F301773

General Info

Members Datasets Scaffolds Average Seq Length
196 108 392 216

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10030746|Ga0316579_100307462
Length 208
Sequence MLERLKEELYQLHLELPRNELVKWTGGNVSARDQETGLVVIKPSGVRYEALRPEDHVVMNLDGEVVEGSLKPSSDTASHLYIYRHREDVNGVVHTHSPYATAFAAVGRPIPCCLTAIADEFGADFALIGSEAIGKQVVEHIGSSKAVLLKQHGVFTIGETATAAVKAAVMVEDVAKAVWLALQIGEVVDIDPEAVKTLHTRYTYVYGQ

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
57 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
58 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
64 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
65 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
106 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
107 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
108 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 3.57
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10030746 3300031691 Bacteria 2455
2 rootH1_10123684 3300003323 Bacteria 1221
3 Ga0070705_100781208 3300005440 Bacteria 758
4 Ga0070694_100014661 3300005444 Bacteria 4909
5 Ga0070694_100144185 3300005444 Bacteria 1733
6 Ga0070694_100675664 3300005444 Bacteria 838
7 Ga0070678_100555986 3300005456 Bacteria 1019
8 Ga0070685_10144166 3300005466 Bacteria 1503
9 Ga0070698_100119560 3300005471 Bacteria 2595
10 Ga0070699_100019418 3300005518 Bacteria 5851
11 Ga0070699_100232866 3300005518 Bacteria 1643
12 Ga0070684_100184630 3300005535 Bacteria 1897
13 Ga0070686_100105544 3300005544 Bacteria 1910
14 Ga0070695_100122228 3300005545 Bacteria 1783
15 Ga0070695_100777952 3300005545 Bacteria 765
16 Ga0070696_100028718 3300005546 Bacteria 3795
17 Ga0070704_100623061 3300005549 Bacteria 950
18 Ga0068857_100284579 3300005577 Unclassified 1521
19 Ga0068857_100333518 3300005577 Unclassified 1402
20 Ga0068862_100271834 3300005844 Bacteria 1550
21 Ga0068862_100529089 3300005844 Bacteria 1123
22 Ga0081539_10002756 3300005985 Bacteria 23655
23 Ga0081539_10033123 3300005985 Bacteria 3153
24 Ga0070717_10351012 3300006028 Bacteria 1319
25 Ga0075430_100377128 3300006846 Bacteria 1171
26 Ga0075431_100046017 3300006847 Bacteria 4499
27 Ga0075431_100397254 3300006847 Bacteria 1380
28 Ga0075429_100114674 3300006880 Bacteria 2356
29 Ga0075429_100249915 3300006880 Bacteria 1553
30 Ga0111539_10406343 3300009094 Unclassified 1586
31 Ga0114129_10025998 3300009147 Bacteria 8289
32 Ga0114129_10039440 3300009147 Bacteria 6658
33 Ga0114129_10050015 3300009147 Bacteria 5872
34 Ga0114129_10203393 3300009147 Bacteria 2681
35 Ga0114129_10212499 3300009147 Bacteria 2614
36 Ga0114129_10380131 3300009147 Bacteria 1865
37 Ga0114129_10587199 3300009147 Bacteria 1445
38 Ga0114129_10793087 3300009147 Bacteria 1209
39 Ga0105243_10066774 3300009148 Bacteria 2894
40 Ga0105242_10116694 3300009176 Bacteria 2284
41 Ga0105242_10961681 3300009176 Bacteria 859
42 Ga0105249_10351289 3300009553 Bacteria 1494
43 Ga0157370_10032088 3300013104 Bacteria 5132
44 Ga0157369_10215625 3300013105 Bacteria 2010
45 Ga0163162_10098213 3300013306 Bacteria 3017
46 Ga0163163_10092819 3300014325 Bacteria 3034
47 Ga0157379_10086109 3300014968 Bacteria 2817
48 Ga0197907_11174274 3300020069 Bacteria 3162
49 Ga0206349_1275625 3300020075 Bacteria 1347
