F302404

General Info

Members Datasets Scaffolds Average Seq Length
197 182 173 107

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10143146|rootH1_101431464
Length 97
Sequence MRVIAKRTLREFWEEYPDSEEPLLAWYREAESADWDSPAEVKAQYRSASFPGGDRVIFNIKGNDYRLVVRINYPYGIIYIRWVGTHRDYDKLDVLEV

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
3 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
4 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
5 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
6 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
7 2791355256 Rhizobium sp. M10 Isolate Nodule
8 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
9 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
10 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
11 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
12 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
13 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
14 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
15 2933599457 Rhizobium phaseoli M3 Isolate Nodule
16 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
17 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
18 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
19 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
20 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
21 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
22 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
115 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
158 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
166 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
172 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
182 8005626139 Rhizobium phaseoli Y18 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.82
Metatranscriptomes 0
Isolates 12.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.68
Nodule 10.15
Rhizoplane 1.02
Rhizosphere 71.07
Stem 0
Stem Tuber 0
Unclassified 6.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10143146 3300003316 Bacteria 5235
2 rootL2_10072669 3300003322 Bacteria 8418
3 Ga0065712_10029315 3300005290 Unclassified 1268
4 Ga0065707_10304136 3300005295 Bacteria 998
5 Ga0070658_10080555 3300005327 Bacteria 2674
6 Ga0070670_100372362 3300005331 Bacteria 1257
7 Ga0070682_100321944 3300005337 Bacteria 1142
8 Ga0070660_100132886 3300005339 Bacteria 1993
9 Ga0070689_100912901 3300005340 Unclassified 777
10 Ga0070687_100109491 3300005343 Bacteria 1561
11 Ga0070687_100126828 3300005343 Bacteria 1468
12 Ga0070661_100336759 3300005344 Bacteria 1181
13 Ga0070692_10498509 3300005345 Bacteria 789
14 Ga0070675_100089857 3300005354 Bacteria 2572
15 Ga0070674_100012046 3300005356 Bacteria 5297
16 Ga0070673_100150213 3300005364 Bacteria 1972
17 Ga0070710_10298965 3300005437 Bacteria 1050
18 Ga0070708_100070973 3300005445 Bacteria 3134
19 Ga0070663_100121244 3300005455 Bacteria 1975
20 Ga0070685_10154633 3300005466 Bacteria 1456
21 Ga0070685_10357188 3300005466 Bacteria 1001
22 Ga0070706_100357724 3300005467 Bacteria 1360
23 Ga0070706_100376689 3300005467 Bacteria 1322
24 Ga0070707_100315336 3300005468 Bacteria 1520
25 Ga0070698_100885460 3300005471 Bacteria 838
26 Ga0070679_100035538 3300005530 Bacteria 4944
27 Ga0070697_100522615 3300005536 Bacteria 1039
28 Ga0070686_100939524 3300005544 Bacteria 706
