F301786

General Info

Members Datasets Scaffolds Average Seq Length
196 153 164 259

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10014356|Ga0307413_100143561
Length 288
Sequence MSTVTSSSPTDTQTAGVDRPVAAEAIAAVLAPAARPPRPGALSTSLTFGWRAILKIKHVPEQLFDVTAFPIIMTLMFTYLFGGALAGSTREYLQFLLPGIMVTSVVMITMYTGIGVNTDIEKGVFDRFRTLPIWRPSALVGAIFGDVLRYVLAATTIMIVGLVLGFRPAGGVLGVLAGVGLLVVFSFAFSWIWTMFGLFLRSEKSVMGVSMLVLFPLTFLSNVFVQPETMPGWLQAFVEVNPITHLVAAVRALMAGAPDGFEITWVLVASAVIVAVFGTLTMRLYNRK

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
4 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
5 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
6 2808606394 Promicromonospora sp. C35 Isolate Unclassified
7 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
8 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
9 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
10 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
11 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
12 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
13 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
14 2858882152 Micromonospora noduli MED15 Isolate Nodule
15 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
16 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
17 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
18 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
19 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
20 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
21 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
22 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
23 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
24 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
25 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
26 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
27 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
28 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
151 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
152 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
153 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0
Isolates 16.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 7.65
Nodule 1.02
Rhizoplane 2.55
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 17.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015564 3300003203 Bacteria 3203
2 JGI25407J50210_10015821 3300003373 Bacteria 1950
3 Ga0070683_100052392 3300005329 Bacteria 3780
4 Ga0070683_100289258 3300005329 Bacteria 1559
5 Ga0070659_100008093 3300005366 Bacteria 7667
6 Ga0070667_100082105 3300005367 Bacteria 2759
7 Ga0070710_10162584 3300005437 Bacteria 1386
8 Ga0070710_10276559 3300005437 Bacteria 1088
9 Ga0070694_100000015 3300005444 Bacteria 77125
10 Ga0070685_10014519 3300005466 Bacteria 4175
11 Ga0070684_100027841 3300005535 Bacteria 4774
12 Ga0068853_100017251 3300005539 Bacteria 5958
13 Ga0070672_100020949 3300005543 Bacteria 4778
14 Ga0070672_100249728 3300005543 Bacteria 1494
15 Ga0068855_100004021 3300005563 Bacteria 17952
16 Ga0068855_100022747 3300005563 Bacteria 7512
17 Ga0068855_100313319 3300005563 Bacteria 1736
18 Ga0068857_100000943 3300005577 Bacteria 22140
19 Ga0068856_100038908 3300005614 Bacteria 4669
20 Ga0068856_100588902 3300005614 Bacteria 1133
