F302150

General Info

Members Datasets Scaffolds Average Seq Length
196 116 392 390

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0023597|Ga0501039_0023597_847_2139
Length 430
Sequence MSERPGGRPSEPGPSGRGSGIQHVDSPSGPAEGRERRAAFESLPTADDVLAALRGVIDPELGSDIVDLGMARSADVLPDGSVDVMVALTTAGCPLRSQLQHDVVARIGSLPGVTHVRLHWAEMTADQRASAMAKARWNITQRPEDTSVPLGAKVILVASGKGGVGKSSVTVNLAAALAQRGHKVGVLDADIWGFSVPRMLGVEGRLEGTTTHDGRKQMVPIERAIGDGVVRVVSMGFLVDDEETALMWRGLMLNRGVQHFLQDVRWGDDLDYLLIDMPPGTGDVQMGVAKLLPRAEVIVVTTPAQAAQKVAVRVVGMARKSYLRVAGVIENMSAFTCEHGETYALFGEGGGAQLAHDAGVPLLGAVPLEPSVSAGGDTGSPVTMGDGPAADAFRDIAQRIVDEAVPLAAMAGCSARMLDAAVAALDRAGT

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
22 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
23 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
24 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
25 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
26 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
30 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
31 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
32 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
33 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
34 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
35 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
36 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
37 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
38 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
39 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
40 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
43 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
46 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
49 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
52 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
65 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 0
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0023597 3300049575 Bacteria 4721
2 Ga0070671_100000121 3300005355 Bacteria 50406
3 Ga0070708_100015966 3300005445 Bacteria 6217
4 Ga0068858_100008308 3300005842 Bacteria 9983
5 Ga0081455_10001111 3300005937 Bacteria 33754
6 Ga0081455_10001956 3300005937 Bacteria 24732
7 Ga0081455_10067846 3300005937 Bacteria 2971
8 Ga0081538_10000185 3300005981 Bacteria 68366
9 Ga0081538_10048007 3300005981 Bacteria 2611
10 Ga0075365_10006861 3300006038 Bacteria 6316
11 Ga0075368_10015414 3300006042 Bacteria 2836
12 Ga0075364_10003345 3300006051 Bacteria 9094
13 Ga0075364_10035381 3300006051 Bacteria 3227
14 Ga0075428_100001570 3300006844 Bacteria 24485
15 Ga0075428_100005297 3300006844 Bacteria 14337
16 Ga0075428_100050430 3300006844 Bacteria 4565
17 Ga0075428_100240559 3300006844 Bacteria 1953
18 Ga0075430_100000756 3300006846 Bacteria 24924
19 Ga0075430_100000857 3300006846 Bacteria 23860
20 Ga0075430_100117348 3300006846 Bacteria 2218
21 Ga0075431_100001433 3300006847 Bacteria 21941
22 Ga0075429_100001096 3300006880 Bacteria 21810
23 Ga0075429_100238823 3300006880 Bacteria 1592
24 Ga0111539_10020271 3300009094 Bacteria 8193
25 Ga0111539_10052371 3300009094 Bacteria 4859
26 Ga0105245_10003560 3300009098 Bacteria 13896