29 Ga0070665_100101297 3300005548 Bacteria 2884
30 Ga0070665_100158371 3300005548 Bacteria 2266
31 Ga0068852_100124206 3300005616 Bacteria 2367
32 Ga0068859_100123491 3300005617 Bacteria 2656
33 Ga0068861_100809358 3300005719 Bacteria 880
34 Ga0068870_10755447 3300005840 Unclassified 676
35 Ga0068863_100007503 3300005841 Bacteria 10669
36 Ga0068858_100729150 3300005842 Bacteria 965
37 Ga0068862_100000347 3300005844 Bacteria 50091
38 Ga0070716_100895405 3300006173 Bacteria 694
39 Ga0075428_100115003 3300006844 Bacteria 2931
40 Ga0075431_100004539 3300006847 Bacteria 13628
41 Ga0075429_100109364 3300006880 Bacteria 2416
42 Ga0097620_100123485 3300006931 Bacteria 2656
43 Ga0099794_10812507 3300007265 Bacteria 500
44 Ga0099795_10397441 3300007788 Bacteria 625
45 Ga0111539_10056618 3300009094 Bacteria 4659
46 Ga0105245_10047953 3300009098 Bacteria 3820
47 Ga0105247_10008575 3300009101 Bacteria 6228
48 Ga0114129_11953741 3300009147 Unclassified 710
49 Ga0105243_10283653 3300009148 Bacteria 1493
50 Ga0105242_11774590 3300009176 Unclassified 655
51 Ga0105248_10152068 3300009177 Bacteria 2611
52 Ga0105248_10606352 3300009177 Bacteria 1235
53 Ga0105237_10561018 3300009545 Bacteria 1149
54 Ga0105238_11429917 3300009551 Bacteria 719
55 Ga0105249_10000638 3300009553 Bacteria 31966
56 Ga0105239_10448017 3300010375 Bacteria 1464
57 Ga0105239_10576962 3300010375 Bacteria 1282
58 Ga0157370_10019096 3300013104 Bacteria 6890
59 Ga0157369_10500413 3300013105 Bacteria 1257
60 Ga0157369_11671156 3300013105 Bacteria 647
61 Ga0157374_11126692 3300013296 Bacteria 805
62 Ga0157378_11630095 3300013297 Bacteria 691
63 Ga0157372_13292752 3300013307 Bacteria 515
64 Ga0163163_13064100 3300014325 Bacteria 521
65 Ga0157377_11639591 3300014745 Unclassified 517
66 Ga0157379_10050865 3300014968 Bacteria 3700
67 Ga0209233_1005525 3300025261 Bacteria 4184
68 Ga0207710_10099223 3300025900 Bacteria 1371
69 Ga0207705_10033972 3300025909 Bacteria 3645
70 Ga0207684_10426670 3300025910 Bacteria 1139
71 Ga0207707_10064312 3300025912 Bacteria 3193
72 Ga0207662_10149343 3300025918 Bacteria 1485
73 Ga0207657_10126955 3300025919 Bacteria 2094
74 Ga0207649_10300235 3300025920 Bacteria 1174
75 Ga0207646_10407307 3300025922 Bacteria 1228
76 Ga0207694_10702861 3300025924 Bacteria 853
77 Ga0207687_11265461 3300025927 Bacteria 634
78 Ga0207709_10677676 3300025935 Bacteria 823
79 Ga0207670_10017982 3300025936 Bacteria 4284
80 Ga0207665_10827468 3300025939 Bacteria 732
81 Ga0207711_10119547 3300025941 Bacteria 2351
82 Ga0207712_10000515 3300025961 Bacteria 32017
83 Ga0207678_10228914 3300026067 Bacteria 1592
84 Ga0207641_10002489 3300026088 Bacteria 17005
85 Ga0207675_100635783 3300026118 Bacteria 1072
86 Ga0207698_10097874 3300026142 Bacteria 2422
87 Ga0268266_10130246 3300028379 Bacteria 2249
88 Ga0268266_11488567 3300028379 Bacteria 652
89 Ga0268265_10000295 3300028380 Bacteria 56143
90 Ga0265328_10000136 3300031239 Bacteria 34764
91 Ga0265325_10306036 3300031241 Bacteria 708
92 Ga0265340_10013533 3300031247 Bacteria 4283
93 Ga0265316_10071637 3300031344 Bacteria 2671
94 Ga0265316_10804123 3300031344 Bacteria 659
95 Ga0265314_10332078 3300031711 Bacteria 842
96 Ga0373947_0363613 3300035725 Bacteria 972
97 Ga0373925_0507058 3300037068 Bacteria 991
98 Ga0395898_1533090 3300037466 Bacteria 592
99 Ga0436364_0779969 3300037853 Bacteria 1773