21 Ga0068856_101073949 3300005614 Bacteria 823
22 Ga0068852_100014462 3300005616 Bacteria 6078
23 Ga0068859_100035694 3300005617 Bacteria 4989
24 Ga0068851_10000003 3300005834 Bacteria 293018
25 Ga0081455_10147636 3300005937 Bacteria 1816
26 Ga0081538_10001504 3300005981 Bacteria 23920
27 Ga0081538_10009505 3300005981 Bacteria 8104
28 Ga0081539_10000516 3300005985 Bacteria 80445
29 Ga0081539_10004503 3300005985 Bacteria 15323
30 Ga0075365_10022816 3300006038 Bacteria 3927
31 Ga0075368_10045315 3300006042 Bacteria 1737
32 Ga0075362_10072813 3300006177 Bacteria 1572
33 Ga0075370_10131874 3300006353 Bacteria 1458
34 Ga0075428_100002660 3300006844 Bacteria 19407
35 Ga0075428_100064078 3300006844 Bacteria 4025
36 Ga0097620_100035694 3300006931 Bacteria 4989
37 Ga0105240_10004319 3300009093 Bacteria 21696
38 Ga0105240_10324229 3300009093 Bacteria 1754
39 Ga0111539_10641735 3300009094 Bacteria 1236
40 Ga0105245_10045254 3300009098 Bacteria 3930
41 Ga0105245_10063758 3300009098 Bacteria 3328
42 Ga0114129_10000402 3300009147 Bacteria 50689
43 Ga0114129_10111913 3300009147 Bacteria 3766
44 Ga0105243_10001007 3300009148 Bacteria 26043
45 Ga0105248_10031673 3300009177 Bacteria 5907
46 Ga0105237_10000131 3300009545 Bacteria 105010
47 Ga0105237_10016784 3300009545 Bacteria 7601
48 Ga0105238_10100776 3300009551 Bacteria 2871
49 Ga0105239_10115826 3300010375 Bacteria 2973
50 Ga0163163_10186825 3300014325 Bacteria 2120
51 Ga0157379_10037508 3300014968 Bacteria 4322
52 Ga0209148_1000828 3300025254 Bacteria 22166
53 Ga0207656_10000002 3300025321 Bacteria 792178
54 Ga0207692_10184819 3300025898 Bacteria 1216
55 Ga0207692_10264786 3300025898 Bacteria 1035
56 Ga0207710_10055612 3300025900 Bacteria 1784
57 Ga0207688_10024581 3300025901 Bacteria 3305
58 Ga0207645_10218474 3300025907 Bacteria 1256
59 Ga0207654_10000001 3300025911 Bacteria 1816198
60 Ga0207695_10001590 3300025913 Bacteria 36878
61 Ga0207695_10050329 3300025913 Bacteria 4384
62 Ga0207671_10000002 3300025914 Bacteria 1144816
63 Ga0207671_10016018 3300025914 Bacteria 5842
64 Ga0207657_10005029 3300025919 Bacteria 13872
65 Ga0207681_10709209 3300025923 Bacteria 837
66 Ga0207694_10000092 3300025924 Bacteria 100605
67 Ga0207694_10097284 3300025924 Bacteria 2329
68 Ga0207687_10031239 3300025927 Bacteria 3598
69 Ga0207687_10036306 3300025927 Bacteria 3357
70 Ga0207664_10185369 3300025929 Bacteria 1789
71 Ga0207644_10150110 3300025931 Bacteria 1803
72 Ga0207690_10022045 3300025932 Bacteria 3957
73 Ga0207709_10053332 3300025935 Bacteria 2488
74 Ga0207691_10027759 3300025940 Bacteria 5305
75 Ga0207711_10121214 3300025941 Bacteria 2335
76 Ga0207679_10224231 3300025945 Bacteria 1583
77 Ga0207667_10004049 3300025949 Bacteria 18003
78 Ga0207667_10020838 3300025949 Bacteria 7279
79 Ga0207667_10186549 3300025949 Bacteria 2129
80 Ga0207702_10039504 3300026078 Bacteria 3954
81 Ga0207675_100617399 3300026118 Bacteria 1088
82 Ga0207698_10000277 3300026142 Bacteria 31170
83 Ga0307515_10001173 3300028794 Bacteria 59934
84 Ga0307515_10059669 3300028794 Bacteria 5461
85 Ga0307515_10171619 3300028794 Bacteria 2159
86 Ga0307512_10003431 3300030522 Bacteria 18469
87 Ga0307513_10000123 3300031456 Bacteria 108854
88 Ga0307513_10065622 3300031456 Bacteria 3819
89 Ga0307408_100400261 3300031548 Bacteria 1179