27 Ga0114129_10022109 3300009147 Bacteria 9025
28 Ga0114129_10093360 3300009147 Bacteria 4168
29 Ga0114129_10147471 3300009147 Bacteria 3222
30 Ga0114129_10157979 3300009147 Bacteria 3100
31 Ga0213875_10022499 3300021388 Bacteria 3014
32 Ga0207649_10050964 3300025920 Bacteria 2562
33 Ga0207687_10002585 3300025927 Bacteria 12287
34 Ga0207683_10175788 3300026121 Bacteria 1940
35 Ga0207428_10029397 3300027907 Bacteria 4555
36 Ga0207428_10035462 3300027907 Bacteria 4077
37 Ga0265327_10082197 3300031251 Bacteria 1588
38 Ga0316575_10023676 3300031665 Bacteria 2375
39 Ga0316576_10061596 3300031727 Bacteria 2750
40 Ga0316578_10032840 3300031728 Bacteria 2968
41 Ga0307407_10028888 3300031903 Bacteria 2971
42 Ga0307409_100009686 3300031995 Bacteria 5939
43 Ga0307409_100291061 3300031995 Bacteria 1515
44 Ga0307416_100089069 3300032002 Bacteria 2641
45 Ga0307416_100217906 3300032002 Bacteria 1828
46 Ga0307414_10191902 3300032004 Bacteria 1654
47 Ga0316583_10027998 3300032133 Bacteria 2011
48 Ga0373930_0004922 3300034816 Bacteria 2197
49 Ga0373948_0000162 3300034817 Bacteria 7387
50 Ga0373928_0000102 3300035084 Bacteria 15185
51 Ga0373929_0002261 3300035085 Bacteria 3557
52 Ga0373949_0024864 3300035090 Bacteria 1395
53 Ga0373932_0000453 3300035112 Bacteria 12535
54 Ga0373945_0005679 3300035116 Bacteria 4001
55 Ga0373946_0027734 3300035171 Bacteria 2242
56 Ga0373931_0000006 3300035691 Bacteria 437006
57 Ga0373931_0000048 3300035691 Bacteria 63106
58 Ga0373947_0075225 3300035725 Bacteria 2079
59 Ga0373937_0089262 3300036401 Bacteria 2854
60 Ga0316582_0033014 3300036647 Bacteria 3175
61 Ga0316584_0030245 3300036712 Bacteria 4001
62 Ga0316584_0044746 3300036712 Bacteria 3302
63 Ga0436364_0119202 3300037853 Bacteria 4117
64 Ga0400485_12641 3300038735 Bacteria 9915
65 Ga0400483_016226 3300039062 Bacteria 90099
66 Ga0400483_180976 3300039062 Bacteria 4702
67 Ga0400483_214414 3300039062 Bacteria 39115
68 Ga0400483_255140 3300039062 Bacteria 7034
69 Ga0436365_0828564 3300039437 Bacteria 13256
70 Ga0436360_0433504 3300039438 Bacteria 4047
71 Ga0436361_0010915 3300039447 Bacteria 6297
72 Ga0436362_0264261 3300039453 Bacteria 1734
73 Ga0451837_0373109 3300041494 Bacteria 2724
74 Ga0439450_002571 3300042008 Bacteria 2875
75 Ga0466966_0036883 3300044684 Bacteria 3155
76 Ga0495629_0316579 3300046459 Bacteria 1067
77 Ga0495651_0009128 3300046462 Bacteria 7612
78 Ga0495653_0191550 3300046463 Bacteria 1395
79 Ga0495582_0140771 3300046473 Bacteria 1367
80 Ga0495608_0017393 3300046511 Bacteria 4973
81 Ga0495621_0017877 3300046539 Bacteria 2297
82 Ga0495634_0035503 3300046642 Bacteria 3414
83 Ga0495634_0088879 3300046642 Bacteria 2009
84 Ga0495657_0001804 3300046675 Bacteria 18331
85 Ga0495613_0002715 3300046689 Bacteria 13282
86 Ga0495613_0242791 3300046689 Bacteria 1259
87 Ga0495600_0252251 3300046809 Bacteria 1122
88 Ga0495581_0210589 3300047315 Bacteria 1137
89 Ga0495672_0003470 3300047320 Bacteria 13476
90 Ga0495676_0105697 3300047321 Bacteria 2075
91 Ga0495680_0039026 3300047322 Bacteria 3791
92 Ga0495680_0103737 3300047322 Bacteria 2116
93 Ga0501032_0000645 3300049569 Bacteria 28338
94 Ga0501033_0009627 3300049570 Bacteria 7435