100 Ga0436360_1058345 3300039438 Bacteria 733
101 Ga0451837_0322555 3300041494 Bacteria 566
102 Ga0451839_0584837 3300041496 Bacteria 1859
103 Ga0451841_0150037 3300041498 Bacteria 828
104 Ga0451853_1437184 3300041512 Bacteria 1140
105 Ga0466966_0014332 3300044684 Bacteria 5248
106 Ga0466961_0068417 3300044693 Bacteria 2255
107 Ga0466967_0990527 3300045976 Bacteria 837
108 Ga0495638_0015638 3300046460 Bacteria 5092
109 Ga0495651_0204685 3300046462 Bacteria 1378
110 Ga0495606_0074050 3300046507 Bacteria 2134
111 Ga0495628_0254977 3300046516 Bacteria 1308
112 Ga0495630_0114537 3300046517 Bacteria 2043
113 Ga0495643_0050215 3300046522 Bacteria 2247
114 Ga0495643_0052899 3300046522 Bacteria 2179
115 Ga0495643_0055666 3300046522 Bacteria 2114
116 Ga0495587_0258519 3300046536 Bacteria 978
117 Ga0495609_0139064 3300046538 Bacteria 1037
118 Ga0495646_0348806 3300046680 Bacteria 776
119 Ga0495669_0055155 3300046684 Bacteria 1789
120 Ga0495672_0190703 3300047320 Bacteria 1031
121 Ga0495680_0328816 3300047322 Bacteria 1068
122 Ga0495684_0065896 3300047471 Bacteria 2753
123 Ga0496104_0405442 3300048907 Bacteria 1276
124 Ga0496115_0923837 3300048918 Unclassified 671
125 Ga0496119_0012252 3300048922 Bacteria 6990
126 Ga0496120_0037322 3300048923 Bacteria 2884
127 Ga0496121_0002836 3300048924 Bacteria 25580
128 Ga0495678_081858 3300049459 Bacteria 1157
129 Ga0501032_0157165 3300049569 Bacteria 1493
130 Ga0501034_0367078 3300049571 Bacteria 1366
131 Ga0501040_0508059 3300049576 Bacteria 869
132 Ga0501047_0587954 3300049581 Bacteria 936
133 Ga0501047_0683476 3300049581 Bacteria 844
134 Ga0501068_0485337 3300049584 Bacteria 801
135 Ga0501073_0537072 3300049589 Bacteria 808
136 Ga0501077_0078107 3300049593 Bacteria 2098
137 Ga0501079_0353362 3300049741 Bacteria 1152
138 Ga0501083_0336432 3300049744 Unclassified 981
139 Ga0501044_0840631 3300049823 Unclassified 795
140 nmdc:mga05p37_1424602_c1 3300050507 Unclassified 696
141 nmdc:mga09592_116624_c1 3300050508 Bacteria 2292
142 nmdc:mga06r32_19657_c1 3300050510 Bacteria 6204
143 nmdc:mga0a205_334595_c1 3300050515 Bacteria 1383
144 Ga0495619_0626739 3300053085 Bacteria 735
145 Ga0500566_0199126 3300053094 Bacteria 1013
146 Ga0500556_0053922 3300053104 Unclassified 1463
147 Ga0500562_091552 3300053108 Bacteria 825
148 Ga0500572_000819 3300053111 Bacteria 9833
149 Ga0500614_181845 3300053123 Bacteria 643
150 Ga0500642_0002665 3300053130 Bacteria 5275
151 Ga0500655_001458 3300053133 Bacteria 4487
152 Ga0500655_068515 3300053133 Bacteria 721
153 Ga0500658_0136175 3300053134 Bacteria 1099
154 Ga0500559_0000893 3300053136 Bacteria 19031
155 Ga0500568_0003279 3300053139 Bacteria 9131
156 Ga0500590_017312 3300053148 Bacteria 3726
157 Ga0500603_078869 3300053150 Bacteria 951
158 Ga0500603_088320 3300053150 Bacteria 907
159 Ga0500616_0005028 3300053153 Bacteria 9158
160 Ga0500639_054458 3300053163 Bacteria 2078
161 Ga0500636_0212612 3300053177 Bacteria 1014
162 Ga0500637_0599893 3300053178 Bacteria 522
163 Ga0500649_178413 3300053722 Bacteria 721
164 Ga0500570_000096 3300053724 Bacteria 24955
165 Ga0500645_087612 3300053730 Bacteria 885
166 Ga0500596_002348 3300053735 Bacteria 3742
167 Ga0501084_1327772 3300054114 Bacteria 603
168 Ga0590071_005339 3300059421 Bacteria 3094
169 Ga0590075_017250 3300059424 Bacteria 1779
170 Ga0590077_037460 3300059426 Bacteria 1071