90 Ga0307514_10118175 3300031649 Bacteria 1858
91 Ga0307413_10014356 3300031824 Bacteria 4019
92 Ga0307409_100117397 3300031995 Bacteria 2245
93 Ga0307409_100316819 3300031995 Bacteria 1458
94 Ga0307415_100149978 3300032126 Bacteria 1793
95 Ga0307415_100382938 3300032126 Bacteria 1195
96 Ga0373951_0000222 3300035091 Bacteria 19755
97 Ga0373941_0083404 3300035115 Bacteria 1083
98 Ga0373941_0102209 3300035115 Bacteria 999
99 Ga0373946_0061976 3300035171 Bacteria 1594
100 Ga0373955_0062749 3300035172 Bacteria 2056
101 Ga0395900_0045473 3300037418 Bacteria 4522
102 Ga0395898_0052139 3300037466 Bacteria 3997
103 Ga0451791_0757525 3300041451 Bacteria 1192
104 Ga0451791_0807488 3300041451 Bacteria 1014
105 Ga0451791_1332823 3300041451 Bacteria 1008
106 Ga0451795_0881777 3300041456 Bacteria 1649
107 Ga0451833_1297516 3300041491 Bacteria 1304
108 Ga0466963_0126732 3300044694 Bacteria 1760
109 Ga0466963_0167434 3300044694 Bacteria 1531
110 Ga0466963_0345694 3300044694 Bacteria 1047
111 Ga0466963_0383244 3300044694 Bacteria 991
112 Ga0466964_0155197 3300044706 Bacteria 1065
113 Ga0466971_0018351 3300044719 Bacteria 3098
114 Ga0466971_0186091 3300044719 Bacteria 977
115 Ga0466967_0056267 3300045976 Bacteria 3467
116 Ga0466967_0236053 3300045976 Bacteria 1742
117 Ga0466967_0289122 3300045976 Bacteria 1574
118 Ga0495627_053295 3300046453 Bacteria 1211
119 Ga0495629_0192128 3300046459 Bacteria 1413
120 Ga0495651_0371854 3300046462 Bacteria 939
121 Ga0495650_0001330 3300046471 Bacteria 24757
122 Ga0495665_0053403 3300046531 Bacteria 2137
123 Ga0495581_0016859 3300047315 Bacteria 4247
124 Ga0495581_0196941 3300047315 Bacteria 1178
125 Ga0495674_0024379 3300047319 Bacteria 5559
126 Ga0496110_0018557 3300048913 Bacteria 5834
127 Ga0496118_0017672 3300048921 Bacteria 6477
128 Ga0496118_0249996 3300048921 Bacteria 1008
129 Ga0496119_0004811 3300048922 Bacteria 13245
130 Ga0496120_0000655 3300048923 Bacteria 50898
131 Ga0496120_0004978 3300048923 Bacteria 10796
132 Ga0496120_0046369 3300048923 Bacteria 2512
133 Ga0496121_0000277 3300048924 Bacteria 107014
134 Ga0496122_0000360 3300048925 Bacteria 97913
135 Ga0496123_0002859 3300048926 Bacteria 20356
136 Ga0501032_0221509 3300049569 Bacteria 1231
137 Ga0501034_0181101 3300049571 Bacteria 2072
138 Ga0501036_0526136 3300049572 Bacteria 983
139 Ga0501037_0117862 3300049573 Bacteria 1910
140 Ga0501038_0181729 3300049574 Bacteria 1697
141 Ga0501042_0233853 3300049578 Bacteria 1326
142 Ga0501043_0284103 3300049579 Bacteria 1268
143 Ga0501047_0001409 3300049581 Bacteria 23584
144 Ga0501047_0087033 3300049581 Bacteria 3002
145 Ga0501070_0396601 3300049586 Bacteria 1116
146 Ga0501079_0018992 3300049741 Bacteria 5252
147 Ga0501080_0096915 3300049742 Bacteria 2739
148 Ga0501035_0023040 3300049822 Bacteria 5715
149 Ga0501044_0027058 3300049823 Bacteria 6067
150 nmdc:mga0yw44_113739_c1 3300050492 Bacteria 1736
151 nmdc:mga0yw44_5194_c1 3300050492 Bacteria 6105
152 nmdc:mga06z11_15116_c1 3300050494 Bacteria 3437
153 nmdc:mga05p37_270_c1 3300050507 Bacteria 53882
154 nmdc:mga09592_27_c1 3300050508 Bacteria 84251
155 nmdc:mga0qj67_24_c1 3300050509 Bacteria 106844
156 nmdc:mga06r32_99_c1 3300050510 Bacteria 61063
157 Ga0500651_0028601 3300053093 Bacteria 3505
158 Ga0500559_0005796 3300053136 Bacteria 5633
159 Ga0500559_0251776 3300053136 Bacteria 832