95 Ga0501034_0003682 3300049571 Bacteria 17326
96 Ga0501034_0003728 3300049571 Bacteria 17213
97 Ga0501034_0004850 3300049571 Bacteria 14846
98 Ga0501034_0005384 3300049571 Bacteria 14001
99 Ga0501034_0013265 3300049571 Bacteria 8490
100 Ga0501034_0233595 3300049571 Bacteria 1787
101 Ga0501034_0298183 3300049571 Bacteria 1549
102 Ga0501036_0009546 3300049572 Bacteria 7979
103 Ga0501036_0036237 3300049572 Bacteria 4174
104 Ga0501037_0007150 3300049573 Bacteria 8160
105 Ga0501038_0017480 3300049574 Bacteria 6483
106 Ga0501038_0025733 3300049574 Bacteria 5243
107 Ga0501039_0018048 3300049575 Bacteria 5413
108 Ga0501040_0002312 3300049576 Bacteria 12245
109 Ga0501040_0005737 3300049576 Bacteria 8029
110 Ga0501041_0194610 3300049577 Bacteria 1270
111 Ga0501042_0008377 3300049578 Bacteria 6818
112 Ga0501042_0089137 3300049578 Bacteria 2213
113 Ga0501043_0016918 3300049579 Bacteria 5715
114 Ga0501043_0041347 3300049579 Bacteria 3622
115 Ga0501043_0111249 3300049579 Bacteria 2150
116 Ga0501046_0015535 3300049580 Bacteria 6394
117 Ga0501046_0030867 3300049580 Bacteria 4348
118 Ga0501047_0276668 3300049581 Bacteria 1524
119 Ga0501048_0061528 3300049582 Bacteria 2658
120 Ga0501067_0051884 3300049583 Bacteria 2272
121 Ga0501068_0005018 3300049584 Bacteria 7208
122 Ga0501068_0011283 3300049584 Bacteria 5040
123 Ga0501068_0115484 3300049584 Bacteria 1671
124 Ga0501069_0000127 3300049585 Bacteria 33582
125 Ga0501070_0000777 3300049586 Bacteria 29040
126 Ga0501070_0029451 3300049586 Bacteria 4603
127 Ga0501071_0001227 3300049587 Bacteria 14503
128 Ga0501071_0009887 3300049587 Bacteria 6370
129 Ga0501071_0024988 3300049587 Bacteria 4182
130 Ga0501071_0118967 3300049587 Bacteria 1957
131 Ga0501071_0133679 3300049587 Bacteria 1844
132 Ga0501072_0003333 3300049588 Bacteria 12085
133 Ga0501072_0008375 3300049588 Bacteria 7851
134 Ga0501072_0016595 3300049588 Bacteria 5656
135 Ga0501072_0018886 3300049588 Bacteria 5318
136 Ga0501073_0006820 3300049589 Bacteria 8493
137 Ga0501074_0008562 3300049590 Bacteria 7410
138 Ga0501074_0045673 3300049590 Bacteria 3168
139 Ga0501075_0001085 3300049591 Bacteria 17501
140 Ga0501076_0022555 3300049592 Bacteria 4839
141 Ga0501076_0046373 3300049592 Bacteria 3434
142 Ga0501077_0006876 3300049593 Bacteria 7001
143 Ga0501077_0018194 3300049593 Bacteria 4444
144 Ga0501079_0017917 3300049741 Bacteria 5408
145 Ga0501079_0018645 3300049741 Bacteria 5301
146 Ga0501080_0016614 3300049742 Bacteria 6799
147 Ga0501080_0022761 3300049742 Bacteria 5804
148 Ga0501080_0041111 3300049742 Bacteria 4310
149 Ga0501080_0183443 3300049742 Bacteria 1925
150 Ga0501080_0444113 3300049742 Bacteria 1163
151 Ga0501081_0010829 3300049743 Bacteria 5956
152 Ga0501081_0136474 3300049743 Bacteria 1756
153 Ga0501081_0138748 3300049743 Bacteria 1742
154 Ga0501083_0005416 3300049744 Bacteria 9037
155 Ga0501083_0059176 3300049744 Bacteria 2563
156 Ga0501035_0048659 3300049822 Bacteria 3802
157 Ga0501044_0003924 3300049823 Bacteria 16677
158 Ga0501044_0007547 3300049823 Bacteria 11958
159 Ga0501045_0019846 3300049824 Bacteria 4797
160 nmdc:mga00v17_2871_c1 3300050491 Bacteria 8825
161 nmdc:mga00v17_61142_c1 3300050491 Bacteria 2315