171 Ga0501082_0975939 3300060353 Bacteria 741
172 Ga0530510_0861786 3300061734 Bacteria 692
173 Ga0530510_0992347 3300061734 Bacteria 642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100070973 Ga0070708_1000709733 85
2 3300005467 Ga0070706_100376689 Ga0070706_1003766892 85
3 3300005468 Ga0070707_100315336 Ga0070707_1003153363 85
4 3300005536 Ga0070697_100522615 Ga0070697_1005226152 85
5 3300025922 Ga0207646_10407307 Ga0207646_104073072 85
6 3300037068 Ga0373925_0507058 Ga0373925_0507058_13_300 85
7 3300049459 Ga0495678_081858 Ga0495678_081858_606_890 85
8 iso_pu_bacteria 2582581305 2585263428 93
9 iso_pu_bacteria 2802429606 2805932712 93
10 iso_pu_bacteria 2838022645 2838023581 93
11 iso_pu_bacteria 2838068647 2838069874 93
12 iso_pu_bacteria 2842198810 2842199095 93
13 iso_pu_bacteria 2842422224 2842423488 93
14 iso_pu_bacteria 2915650412 2915652961 93
15 iso_pu_bacteria 2935648319 2935651457 93
16 iso_pu_bacteria 2935656913 2935659775 93
17 iso_pu_bacteria 2936011229 2936014191 93
18 iso_pu_bacteria 2936019824 2936022900 93
19 iso_pu_bacteria 2936028420 2936031037 93
20 iso_pu_bacteria 2936046547 2936049158 93
21 iso_pu_bacteria 3005483717 3005490448 93
22 3300005548 Ga0070665_100158371 Ga0070665_1001583712 95
23 3300028379 Ga0268266_10130246 Ga0268266_101302462 95
24 iso_pu_bacteria 2906626472 2906634511 96
25 3300003316 rootH1_10143146 rootH1_101431464 97
26 3300003322 rootL2_10072669 rootL2_100726696 97
27 3300005290 Ga0065712_10029315 Ga0065712_100293153 97
28 3300005295 Ga0065707_10304136 Ga0065707_103041363 97
29 3300005327 Ga0070658_10080555 Ga0070658_100805551 97
30 3300005331 Ga0070670_100372362 Ga0070670_1003723622 97
31 3300005337 Ga0070682_100321944 Ga0070682_1003219443 97
32 3300005339 Ga0070660_100132886 Ga0070660_1001328862 97
33 3300005340 Ga0070689_100912901 Ga0070689_1009129012 97
34 3300005343 Ga0070687_100109491 Ga0070687_1001094913 97
35 3300005343 Ga0070687_100126828 Ga0070687_1001268282 97
36 3300005344 Ga0070661_100336759 Ga0070661_1003367592 97
37 3300005345 Ga0070692_10498509 Ga0070692_104985092 97
38 3300005354 Ga0070675_100089857 Ga0070675_1000898572 97
39 3300005356 Ga0070674_100012046 Ga0070674_1000120463 97
40 3300005364 Ga0070673_100150213 Ga0070673_1001502132 97
41 3300005437 Ga0070710_10298965 Ga0070710_102989652 97
42 3300005455 Ga0070663_100121244 Ga0070663_1001212443 97
43 3300005466 Ga0070685_10154633 Ga0070685_101546332 97
44 3300005466 Ga0070685_10357188 Ga0070685_103571883 97
45 3300005467 Ga0070706_100357724 Ga0070706_1003577243 97
46 3300005471 Ga0070698_100885460 Ga0070698_1008854602 97
47 3300005530 Ga0070679_100035538 Ga0070679_1000355386 97
48 3300005544 Ga0070686_100939524 Ga0070686_1009395242 97
49 3300005548 Ga0070665_100101297 Ga0070665_1001012975 97
50 3300005616 Ga0068852_100124206 Ga0068852_1001242065 97
51 3300005617 Ga0068859_100123491 Ga0068859_1001234914 97
52 3300005719 Ga0068861_100809358 Ga0068861_1008093582 97
53 3300005840 Ga0068870_10755447 Ga0068870_107554472 97
54 3300005841 Ga0068863_100007503 Ga0068863_1000075039 97
55 3300005842 Ga0068858_100729150 Ga0068858_1007291502 97
56 3300005844 Ga0068862_100000347 Ga0068862_10000034713 97
57 3300006173 Ga0070716_100895405 Ga0070716_1008954051 97
58 3300006844 Ga0075428_100115003 Ga0075428_1001150033 97
59 3300006847 Ga0075431_100004539 Ga0075431_1000045395 97