160 Ga0500573_0006685 3300053140 Bacteria 6255
161 Ga0500573_0011741 3300053140 Bacteria 4909
162 Ga0500577_0048251 3300053142 Bacteria 1587
163 Ga0500616_0006439 3300053153 Bacteria 7689
164 Ga0466962_0061804 3300061719 Bacteria 1788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031649 Ga0307514_10118175 Ga0307514_101181752 191
2 3300048921 Ga0496118_0017672 Ga0496118_0017672_3334_4101 191
3 3300048922 Ga0496119_0004811 Ga0496119_0004811_8084_8851 191
4 3300048923 Ga0496120_0000655 Ga0496120_0000655_22276_23043 191
5 3300053136 Ga0500559_0251776 Ga0500559_0251776_21_695 196
6 3300025923 Ga0207681_10709209 Ga0207681_107092091 207
7 3300053142 Ga0500577_0048251 Ga0500577_0048251_33_758 213
8 3300053153 Ga0500616_0006439 Ga0500616_0006439_5833_6651 213
9 3300044719 Ga0466971_0186091 Ga0466971_0186091_76_786 216
10 3300050492 nmdc:mga0yw44_5194_c1 nmdc:mga0yw44_5194_c1_4985_5698 216
11 3300050494 nmdc:mga06z11_15116_c1 nmdc:mga06z11_15116_c1_474_1337 218
12 3300006042 Ga0075368_10045315 Ga0075368_100453151 219
13 3300035172 Ga0373955_0062749 Ga0373955_0062749_1166_1960 221
14 3300046462 Ga0495651_0371854 Ga0495651_0371854_197_925 221
15 3300047319 Ga0495674_0024379 Ga0495674_0024379_4555_5349 221
16 3300049586 Ga0501070_0396601 Ga0501070_0396601_79_876 222
17 3300049742 Ga0501080_0096915 Ga0501080_0096915_1772_2569 222
18 iso_pu_bacteria 2852643534 2852645687 224
19 iso_pu_bacteria 2870622029 2870623785 224
20 3300005366 Ga0070659_100008093 Ga0070659_1000080932 227
21 3300005367 Ga0070667_100082105 Ga0070667_1000821053 227
22 3300005466 Ga0070685_10014519 Ga0070685_100145193 227
23 3300005539 Ga0068853_100017251 Ga0068853_1000172512 227
24 3300005543 Ga0070672_100020949 Ga0070672_1000209493 227
25 3300005563 Ga0068855_100004021 Ga0068855_10000402115 227
26 3300005563 Ga0068855_100022747 Ga0068855_1000227474 227
27 3300005563 Ga0068855_100313319 Ga0068855_1003133192 227
28 3300005577 Ga0068857_100000943 Ga0068857_10000094317 227
29 3300005614 Ga0068856_100038908 Ga0068856_1000389082 227
30 3300005614 Ga0068856_100588902 Ga0068856_1005889022 227
31 3300005614 Ga0068856_101073949 Ga0068856_1010739491 227
32 3300005616 Ga0068852_100014462 Ga0068852_1000144623 227
33 3300005617 Ga0068859_100035694 Ga0068859_1000356942 227
34 3300005834 Ga0068851_10000003 Ga0068851_1000000365 227
35 3300006931 Ga0097620_100035694 Ga0097620_1000356942 227
36 3300009093 Ga0105240_10004319 Ga0105240_1000431916 227
37 3300009093 Ga0105240_10324229 Ga0105240_103242292 227
38 3300009098 Ga0105245_10045254 Ga0105245_100452543 227
39 3300009098 Ga0105245_10063758 Ga0105245_100637583 227
40 3300009177 Ga0105248_10031673 Ga0105248_100316734 227
41 3300009545 Ga0105237_10000131 Ga0105237_1000013165 227
42 3300009545 Ga0105237_10016784 Ga0105237_100167842 227
43 3300009551 Ga0105238_10100776 Ga0105238_101007762 227
44 3300010375 Ga0105239_10115826 Ga0105239_101158262 227
45 3300014968 Ga0157379_10037508 Ga0157379_100375082 227
46 3300025254 Ga0209148_1000828 Ga0209148_100082815 227
47 3300025321 Ga0207656_10000002 Ga0207656_10000002172 227
48 3300025900 Ga0207710_10055612 Ga0207710_100556122 227
49 3300025911 Ga0207654_10000001 Ga0207654_100000011682 227
50 3300025913 Ga0207695_10001590 Ga0207695_100015905 227