50 Ga0224712_10012437 3300022467 Bacteria 2678
51 Ga0207684_10422038 3300025910 Bacteria 1146
52 Ga0207662_10344260 3300025918 Bacteria 1000
53 Ga0207681_10330102 3300025923 Bacteria 1216
54 Ga0207640_10318748 3300025981 Bacteria 1237
55 Ga0207676_10311386 3300026095 Bacteria 1442
56 Ga0207698_10514820 3300026142 Bacteria 1167
57 Ga0268265_10719958 3300028380 Unclassified 966
58 Ga0268264_10318355 3300028381 Bacteria 1470
59 Ga0265318_10004016 3300028577 Bacteria 7227
60 Ga0265323_10100370 3300028653 Bacteria 959
61 Ga0265323_10165842 3300028653 Unclassified 703
62 Ga0265338_10010845 3300028800 Bacteria 10612
63 Ga0265320_10026031 3300031240 Bacteria 3068
64 Ga0265340_10000827 3300031247 Bacteria 17590
65 Ga0265331_10008196 3300031250 Bacteria 5959
66 Ga0307509_10033446 3300031507 Bacteria 5659
67 Ga0265313_10252386 3300031595 Unclassified 719
68 Ga0316575_10070739 3300031665 Bacteria 1401
69 Ga0316579_10074732 3300031691 Bacteria 1609
70 Ga0316579_10122166 3300031691 Unclassified 1252
71 Ga0316576_10069325 3300031727 Bacteria 2600
72 Ga0316576_10291356 3300031727 Bacteria 1221
73 Ga0316576_10294881 3300031727 Bacteria 1213
74 Ga0316576_10515453 3300031727 Bacteria 879
75 Ga0316578_10033637 3300031728 Bacteria 2939
76 Ga0316578_10033667 3300031728 Bacteria 2938
77 Ga0316578_10123839 3300031728 Bacteria 1555
78 Ga0316577_10000764 3300031733 Bacteria 13821
79 Ga0316577_10001640 3300031733 Bacteria 10698
80 Ga0316577_10008860 3300031733 Bacteria 5399
81 Ga0316577_10009942 3300031733 Bacteria 5131
82 Ga0316577_10019401 3300031733 Bacteria 3762
83 Ga0316577_10032620 3300031733 Bacteria 2909
84 Ga0316577_10077336 3300031733 Unclassified 1858
85 Ga0307412_10032209 3300031911 Bacteria 3319
86 Ga0307409_100073324 3300031995 Bacteria 2730
87 Ga0307409_100527234 3300031995 Bacteria 1155
88 Ga0316585_10062773 3300032137 Bacteria 1201
89 Ga0316585_10106912 3300032137 Unclassified 919
90 Ga0316580_10042558 3300032139 Bacteria 1402
91 Ga0373929_0083254 3300035085 Bacteria 783
92 Ga0316574_0021301 3300035398 Bacteria 3848
93 Ga0316574_0193209 3300035398 Bacteria 1309
94 Ga0316574_0486456 3300035398 Unclassified 771
95 Ga0373947_0518162 3300035725 Bacteria 811
96 Ga0316582_0015732 3300036647 Bacteria 4336
97 Ga0316582_0019229 3300036647 Bacteria 3993
98 Ga0316582_0024588 3300036647 Bacteria 3606
99 Ga0316582_0028126 3300036647 Bacteria 3403
100 Ga0316582_0029310 3300036647 Bacteria 3343
101 Ga0316582_0045878 3300036647 Bacteria 2753
102 Ga0316582_0077828 3300036647 Bacteria 2159
103 Ga0316582_0080202 3300036647 Bacteria 2130
104 Ga0316582_0137712 3300036647 Bacteria 1644
105 Ga0316582_0163180 3300036647 Bacteria 1510
106 Ga0316582_0220982 3300036647 Bacteria 1295
107 Ga0316582_0261654 3300036647 Bacteria 1186
108 Ga0316582_0375119 3300036647 Bacteria 979
109 Ga0316584_0002927 3300036712 Bacteria 10973
110 Ga0316584_0023506 3300036712 Bacteria 4502
111 Ga0316584_0024236 3300036712 Bacteria 4439
112 Ga0316584_0034157 3300036712 Bacteria 3770
113 Ga0316584_0098919 3300036712 Unclassified 2184
114 Ga0316584_0144798 3300036712 Bacteria 1770
115 Ga0316584_0145442 3300036712 Bacteria 1766
116 Ga0316584_0220358 3300036712 Bacteria 1394
117 Ga0316584_0328646 3300036712 Bacteria 1101