162 nmdc:mga0yw44_206_c1 3300050492 Bacteria 20943
163 nmdc:mga0yw44_221700_c1 3300050492 Bacteria 1253
164 nmdc:mga06z11_16399_c1 3300050494 Bacteria 3336
165 nmdc:mga06z11_81213_c1 3300050494 Bacteria 1740
166 nmdc:mga05p37_2018_c1 3300050507 Bacteria 23680
167 nmdc:mga05p37_56304_c1 3300050507 Bacteria 4841
168 nmdc:mga05p37_64304_c1 3300050507 Bacteria 4514
169 nmdc:mga09592_6708_c1 3300050508 Bacteria 9376
170 nmdc:mga09592_8861_c1 3300050508 Bacteria 8181
171 nmdc:mga0qj67_117497_c1 3300050509 Bacteria 2150
172 nmdc:mga0qj67_1261_c1 3300050509 Bacteria 17733
173 nmdc:mga0qj67_218122_c1 3300050509 Bacteria 1549
174 nmdc:mga0qj67_2404_c1 3300050509 Bacteria 13333
175 nmdc:mga0qj67_36033_c1 3300050509 Bacteria 3870
176 nmdc:mga06r32_235227_c1 3300050510 Bacteria 1820
177 nmdc:mga06r32_3464_c1 3300050510 Bacteria 14085
178 nmdc:mga06r32_40559_c1 3300050510 Bacteria 4421
179 nmdc:mga06r32_54865_c1 3300050510 Bacteria 3822
180 nmdc:mga06r32_83758_c1 3300050510 Bacteria 3108
181 nmdc:mga08y16_6026_c1 3300050511 Bacteria 12706
182 nmdc:mga08y16_63528_c1 3300050511 Bacteria 3856
183 nmdc:mga0rr50_168189_c1 3300050513 Bacteria 1784
184 Ga0495619_0123075 3300053085 Bacteria 1779
185 Ga0500566_0001677 3300053094 Bacteria 13001
186 Ga0500593_058574 3300053117 Bacteria 1696
187 Ga0500568_0000450 3300053139 Bacteria 30946
188 Ga0500604_0001673 3300053151 Bacteria 6224
189 Ga0500616_0004913 3300053153 Bacteria 9293
190 Ga0501084_0001793 3300054114 Bacteria 17100
191 Ga0501084_0025415 3300054114 Bacteria 4941
192 Ga0501084_0034158 3300054114 Bacteria 4252
193 Ga0501082_0111574 3300060353 Bacteria 2367
194 Ga0501082_0248220 3300060353 Bacteria 1549
195 Ga0530510_0002759 3300061734 Bacteria 12068
196 Ga0530510_0007359 3300061734 Bacteria 7664
197 Ga0501039_0023597
198 Ga0070671_100000121
199 Ga0070708_100015966
200 Ga0068858_100008308
201 Ga0081455_10001111
202 Ga0081455_10001956
203 Ga0081455_10067846
204 Ga0081538_10000185
205 Ga0081538_10048007
206 Ga0075365_10006861
207 Ga0075368_10015414
208 Ga0075364_10003345
209 Ga0075364_10035381
210 Ga0075428_100001570
211 Ga0075428_100005297
212 Ga0075428_100050430
213 Ga0075428_100240559
214 Ga0075430_100000756
215 Ga0075430_100000857
216 Ga0075430_100117348
217 Ga0075431_100001433
218 Ga0075429_100001096
219 Ga0075429_100238823
220 Ga0111539_10020271
221 Ga0111539_10052371
222 Ga0105245_10003560
223 Ga0114129_10022109
224 Ga0114129_10093360
225 Ga0114129_10147471
226 Ga0114129_10157979
227 Ga0213875_10022499
228 Ga0207649_10050964
229 Ga0207687_10002585
230 Ga0207683_10175788
231 Ga0207428_10029397
232 Ga0207428_10035462
233 Ga0265327_10082197
234 Ga0316575_10023676
235 Ga0316576_10061596
236 Ga0316578_10032840
237 Ga0307407_10028888
238 Ga0307409_100009686
239 Ga0307409_100291061
240 Ga0307416_100089069
241 Ga0307416_100217906
242 Ga0307414_10191902
243 Ga0316583_10027998
244 Ga0373930_0004922
245 Ga0373948_0000162
246 Ga0373928_0000102
247 Ga0373929_0002261
248 Ga0373949_0024864
249 Ga0373932_0000453
250 Ga0373945_0005679
251 Ga0373946_0027734
252 Ga0373931_0000006
253 Ga0373931_0000048
254 Ga0373947_0075225
255 Ga0373937_0089262
256 Ga0316582_0033014