51 3300025913 Ga0207695_10050329 Ga0207695_100503292 227
52 3300025914 Ga0207671_10000002 Ga0207671_10000002466 227
53 3300025914 Ga0207671_10016018 Ga0207671_100160184 227
54 3300025919 Ga0207657_10005029 Ga0207657_100050295 227
55 3300025924 Ga0207694_10000092 Ga0207694_1000009270 227
56 3300025924 Ga0207694_10097284 Ga0207694_100972841 227
57 3300025927 Ga0207687_10031239 Ga0207687_100312392 227
58 3300025927 Ga0207687_10036306 Ga0207687_100363063 227
59 3300025929 Ga0207664_10185369 Ga0207664_101853692 227
60 3300025932 Ga0207690_10022045 Ga0207690_100220452 227
61 3300025940 Ga0207691_10027759 Ga0207691_100277593 227
62 3300025941 Ga0207711_10121214 Ga0207711_101212142 227
63 3300025949 Ga0207667_10004049 Ga0207667_100040493 227
64 3300025949 Ga0207667_10020838 Ga0207667_100208385 227
65 3300025949 Ga0207667_10186549 Ga0207667_101865492 227
66 3300026078 Ga0207702_10039504 Ga0207702_100395044 227
67 3300026142 Ga0207698_10000277 Ga0207698_1000027721 227
68 3300041456 Ga0451795_0881777 Ga0451795_0881777_285_1052 227
69 3300046453 Ga0495627_053295 Ga0495627_053295_386_1195 227
70 3300046471 Ga0495650_0001330 Ga0495650_0001330_2402_3169 227
71 3300048921 Ga0496118_0249996 Ga0496118_0249996_220_987 227
72 3300048923 Ga0496120_0004978 Ga0496120_0004978_8988_9755 227
73 3300048923 Ga0496120_0046369 Ga0496120_0046369_518_1285 227
74 3300048925 Ga0496122_0000360 Ga0496122_0000360_14305_15075 227
75 3300048926 Ga0496123_0002859 Ga0496123_0002859_2195_2965 227
76 3300049569 Ga0501032_0221509 Ga0501032_0221509_460_1209 227
77 3300053093 Ga0500651_0028601 Ga0500651_0028601_835_1602 227
78 3300053136 Ga0500559_0005796 Ga0500559_0005796_384_1151 227
79 3300053140 Ga0500573_0006685 Ga0500573_0006685_2808_3575 227
80 3300053140 Ga0500573_0011741 Ga0500573_0011741_3277_4044 227
81 3300005437 Ga0070710_10276559 Ga0070710_102765591 228
82 3300005985 Ga0081539_10004503 Ga0081539_100045038 228
83 3300006038 Ga0075365_10022816 Ga0075365_100228162 228
84 3300025898 Ga0207692_10264786 Ga0207692_102647861 228
85 3300048924 Ga0496121_0000277 Ga0496121_0000277_8911_9681 228
86 3300049571 Ga0501034_0181101 Ga0501034_0181101_70_840 228
87 3300049572 Ga0501036_0526136 Ga0501036_0526136_162_932 228
88 3300049573 Ga0501037_0117862 Ga0501037_0117862_611_1381 228
89 3300049574 Ga0501038_0181729 Ga0501038_0181729_877_1647 228
90 3300049579 Ga0501043_0284103 Ga0501043_0284103_348_1118 228
91 3300049581 Ga0501047_0001409 Ga0501047_0001409_20918_21688 228
92 3300049822 Ga0501035_0023040 Ga0501035_0023040_4069_4839 228
93 3300049823 Ga0501044_0027058 Ga0501044_0027058_3582_4352 228
94 3300050492 nmdc:mga0yw44_113739_c1 nmdc:mga0yw44_113739_c1_492_1262 228
95 3300005937 Ga0081455_10147636 Ga0081455_101476363 229
96 3300026118 Ga0207675_100617399 Ga0207675_1006173992 230
97 3300045976 Ga0466967_0289122 Ga0466967_0289122_376_1134 230
98 3300049581 Ga0501047_0087033 Ga0501047_0087033_289_1092 230
99 3300005543 Ga0070672_100249728 Ga0070672_1002497282 231
100 3300041451 Ga0451791_0757525 Ga0451791_0757525_279_1046 232
101 3300037418 Ga0395900_0045473 Ga0395900_0045473_533_1336 233
102 3300037466 Ga0395898_0052139 Ga0395898_0052139_297_1100 233
103 3300005329 Ga0070683_100052392 Ga0070683_1000523924 236
104 3300005535 Ga0070684_100027841 Ga0070684_1000278414 236