60 3300006880 Ga0075429_100109364 Ga0075429_1001093642 97
61 3300006931 Ga0097620_100123485 Ga0097620_1001234853 97
62 3300007265 Ga0099794_10812507 Ga0099794_108125072 97
63 3300007788 Ga0099795_10397441 Ga0099795_103974411 97
64 3300009094 Ga0111539_10056618 Ga0111539_100566183 97
65 3300009098 Ga0105245_10047953 Ga0105245_100479536 97
66 3300009101 Ga0105247_10008575 Ga0105247_100085754 97
67 3300009147 Ga0114129_11953741 Ga0114129_119537412 97
68 3300009148 Ga0105243_10283653 Ga0105243_102836533 97
69 3300009176 Ga0105242_11774590 Ga0105242_117745902 97
70 3300009177 Ga0105248_10152068 Ga0105248_101520684 97
71 3300009177 Ga0105248_10606352 Ga0105248_106063522 97
72 3300009545 Ga0105237_10561018 Ga0105237_105610181 97
73 3300009551 Ga0105238_11429917 Ga0105238_114299171 97
74 3300009553 Ga0105249_10000638 Ga0105249_1000063836 97
75 3300010375 Ga0105239_10448017 Ga0105239_104480171 97
76 3300010375 Ga0105239_10576962 Ga0105239_105769621 97
77 3300013104 Ga0157370_10019096 Ga0157370_100190969 97
78 3300013105 Ga0157369_10500413 Ga0157369_105004132 97
79 3300013105 Ga0157369_11671156 Ga0157369_116711562 97
80 3300013296 Ga0157374_11126692 Ga0157374_111266922 97
81 3300013297 Ga0157378_11630095 Ga0157378_116300952 97
82 3300013307 Ga0157372_13292752 Ga0157372_132927522 97
83 3300014325 Ga0163163_13064100 Ga0163163_130641001 97
84 3300014745 Ga0157377_11639591 Ga0157377_116395911 97
85 3300014968 Ga0157379_10050865 Ga0157379_100508652 97
86 3300025261 Ga0209233_1005525 Ga0209233_10055255 97
87 3300025900 Ga0207710_10099223 Ga0207710_100992232 97
88 3300025909 Ga0207705_10033972 Ga0207705_100339721 97
89 3300025910 Ga0207684_10426670 Ga0207684_104266703 97
90 3300025912 Ga0207707_10064312 Ga0207707_100643125 97
91 3300025918 Ga0207662_10149343 Ga0207662_101493432 97
92 3300025919 Ga0207657_10126955 Ga0207657_101269554 97
93 3300025920 Ga0207649_10300235 Ga0207649_103002351 97
94 3300025924 Ga0207694_10702861 Ga0207694_107028612 97
95 3300025927 Ga0207687_11265461 Ga0207687_112654611 97
96 3300025935 Ga0207709_10677676 Ga0207709_106776762 97
97 3300025936 Ga0207670_10017982 Ga0207670_100179823 97
98 3300025939 Ga0207665_10827468 Ga0207665_108274682 97
99 3300025941 Ga0207711_10119547 Ga0207711_101195473 97
100 3300025961 Ga0207712_10000515 Ga0207712_1000051536 97
101 3300026067 Ga0207678_10228914 Ga0207678_102289143 97
102 3300026088 Ga0207641_10002489 Ga0207641_1000248912 97
103 3300026118 Ga0207675_100635783 Ga0207675_1006357832 97
104 3300026142 Ga0207698_10097874 Ga0207698_100978742 97
105 3300028379 Ga0268266_11488567 Ga0268266_114885671 97
106 3300028380 Ga0268265_10000295 Ga0268265_1000029513 97
107 3300031239 Ga0265328_10000136 Ga0265328_100001364 97
108 3300031241 Ga0265325_10306036 Ga0265325_103060361 97
109 3300031247 Ga0265340_10013533 Ga0265340_100135333 97
110 3300031344 Ga0265316_10071637 Ga0265316_100716373 97
111 3300031344 Ga0265316_10804123 Ga0265316_108041232 97
112 3300031711 Ga0265314_10332078 Ga0265314_103320782 97
113 3300035725 Ga0373947_0363613 Ga0373947_0363613_366_689 97
114 3300037466 Ga0395898_1533090 Ga0395898_1533090_160_486 97
115 3300037853 Ga0436364_0779969 Ga0436364_0779969_585_908 97
116 3300039438 Ga0436360_1058345 Ga0436360_1058345_36_359 97
117 3300041494 Ga0451837_0322555 Ga0451837_0322555_139_459 97
