ga0207705_100000011604 147
137 3300025932 Ga0207690_10095341 Ga0207690_100953412 147
138 3300025949 Ga0207667_10053934 Ga0207667_100539342 147
139 3300026067 Ga0207678_11744442 Ga0207678_117444421 147
140 3300028794 Ga0307515_10730143 Ga0307515_107301431 147
141 3300031649 Ga0307514_10007171 Ga0307514_100071713 147
142 3300041443 Ga0451789_1270319 Ga0451789_1270319_81_560 147
143 3300041453 Ga0451797_1103579 Ga0451797_1103579_128_610 147
144 3300041509 Ga0451843_1299647 Ga0451843_1299647_15_518 147
145 3300044683 Ga0466965_0000021 Ga0466965_0000021_24713_25165 147
146 3300044683 Ga0466965_0660473 Ga0466965_0660473_90_563 147
147 3300046457 Ga0495590_0000336 Ga0495590_0000336_7111_7566 147
148 3300046615 Ga0495656_0052749 Ga0495656_0052749_1198_1704 147
149 3300048920 Ga0496117_0043819 Ga0496117_0043819_364_822 147
150 3300048922 Ga0496119_0006102 Ga0496119_0006102_6417_6866 147
151 3300048922 Ga0496119_0087333 Ga0496119_0087333_799_1287 147
152 3300048922 Ga0496119_0341890 Ga0496119_0341890_55_531 147
153 3300048924 Ga0496121_0000025 Ga0496121_0000025_203051_203500 147
154 3300048924 Ga0496121_0161799 Ga0496121_0161799_254_700 147
155 3300048924 Ga0496121_0275154 Ga0496121_0275154_579_1025 147
156 3300048925 Ga0496122_0001607 Ga0496122_0001607_9825_10301 147
157 3300048929 Ga0496126_0515969 Ga0496126_0515969_30_491 147
158 3300049568 Ga0501031_0200789 Ga0501031_0200789_202_651 147
159 3300049569 Ga0501032_0030015 Ga0501032_0030015_2540_2989 147
160 3300049569 Ga0501032_0045850 Ga0501032_0045850_985_1437 147
161 3300049569 Ga0501032_0121224 Ga0501032_0121224_486_938 147
162 3300049571 Ga0501034_0040697 Ga0501034_0040697_719_1174 147
163 3300049571 Ga0501034_0241730 Ga0501034_0241730_812_1264 147
164 3300049571 Ga0501034_0329108 Ga0501034_0329108_17_466 147
165 3300049571 Ga0501034_0539666 Ga0501034_0539666_359_814 147
166 3300049571 Ga0501034_0615151 Ga0501034_0615151_434_886 147
167 3300049572 Ga0501036_0365491 Ga0501036_0365491_270_719 147
168 3300049573 Ga0501037_0003899 Ga0501037_0003899_5852_6301 147
169 3300049573 Ga0501037_0061543 Ga0501037_0061543_292_744 147
170 3300049573 Ga0501037_0076432 Ga0501037_0076432_963_1412 147
171 3300049574 Ga0501038_0182972 Ga0501038_0182972_889_1338 147
172 3300049575 Ga0501039_0689893 Ga0501039_0689893_148_597 147
173 3300049579 Ga0501043_0393163 Ga0501043_0393163_191_640 147
174 3300049580 Ga0501046_0737761 Ga0501046_0737761_84_533 147
175 3300049581 Ga0501047_0000770 Ga0501047_0000770_3290_3739 147
176 3300049581 Ga0501047_0410526 Ga0501047_0410526_52_501 147
177 3300049582 Ga0501048_0308033 Ga0501048_0308033_270_719 147
178 3300049583 Ga0501067_0515190 Ga0501067_0515190_34_489 147
179 3300049584 Ga0501068_0197462 Ga0501068_0197462_801_1250 147
180 3300049585 Ga0501069_0085215 Ga0501069_0085215_954_1409 147
181 3300049586 Ga0501070_0009390 Ga0501070_0009390_6805_7260 147
182 3300049586 Ga0501070_0108362 Ga0501070_0108362_1307_1756 147
183 3300049586 Ga0501070_0671455 Ga0501070_0671455_47_499 147
184 3300049587 Ga0501071_0000109 Ga0501071_0000109_9536_9991 147
185 3300049744 Ga0501083_0086289 Ga0501083_0086289_1419_1874 147
186 3300049822 Ga0501035_0006967 Ga0501035_0006967_2265_2714 147
187 3300049823 Ga0501044_0003539 Ga0501044_0003539_5760_6209 147
188 3300049823 Ga0501044_0309575 Ga0501044_0309575_65_517 147
189 3300053098 Ga0500650_0045929 Ga0500650_0045929_577_1038 147
190 3300053136 Ga0500559_0005264 Ga0500559_0005264_5118_5759 147
191 3300053140 Ga0500573_0057280 Ga0500573_0057280_1720_2193 147
192 3300053140 Ga0500573_0152437 Ga0500573_0152437_726_1247 147
193 3300053140 Ga0500573_0168597 Ga0500573_0168597_341_817 147
194 3300053142 Ga0500577_0041223 Ga0500577_0041223_260_781 147
195 3300053142 Ga0500577_0085348 Ga0500577_0085348_473_934 147
196 3300053142 Ga0500577_0172174 Ga0500577_0172174_294_755 147
197 3300054114 Ga0501084_1363424 Ga0501084_1363424_88_543 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20060

DUF6459

Family of unknown function (DUF6459)

40

151

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i2f-assembly2.cif.gz_C crystal structure of bacillus subtilis lyte catalytic domain in complex with isea 0.8352 102 142
5kvb-assembly1.cif.gz_A the crystal structure of hexachlorocyclohexane dehydrochlorinase lina-type3 from novosphingobium barchaimii ll02 0.8201 94 147
4gdz-assembly1.cif.gz_A-3 crystal structure of a duf4251 family protein (bacegg_02002) from bacteroides eggerthii dsm 20697 at 1.95 a resolution 0.8154 99 136
3fyf-assembly1.cif.gz_A crystal structure of uncharacterized protein bvu_3222 from bacteroides vulgatus 0.7953 99 134
6d63-assembly3.cif.gz_E the structure of atzh: a little known member of the atrazine breakdown pathway 0.7383 81 146
ID Description Score Start End Superfamily
af_Q46858_15_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8593 98 147 3.10.450.50
af_Q9NEW7_1_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8471 99 147 2.130.10.10
4gdzA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8154 99 136 2.40.128.410
af_Q8IAU7_736_1093_2.140.10.30 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Dipeptidylpeptidase IV, N-terminal domain 0.799 109 147 2.140.10.30
af_Q9USZ0_316_543_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7863 92 147 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A387B6L9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 1.002 36 147
AF-A0A495IBI0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9976 36 147
AF-A0A387B6L9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9928 36 147
AF-A0A852SUB0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9901 36 147
AF-A0A3L6ZRT1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9873 36 147

Feature Viewer

pLDDT pTM Quality
87.39 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map