257 Ga0316584_0030245
258 Ga0316584_0044746
259 Ga0436364_0119202
260 Ga0400485_12641
261 Ga0400483_016226
262 Ga0400483_180976
263 Ga0400483_214414
264 Ga0400483_255140
265 Ga0436365_0828564
266 Ga0436360_0433504
267 Ga0436361_0010915
268 Ga0436362_0264261
269 Ga0451837_0373109
270 Ga0439450_002571
271 Ga0466966_0036883
272 Ga0495629_0316579
273 Ga0495651_0009128
274 Ga0495653_0191550
275 Ga0495582_0140771
276 Ga0495608_0017393
277 Ga0495621_0017877
278 Ga0495634_0035503
279 Ga0495634_0088879
280 Ga0495657_0001804
281 Ga0495613_0002715
282 Ga0495613_0242791
283 Ga0495600_0252251
284 Ga0495581_0210589
285 Ga0495672_0003470
286 Ga0495676_0105697
287 Ga0495680_0039026
288 Ga0495680_0103737
289 Ga0501032_0000645
290 Ga0501033_0009627
291 Ga0501034_0003682
292 Ga0501034_0003728
293 Ga0501034_0004850
294 Ga0501034_0005384
295 Ga0501034_0013265
296 Ga0501034_0233595
297 Ga0501034_0298183
298 Ga0501036_0009546
299 Ga0501036_0036237
300 Ga0501037_0007150
301 Ga0501038_0017480
302 Ga0501038_0025733
303 Ga0501039_0018048
304 Ga0501040_0002312
305 Ga0501040_0005737
306 Ga0501041_0194610
307 Ga0501042_0008377
308 Ga0501042_0089137
309 Ga0501043_0016918
310 Ga0501043_0041347
311 Ga0501043_0111249
312 Ga0501046_0015535
313 Ga0501046_0030867
314 Ga0501047_0276668
315 Ga0501048_0061528
316 Ga0501067_0051884
317 Ga0501068_0005018
318 Ga0501068_0011283
319 Ga0501068_0115484
320 Ga0501069_0000127
321 Ga0501070_0000777
322 Ga0501070_0029451
323 Ga0501071_0001227
324 Ga0501071_0009887
325 Ga0501071_0024988
326 Ga0501071_0118967
327 Ga0501071_0133679
328 Ga0501072_0003333
329 Ga0501072_0008375
330 Ga0501072_0016595
331 Ga0501072_0018886
332 Ga0501073_0006820
333 Ga0501074_0008562
334 Ga0501074_0045673
335 Ga0501075_0001085
336 Ga0501076_0022555
337 Ga0501076_0046373
338 Ga0501077_0006876
339 Ga0501077_0018194
340 Ga0501079_0017917
341 Ga0501079_0018645
342 Ga0501080_0016614
343 Ga0501080_0022761
344 Ga0501080_0041111
345 Ga0501080_0183443
346 Ga0501080_0444113
347 Ga0501081_0010829
348 Ga0501081_0136474
349 Ga0501081_0138748
350 Ga0501083_0005416
351 Ga0501083_0059176
352 Ga0501035_0048659
353 Ga0501044_0003924
354 Ga0501044_0007547
355 Ga0501045_0019846
356 nmdc:mga00v17_2871_c1
357 nmdc:mga00v17_61142_c1
358 nmdc:mga0yw44_206_c1
359 nmdc:mga0yw44_221700_c1
360 nmdc:mga06z11_16399_c1
361 nmdc:mga06z11_81213_c1
362 nmdc:mga05p37_2018_c1
363 nmdc:mga05p37_56304_c1
364 nmdc:mga05p37_64304_c1
365 nmdc:mga09592_6708_c1
366 nmdc:mga09592_8861_c1
367 nmdc:mga0qj67_117497_c1
368 nmdc:mga0qj67_1261_c1
369 nmdc:mga0qj67_218122_c1
370 nmdc:mga0qj67_2404_c1
371 nmdc:mga0qj67_36033_c1
372 nmdc:mga06r32_235227_c1
373 nmdc:mga06r32_3464_c1
374 nmdc:mga06r32_40559_c1
375 nmdc:mga06r32_54865_c1
376 nmdc:mga06r32_83758_c1
377 nmdc:mga08y16_6026_c1
378 nmdc:mga08y16_63528_c1
379 nmdc:mga0rr50_168189_c1
380 Ga0495619_0123075
381 Ga0500566_0001677
382 Ga0500593_058574
383 Ga0500568_0000450
384 Ga0500604_0001673
385 Ga0500616_0004913
386 Ga0501084_0001793
387 Ga0501084_0025415
388 Ga0501084_0034158
389 Ga0501082_0111574
390 Ga0501082_0248220
391 Ga0530510_0002759
392 Ga0530510_0007359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