118 3300041496 Ga0451839_0584837 Ga0451839_0584837_123_443 97
119 3300041498 Ga0451841_0150037 Ga0451841_0150037_90_413 97
120 3300041512 Ga0451853_1437184 Ga0451853_1437184_696_1016 97
121 3300044684 Ga0466966_0014332 Ga0466966_0014332_4062_4355 97
122 3300044693 Ga0466961_0068417 Ga0466961_0068417_1645_1938 97
123 3300045976 Ga0466967_0990527 Ga0466967_0990527_305_628 97
124 3300046460 Ga0495638_0015638 Ga0495638_0015638_1741_2064 97
125 3300046462 Ga0495651_0204685 Ga0495651_0204685_863_1186 97
126 3300046507 Ga0495606_0074050 Ga0495606_0074050_1265_1591 97
127 3300046516 Ga0495628_0254977 Ga0495628_0254977_974_1297 97
128 3300046517 Ga0495630_0114537 Ga0495630_0114537_1647_1970 97
129 3300046522 Ga0495643_0050215 Ga0495643_0050215_1419_1742 97
130 3300046522 Ga0495643_0052899 Ga0495643_0052899_129_452 97
131 3300046522 Ga0495643_0055666 Ga0495643_0055666_319_642 97
132 3300046536 Ga0495587_0258519 Ga0495587_0258519_45_368 97
133 3300046538 Ga0495609_0139064 Ga0495609_0139064_207_530 97
134 3300046680 Ga0495646_0348806 Ga0495646_0348806_169_492 97
135 3300046684 Ga0495669_0055155 Ga0495669_0055155_770_1093 97
136 3300047320 Ga0495672_0190703 Ga0495672_0190703_561_884 97
137 3300047322 Ga0495680_0328816 Ga0495680_0328816_596_919 97
138 3300047471 Ga0495684_0065896 Ga0495684_0065896_2149_2472 97
139 3300048907 Ga0496104_0405442 Ga0496104_0405442_299_622 97
140 3300048918 Ga0496115_0923837 Ga0496115_0923837_53_379 97
141 3300048922 Ga0496119_0012252 Ga0496119_0012252_2162_2485 97
142 3300048923 Ga0496120_0037322 Ga0496120_0037322_2156_2479 97
143 3300048924 Ga0496121_0002836 Ga0496121_0002836_15903_16223 97
144 3300049569 Ga0501032_0157165 Ga0501032_0157165_866_1186 97
145 3300049571 Ga0501034_0367078 Ga0501034_0367078_742_1062 97
146 3300049576 Ga0501040_0508059 Ga0501040_0508059_69_395 97
147 3300049581 Ga0501047_0587954 Ga0501047_0587954_241_564 97
148 3300049581 Ga0501047_0683476 Ga0501047_0683476_148_468 97
149 3300049584 Ga0501068_0485337 Ga0501068_0485337_314_634 97
150 3300049589 Ga0501073_0537072 Ga0501073_0537072_369_689 97
151 3300049593 Ga0501077_0078107 Ga0501077_0078107_1625_1951 97
152 3300049741 Ga0501079_0353362 Ga0501079_0353362_100_429 97
153 3300049744 Ga0501083_0336432 Ga0501083_0336432_576_896 97
154 3300049823 Ga0501044_0840631 Ga0501044_0840631_168_497 97
155 3300050507 nmdc:mga05p37_1424602_c1 nmdc:mga05p37_1424602_c1_51_374 97
156 3300050508 nmdc:mga09592_116624_c1 nmdc:mga09592_116624_c1_267_590 97
157 3300050510 nmdc:mga06r32_19657_c1 nmdc:mga06r32_19657_c1_2657_2980 97
158 3300050515 nmdc:mga0a205_334595_c1 nmdc:mga0a205_334595_c1_619_942 97
159 3300053085 Ga0495619_0626739 Ga0495619_0626739_279_602 97
160 3300053094 Ga0500566_0199126 Ga0500566_0199126_156_482 97
161 3300053104 Ga0500556_0053922 Ga0500556_0053922_1119_1412 97
162 3300053108 Ga0500562_091552 Ga0500562_091552_220_543 97
163 3300053111 Ga0500572_000819 Ga0500572_000819_7580_7906 97
164 3300053123 Ga0500614_181845 Ga0500614_181845_121_444 97
165 3300053130 Ga0500642_0002665 Ga0500642_0002665_2908_3231 97
166 3300053133 Ga0500655_001458 Ga0500655_001458_2140_2463 97
167 3300053133 Ga0500655_068515 Ga0500655_068515_35_361 97
168 3300053134 Ga0500658_0136175 Ga0500658_0136175_11_334 97
169 3300053136 Ga0500559_0000893 Ga0500559_0000893_15000_15326 97
170 3300053139 Ga0500568_0003279 Ga0500568_0003279_8455_8778 97