118 Ga0316584_0337756 3300036712 Bacteria 1083
119 Ga0316584_0405176 3300036712 Bacteria 971
120 Ga0316581_0004665 3300037588 Unclassified 3514
121 Ga0316581_0007754 3300037588 Bacteria 2895
122 Ga0400489_26392 3300039093 Bacteria 56521
123 Ga0400487_13704 3300039110 Bacteria 1613
124 Ga0451577_0053013 3300042876 Bacteria 3622
125 Ga0451577_0838076 3300042876 Unclassified 830
126 Ga0451577_1102538 3300042876 Bacteria 710
127 Ga0466969_0036751 3300044656 Bacteria 2472
128 Ga0466972_0022816 3300044658 Bacteria 3114
129 Ga0453683_0000414 3300044673 Bacteria 49869
130 Ga0453683_0007959 3300044673 Bacteria 7140
131 Ga0466965_0360579 3300044683 Bacteria 797
132 Ga0466961_0000960 3300044693 Bacteria 17846
133 Ga0466963_0225568 3300044694 Unclassified 1313
134 Ga0453684_0004380 3300044712 Bacteria 29928
135 Ga0453684_0036203 3300044712 Bacteria 6806
136 Ga0453684_0089563 3300044712 Bacteria 3805
137 Ga0453684_0151071 3300044712 Bacteria 2760
138 Ga0453684_0222428 3300044712 Bacteria 2186
139 Ga0453684_0393673 3300044712 Bacteria 1553
140 Ga0453684_0790921 3300044712 Bacteria 1024
141 Ga0453684_0967301 3300044712 Bacteria 907
142 Ga0453684_1091855 3300044712 Unclassified 843
143 Ga0453684_1244174 3300044712 Bacteria 779
144 Ga0466971_0002762 3300044719 Bacteria 7418
145 Ga0466968_0003527 3300044735 Bacteria 5787
146 Ga0466960_0126549 3300044901 Bacteria 1343
147 Ga0466959_0000368 3300045049 Bacteria 26632
148 Ga0451576_0010009 3300045051 Bacteria 10928
149 Ga0451576_0032472 3300045051 Bacteria 5558
150 Ga0451576_0192623 3300045051 Bacteria 2129
151 Ga0451576_0296466 3300045051 Bacteria 1691
152 Ga0451576_0331462 3300045051 Bacteria 1593
153 Ga0466958_0057150 3300045836 Bacteria 2371
154 Ga0495592_0082741 3300046454 Bacteria 2319
155 Ga0495651_0000678 3300046462 Bacteria 26457
156 Ga0495651_0008133 3300046462 Bacteria 8044
157 Ga0495664_0063445 3300046477 Bacteria 2202
158 Ga0495618_0042915 3300046514 Bacteria 2853
159 Ga0495628_0014954 3300046516 Bacteria 6490
160 Ga0495652_0004774 3300046529 Bacteria 12900
161 Ga0495652_0229016 3300046529 Bacteria 1391
162 Ga0495645_0031568 3300046543 Bacteria 3860
163 Ga0495645_0105427 3300046543 Bacteria 2000
164 Ga0495635_0005267 3300046663 Bacteria 8996
165 Ga0495600_0158763 3300046809 Bacteria 1462
166 Ga0495604_0161112 3300047317 Bacteria 1585
167 Ga0501290_010186 3300049513 Bacteria 1199
168 Ga0501075_0181066 3300049591 Bacteria 1608
169 Ga0501257_031441 3300049686 Bacteria 1281
170 Ga0501080_0312140 3300049742 Bacteria 1425
171 Ga0501035_0401211 3300049822 Bacteria 1141
172 nmdc:mga05p37_121326_c1 3300050507 Bacteria 3211
173 nmdc:mga05p37_144295_c1 3300050507 Bacteria 2916
174 nmdc:mga05p37_18069_c1 3300050507 Bacteria 8518
175 nmdc:mga05p37_271403_c1 3300050507 Bacteria 2026
176 nmdc:mga05p37_445240_c1 3300050507 Unclassified 1501
177 nmdc:mga05p37_69940_c1 3300050507 Bacteria 4317
178 nmdc:mga05p37_779541_c1 3300050507 Bacteria 1049
179 nmdc:mga09592_119848_c1 3300050508 Bacteria 2260
180 nmdc:mga09592_221672_c1 3300050508 Bacteria 1638
181 nmdc:mga06r32_11598_c1 3300050510 Bacteria 7933
182 nmdc:mga06r32_151866_c1 3300050510 Bacteria 2295
183 nmdc:mga06r32_387336_c1 3300050510 Bacteria 1380
184 Ga0495601_0027378 3300053077 Bacteria 3524