105 3300044694 Ga0466963_0345694 Ga0466963_0345694_257_1036 236
106 3300044694 Ga0466963_0383244 Ga0466963_0383244_152_931 236
107 3300035115 Ga0373941_0102209 Ga0373941_0102209_146_973 237
108 3300006177 Ga0075362_10072813 Ga0075362_100728132 238
109 3300006353 Ga0075370_10131874 Ga0075370_101318742 238
110 3300009148 Ga0105243_10001007 Ga0105243_100010076 238
111 3300025935 Ga0207709_10053332 Ga0207709_100533323 238
112 3300046531 Ga0495665_0053403 Ga0495665_0053403_435_1274 238
113 3300047315 Ga0495581_0196941 Ga0495581_0196941_274_1113 238
114 3300006844 Ga0075428_100002660 Ga0075428_1000026605 241
115 3300009147 Ga0114129_10000402 Ga0114129_1000040220 241
116 3300049741 Ga0501079_0018992 Ga0501079_0018992_3308_4093 241
117 3300050507 nmdc:mga05p37_270_c1 nmdc:mga05p37_270_c1_38888_39733 241
118 3300050508 nmdc:mga09592_27_c1 nmdc:mga09592_27_c1_19655_20500 241
119 3300050509 nmdc:mga0qj67_24_c1 nmdc:mga0qj67_24_c1_19649_20494 241
120 3300050510 nmdc:mga06r32_99_c1 nmdc:mga06r32_99_c1_19649_20494 241
121 3300025907 Ga0207645_10218474 Ga0207645_102184742 242
122 3300049578 Ga0501042_0233853 Ga0501042_0233853_403_1254 242
123 iso_pu_bacteria 8056667051 8056672775 242
124 3300005437 Ga0070710_10162584 Ga0070710_101625842 243
125 3300025898 Ga0207692_10184819 Ga0207692_101848192 243
126 iso_pu_bacteria 2758568522 2760303832 243
127 iso_pu_bacteria 8056579771 8056580948 243
128 iso_pu_bacteria 2739367654 2739608194 244
129 iso_pu_bacteria 2808606394 2809027078 244
130 3300044706 Ga0466964_0155197 Ga0466964_0155197_171_980 246
131 3300045976 Ga0466967_0056267 Ga0466967_0056267_188_997 246
132 3300025901 Ga0207688_10024581 Ga0207688_100245813 247
133 3300025945 Ga0207679_10224231 Ga0207679_102242313 247
134 3300035171 Ga0373946_0061976 Ga0373946_0061976_241_1053 247
135 3300044694 Ga0466963_0126732 Ga0466963_0126732_61_876 247
136 3300044694 Ga0466963_0167434 Ga0466963_0167434_690_1502 247
137 3300044719 Ga0466971_0018351 Ga0466971_0018351_2148_2960 247
138 3300045976 Ga0466967_0236053 Ga0466967_0236053_98_913 247
139 3300046459 Ga0495629_0192128 Ga0495629_0192128_40_852 247
140 3300047315 Ga0495581_0016859 Ga0495581_0016859_2015_2827 247
141 3300061719 Ga0466962_0061804 Ga0466962_0061804_277_1089 247
142 3300041451 Ga0451791_0807488 Ga0451791_0807488_105_947 248
143 3300014325 Ga0163163_10186825 Ga0163163_101868252 250
144 3300032126 Ga0307415_100382938 Ga0307415_1003829382 250
145 3300048913 Ga0496110_0018557 Ga0496110_0018557_2409_3296 250
146 iso_pu_bacteria 2946072368 2946079173 251
147 3300028794 Ga0307515_10171619 Ga0307515_101716192 252
148 iso_pu_bacteria 2837268691 2837269196 252
149 iso_pu_bacteria 2870721527 2870723772 252
150 iso_pu_bacteria 2837183177 2837184919 253
151 3300005444 Ga0070694_100000015 Ga0070694_10000001557 254
152 3300030522 Ga0307512_10003431 Ga0307512_100034319 254
153 iso_pu_bacteria 2884693830 2884703946 254
154 3300041491 Ga0451833_1297516 Ga0451833_1297516_258_1109 256
155 iso_pu_bacteria 8056207758 8056214888 256
156 iso_pu_bacteria 2984523437 2984525657 257
157 iso_pu_bacteria 2791354901 2791914199 258
158 iso_pu_bacteria 2887478801 2887479241 258
159 3300031456 Ga0307513_10000123 Ga0307513_1000012391 259
160 3300035115 Ga0373941_0083404 Ga0373941_0083404_69_914 259
161 iso_pu_bacteria 2675903059 2676486523 259