171 3300053148 Ga0500590_017312 Ga0500590_017312_1235_1558 97
172 3300053150 Ga0500603_078869 Ga0500603_078869_136_462 97
173 3300053150 Ga0500603_088320 Ga0500603_088320_530_853 97
174 3300053153 Ga0500616_0005028 Ga0500616_0005028_383_706 97
175 3300053163 Ga0500639_054458 Ga0500639_054458_1530_1856 97
176 3300053177 Ga0500636_0212612 Ga0500636_0212612_591_914 97
177 3300053178 Ga0500637_0599893 Ga0500637_0599893_134_457 97
178 3300053722 Ga0500649_178413 Ga0500649_178413_361_687 97
179 3300053724 Ga0500570_000096 Ga0500570_000096_2004_2327 97
180 3300053730 Ga0500645_087612 Ga0500645_087612_404_727 97
181 3300053735 Ga0500596_002348 Ga0500596_002348_1053_1379 97
182 3300054114 Ga0501084_1327772 Ga0501084_1327772_11_337 97
183 3300059421 Ga0590071_005339 Ga0590071_005339_2336_2665 97
184 3300059424 Ga0590075_017250 Ga0590075_017250_826_1155 97
185 3300059426 Ga0590077_037460 Ga0590077_037460_345_674 97
186 3300060353 Ga0501082_0975939 Ga0501082_0975939_232_552 97
187 3300061734 Ga0530510_0861786 Ga0530510_0861786_209_532 97
188 3300061734 Ga0530510_0992347 Ga0530510_0992347_112_438 97
189 iso_pu_bacteria 2718218235 2720632412 97
190 iso_pu_bacteria 2718218269 2720776137 97
191 iso_pu_bacteria 2721755685 2723567987 97
192 iso_pu_bacteria 2721755819 2724090744 97
193 iso_pu_bacteria 2721755822 2724105252 97
194 iso_pu_bacteria 2791355256 2793294161 97
195 iso_pu_bacteria 2933599457 2933600680 97
196 iso_pu_bacteria 8005282627 8005284541 97
197 iso_pu_bacteria 8005626139 8005630039 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09907

HigB_toxin

HigB_toxin, RelE-like toxic component of a toxin-antitoxin system

19

92

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.9265 1 86
5ifg-assembly1.cif.gz_C crystal structure of higa-higb complex from e. coli 0.9117 1 91
6kml-assembly1.cif.gz_A 2.09 angstrom resolution crystal structure of tetrameric higba toxin-antitoxin complex from e.coli 0.9091 1 91
5ycl-assembly1.cif.gz_D crystal structure of higba complex from shigella flexneri 0.8915 1 91
6kmq-assembly1.cif.gz_A 2.3 angstrom resolution structure of dimeric higba toxin-antitoxin complex from e. coli 0.8696 1 86
ID Description Score Start End Superfamily
af_P64578_19_94_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9219 20 92 3.30.2310.20
af_P64578_19_94_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8767 20 92 3.30.2310.20
af_O13856_4_201_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8762 47 85 2.130.10.10
af_O94533_29_248_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8486 48 85 2.130.10.10
af_Q55C80_7_367_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8409 53 85 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2H6EHT0-F1-model_v4 mRNA interferase HigB 0.9982 1 97 GO:0003723
GO:0004519
GO:0110001
AF-A0A3C1TG67-F1-model_v4 Addiction module toxin RelE 0.9949 1 97 GO:0003723
GO:0004519
GO:0016020
GO:0110001
AF-A0A846HP53-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.994 1 93 GO:0003723
GO:0004519
GO:0110001
AF-A0A0J5FVI7-F1-model_v4 Toxin RelE 0.9939 1 86 GO:0003723
GO:0004519
GO:0110001
AF-A0A4U1Z6H6-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9938 1 93 GO:0003723
GO:0004519
GO:0110001

Feature Viewer

pLDDT pTM Quality
96.26 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map