185 Ga0495601_0051705 3300053077 Bacteria 2593
186 Ga0495619_0106579 3300053085 Bacteria 1911
187 Ga0501084_0283173 3300054114 Bacteria 1400
188 Ga0501084_0588390 3300054114 Bacteria 940
189 Ga0587077_034355 3300059493 Bacteria 985
190 Ga0587076_061128 3300059645 Bacteria 759
191 Ga0587071_064029 3300060344 Bacteria 787
192 Ga0587111_0003528 3300060346 Bacteria 2235
193 Ga0466962_0000502 3300061719 Bacteria 17005
194 2819424324 2818991318 Bacteria 5266538
195 2819692933 2818991462 Bacteria 4320267
196 2819727339 2818991469 Bacteria 4644110
197 Ga0316579_10030746
198 rootH1_10123684
199 Ga0070705_100781208
200 Ga0070694_100014661
201 Ga0070694_100144185
202 Ga0070694_100675664
203 Ga0070678_100555986
204 Ga0070685_10144166
205 Ga0070698_100119560
206 Ga0070699_100019418
207 Ga0070699_100232866
208 Ga0070684_100184630
209 Ga0070686_100105544
210 Ga0070695_100122228
211 Ga0070695_100777952
212 Ga0070696_100028718
213 Ga0070704_100623061
214 Ga0068857_100284579
215 Ga0068857_100333518
216 Ga0068862_100271834
217 Ga0068862_100529089
218 Ga0081539_10002756
219 Ga0081539_10033123
220 Ga0070717_10351012
221 Ga0075430_100377128
222 Ga0075431_100046017
223 Ga0075431_100397254
224 Ga0075429_100114674
225 Ga0075429_100249915
226 Ga0111539_10406343
227 Ga0114129_10025998
228 Ga0114129_10039440
229 Ga0114129_10050015
230 Ga0114129_10203393
231 Ga0114129_10212499
232 Ga0114129_10380131
233 Ga0114129_10587199
234 Ga0114129_10793087
235 Ga0105243_10066774
236 Ga0105242_10116694
237 Ga0105242_10961681
238 Ga0105249_10351289
239 Ga0157370_10032088
240 Ga0157369_10215625
241 Ga0163162_10098213
242 Ga0163163_10092819
243 Ga0157379_10086109
244 Ga0197907_11174274
245 Ga0206349_1275625
246 Ga0224712_10012437
247 Ga0207684_10422038
248 Ga0207662_10344260
249 Ga0207681_10330102
250 Ga0207640_10318748
251 Ga0207676_10311386
252 Ga0207698_10514820
253 Ga0268265_10719958
254 Ga0268264_10318355
255 Ga0265318_10004016
256 Ga0265323_10100370
257 Ga0265323_10165842
258 Ga0265338_10010845
259 Ga0265320_10026031
260 Ga0265340_10000827
261 Ga0265331_10008196
262 Ga0307509_10033446
263 Ga0265313_10252386
264 Ga0316575_10070739
265 Ga0316579_10074732
266 Ga0316579_10122166
267 Ga0316576_10069325
268 Ga0316576_10291356
269 Ga0316576_10294881
270 Ga0316576_10515453
271 Ga0316578_10033637
272 Ga0316578_10033667
273 Ga0316578_10123839
274 Ga0316577_10000764
275 Ga0316577_10001640
276 Ga0316577_10008860
277 Ga0316577_10009942
278 Ga0316577_10019401
279 Ga0316577_10032620
280 Ga0316577_10077336
281 Ga0307412_10032209
282 Ga0307409_100073324
283 Ga0307409_100527234
284 Ga0316585_10062773
285 Ga0316585_10106912
286 Ga0316580_10042558
287 Ga0373929_0083254
288 Ga0316574_0021301
289 Ga0316574_0193209
290 Ga0316574_0486456
291 Ga0373947_0518162
292 Ga0316582_0015732
293 Ga0316582_0019229
294 Ga0316582_0024588
295 Ga0316582_0028126
296 Ga0316582_0029310
297 Ga0316582_0045878
298 Ga0316582_0077828
299 Ga0316582_0080202
300 Ga0316582_0137712
301 Ga0316582_0163180
302 Ga0316582_0220982
303 Ga0316582_0261654
304 Ga0316582_0375119
305 Ga0316584_0002927
306 Ga0316584_0023506
307 Ga0316584_0024236
308 Ga0316584_0034157
309 Ga0316584_0098919
310 Ga0316584_0144798
311 Ga0316584_0145442
312 Ga0316584_0220358
313 Ga0316584_0328646