46

118

0.97

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

151

401

0.94

PF09140

MipZ

ATPase MipZ

153

235

0.88

PF00142

Fer4_NifH

4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

154

420

0.75

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

155

382

0.7

PF13614

AAA_31

AAA domain

152

313

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
5auq-assembly2.cif.gz_E crystal structure of atpase-type hypb in the nucleotide free state 0.8827 107 353
5auq-assembly3.cif.gz_C crystal structure of atpase-type hypb in the nucleotide free state 0.8822 109 353
5auq-assembly1.cif.gz_H crystal structure of atpase-type hypb in the nucleotide free state 0.8774 110 353
5auq-assembly4.cif.gz_D crystal structure of atpase-type hypb in the nucleotide free state 0.8722 109 353
5auq-assembly1.cif.gz_A crystal structure of atpase-type hypb in the nucleotide free state 0.8688 109 353
ID Description Score Start End Superfamily
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9499 6 91 3.30.300.130
af_Q2FW86_86_295_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9266 108 321 3.40.50.300
af_Q6STH5_171_428_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.914 109 355 3.40.50.300
af_Q57731_34_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9112 110 358 3.40.50.300
af_Q6DH61_70_326_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9097 109 355 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2W1AJ43-F1-model_v4 Metal-sulfur cluster biosynthetic enzyme 0.9613 1 77
AF-A0A2E8TCK8-F1-model_v4 deleted 0.9562 1 77
AF-A0A7V9GF65-F1-model_v4 P-loop NTPase 0.9515 207 361 GO:0005524
GO:0016226
GO:0051539
AF-A0A7K2CQL7-F1-model_v4 Metal-sulfur cluster assembly factor 0.9508 1 88
AF-A0A2D9RR76-F1-model_v4 Aromatic ring hydroxylase 0.9382 4 81

Map