162 3300005329 Ga0070683_100289258 Ga0070683_1002892582 260
163 3300025931 Ga0207644_10150110 Ga0207644_101501102 260
164 3300003203 JGI25406J46586_10015564 JGI25406J46586_100155643 261
165 3300003373 JGI25407J50210_10015821 JGI25407J50210_100158212 261
166 3300005981 Ga0081538_10001504 Ga0081538_1000150416 261
167 3300005981 Ga0081538_10009505 Ga0081538_100095053 261
168 3300005985 Ga0081539_10000516 Ga0081539_1000051666 261
169 3300006844 Ga0075428_100064078 Ga0075428_1000640782 261
170 3300009094 Ga0111539_10641735 Ga0111539_106417352 261
171 3300009147 Ga0114129_10111913 Ga0114129_101119132 261
172 3300028794 Ga0307515_10001173 Ga0307515_1000117317 261
173 3300028794 Ga0307515_10059669 Ga0307515_100596691 261
174 3300031456 Ga0307513_10065622 Ga0307513_100656225 261
175 3300031548 Ga0307408_100400261 Ga0307408_1004002612 261
176 3300031824 Ga0307413_10014356 Ga0307413_100143561 261
177 3300031995 Ga0307409_100117397 Ga0307409_1001173972 261
178 3300031995 Ga0307409_100316819 Ga0307409_1003168191 261
179 3300032126 Ga0307415_100149978 Ga0307415_1001499782 261
180 3300035091 Ga0373951_0000222 Ga0373951_0000222_9073_9918 261
181 3300041451 Ga0451791_1332823 Ga0451791_1332823_55_906 261
182 iso_pu_bacteria 2515154088 2515494470 261
183 iso_pu_bacteria 2855670206 2855671354 261
184 iso_pu_bacteria 2855676851 2855678516 261
185 iso_pu_bacteria 2857288857 2857292051 261
186 iso_pu_bacteria 2858848962 2858850837 261
187 iso_pu_bacteria 2858882152 2858883789 261
188 iso_pu_bacteria 2858888857 2858894104 261
189 iso_pu_bacteria 2858895516 2858900992 261
190 iso_pu_bacteria 2861520306 2861522619 261
191 iso_pu_bacteria 2869048445 2869051050 261
192 iso_pu_bacteria 2869061728 2869062490 261
193 iso_pu_bacteria 2869068681 2869070862 261
194 iso_pu_bacteria 2880495981 2880498951 261
195 iso_pu_bacteria 2990088156 2990088459 261
196 iso_pu_bacteria 8003870546 8003871389 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

45

255

0.93

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

51

283

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.6833 32 226
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.6523 36 226
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.6488 32 225
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.6471 36 226
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.644 32 226
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7881 86 247 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7861 86 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7738 84 257 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5398 84 257 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5378 86 254 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A127SX38-F1-model_v4 ABC2_membrane 0.9267 84 260 GO:0016020
GO:0140359
AF-A0A7L5ASJ5-F1-model_v4 Transport permease protein 0.9203 41 259 GO:0043190
GO:0140359
AF-A0A1E2RXS6-F1-model_v4 Daunorubicin/doxorubicin resistance ABC transporter permease protein DrrB 0.919 89 260 GO:0016020
GO:0140359
AF-A0A7X7CWJ3-F1-model_v4 Transport permease protein 0.9181 27 260 GO:0043190
GO:0140359
AF-A0A0F5VLK1-F1-model_v4 Transport permease protein 0.9181 33 259 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
64.57 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map