314 Ga0316584_0337756
315 Ga0316584_0405176
316 Ga0316581_0004665
317 Ga0316581_0007754
318 Ga0400489_26392
319 Ga0400487_13704
320 Ga0451577_0053013
321 Ga0451577_0838076
322 Ga0451577_1102538
323 Ga0466969_0036751
324 Ga0466972_0022816
325 Ga0453683_0000414
326 Ga0453683_0007959
327 Ga0466965_0360579
328 Ga0466961_0000960
329 Ga0466963_0225568
330 Ga0453684_0004380
331 Ga0453684_0036203
332 Ga0453684_0089563
333 Ga0453684_0151071
334 Ga0453684_0222428
335 Ga0453684_0393673
336 Ga0453684_0790921
337 Ga0453684_0967301
338 Ga0453684_1091855
339 Ga0453684_1244174
340 Ga0466971_0002762
341 Ga0466968_0003527
342 Ga0466960_0126549
343 Ga0466959_0000368
344 Ga0451576_0010009
345 Ga0451576_0032472
346 Ga0451576_0192623
347 Ga0451576_0296466
348 Ga0451576_0331462
349 Ga0466958_0057150
350 Ga0495592_0082741
351 Ga0495651_0000678
352 Ga0495651_0008133
353 Ga0495664_0063445
354 Ga0495618_0042915
355 Ga0495628_0014954
356 Ga0495652_0004774
357 Ga0495652_0229016
358 Ga0495645_0031568
359 Ga0495645_0105427
360 Ga0495635_0005267
361 Ga0495600_0158763
362 Ga0495604_0161112
363 Ga0501290_010186
364 Ga0501075_0181066
365 Ga0501257_031441
366 Ga0501080_0312140
367 Ga0501035_0401211
368 nmdc:mga05p37_121326_c1
369 nmdc:mga05p37_144295_c1
370 nmdc:mga05p37_18069_c1
371 nmdc:mga05p37_271403_c1
372 nmdc:mga05p37_445240_c1
373 nmdc:mga05p37_69940_c1
374 nmdc:mga05p37_779541_c1
375 nmdc:mga09592_119848_c1
376 nmdc:mga09592_221672_c1
377 nmdc:mga06r32_11598_c1
378 nmdc:mga06r32_151866_c1
379 nmdc:mga06r32_387336_c1
380 Ga0495601_0027378
381 Ga0495601_0051705
382 Ga0495619_0106579
383 Ga0501084_0283173
384 Ga0501084_0588390
385 Ga0587077_034355
386 Ga0587076_061128
387 Ga0587071_064029
388 Ga0587111_0003528
389 Ga0466962_0000502
390 2819424324
391 2819692933
392 2819727339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

7

179

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.9666 1 206
4c25-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase 0.9592 6 208
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.953 1 206
1e4c-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant s71q 0.9348 1 206
1e4b-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant n29q 0.9346 1 206
ID Description Score Start End Superfamily
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9667 1 206 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9531 1 206 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9472 6 209 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9409 6 189 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9382 6 209 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A2N2M7S7-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9956 78 213 GO:0005829
GO:0008742
GO:0016832
GO:0019323
GO:0046872
AF-A0A2W4N7G1-F1-model_v4 Class II aldolase 0.9812 1 213 GO:0005829
GO:0016832
GO:0019323
AF-A0A2N2M7S7-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9812 78 213 GO:0005829
GO:0008742
GO:0016832
GO:0019323
GO:0046872
AF-A0A7X7FRJ1-F1-model_v4 L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4) 0.9805 1 87 GO:0005829
GO:0016832
GO:0016853
GO:0019323
GO:0046872
AF-A0A2N2E2J5-F1-model_v4 Class II aldolase family protein 0.9804 1 96 GO:0005829
GO:0016832
GO:0019323

Map