F301244

General Info

Members Datasets Scaffolds Average Seq Length
196 164 190 61

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100913160|Ga0068853_1009131602
Length 69
Sequence MSDKQKKPAGSGKKIRVTLVKGLVGTIGKHRESVRGLGLRHREHTVELVDTPAVRGMINRVSYLVKVEE

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2831864461 Roseateles noduli HZ7 Isolate Nodule
3 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
4 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
5 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
97 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
109 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
110 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
111 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
112 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
137 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
159 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 4.08
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 1.53
Rhizoplane 2.04
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100281674 3300005331 Bacteria 1451
2 Ga0068868_100083822 3300005338 Bacteria 2560
3 Ga0070660_100001978 3300005339 Bacteria 14153
4 Ga0070661_100008785 3300005344 Bacteria 6991
5 Ga0070671_100219851 3300005355 Bacteria 1612
6 Ga0070659_100004652 3300005366 Bacteria 9804
7 Ga0070705_100034427 3300005440 Bacteria 2832
8 Ga0070678_101772830 3300005456 Bacteria 582
9 Ga0070662_100274424 3300005457 Bacteria 1362
10 Ga0070681_10213518 3300005458 Bacteria 1846
11 Ga0070707_100416642 3300005468 Bacteria 1304
12 Ga0070699_100751592 3300005518 Bacteria 892
13 Ga0070699_100932463 3300005518 Bacteria 795
14 Ga0070697_100381580 3300005536 Bacteria 1221
15 Ga0070697_101924846 3300005536 Bacteria 529
16 Ga0068853_100913160 3300005539 Bacteria 844
17 Ga0070696_100039330 3300005546 Bacteria 3266
18 Ga0070693_100064126 3300005547 Bacteria 2143
19 Ga0070693_100712980 3300005547 Bacteria 736
20 Ga0070665_100121506 3300005548 Bacteria 2613
21 Ga0068855_100056659 3300005563 Bacteria 4598
22 Ga0070664_100005596 3300005564 Bacteria 10100
23 Ga0068854_101691964 3300005578 Bacteria 578
24 Ga0068859_100135761 3300005617 Bacteria 2533
25 Ga0068864_100203018 3300005618 Bacteria 1822
26 Ga0068864_100232459 3300005618 Bacteria 1706
27 Ga0068863_100267993 3300005841 Bacteria 1652
28 Ga0068860_102236801 3300005843 Bacteria 567
29 Ga0075366_10111080 3300006195 Bacteria 1649
30 Ga0075366_10829173 3300006195 Bacteria 575
31 Ga0075370_10211292 3300006353 Bacteria 1146
32 Ga0075428_101755609 3300006844 Bacteria 647
33 Ga0075434_100195293 3300006871 Bacteria 2044
34 Ga0075434_100803684 3300006871 Bacteria 957
35 Ga0075436_100908192 3300006914 Bacteria 659
36 Ga0097620_100135768 3300006931 Bacteria 2533
37 Ga0079104_1013050 3300006946 Bacteria 2581
38 Ga0105240_10390077 3300009093 Bacteria 1571
39 Ga0105245_10197988 3300009098 Bacteria 1928
40 Ga0105245_12663276 3300009098 Bacteria 553
41 Ga0114129_10781329 3300009147 Bacteria 1220
42 Ga0114129_13226100 3300009147 Bacteria 530
43 Ga0105243_12258272 3300009148 Bacteria 581
44 Ga0105241_10131178 3300009174 Bacteria 2029
45 Ga0105242_12045956 3300009176 Bacteria 616
46 Ga0105242_12067010 3300009176 Bacteria 613
47 Ga0105248_11161825 3300009177 Bacteria 873
48 Ga0105238_10955045 3300009551 Bacteria 877
49 Ga0105249_11551745 3300009553 Bacteria 735
50 Ga0105246_12023347 3300011119 Bacteria 556
51 Ga0157370_10064358 3300013104 Bacteria 3472
52 Ga0157378_10287522 3300013297 Bacteria 1587
53 Ga0163162_10511298 3300013306 Bacteria 1331
54 Ga0157372_10889466 3300013307 Bacteria 1033
55 Ga0157372_11063348 3300013307 Bacteria 937
56 Ga0157372_11115219 3300013307 Bacteria 913
57 Ga0157375_13441238 3300013308 Bacteria 527
58 Ga0163163_12122414 3300014325 Bacteria 621
59 Ga0157380_12384854 3300014326 Bacteria 594
60 Ga0157379_10227813 3300014968 Bacteria 1689
61 Ga0157379_10233346 3300014968 Bacteria 1668
62 Ga0157376_10472079 3300014969 Bacteria 1228
63 Ga0163161_10007196 3300017792 Bacteria 7692
64 Ga0207707_10063286 3300025912 Bacteria 3220
65 Ga0207695_10493464 3300025913 Bacteria 1107
66 Ga0207657_10001495 3300025919 Bacteria 25015
67 Ga0207649_10020127 3300025920 Bacteria 3822
68 Ga0207646_10382387 3300025922 Bacteria 1272
69 Ga0207650_10169816 3300025925 Bacteria 1733
70 Ga0207687_10198898 3300025927 Bacteria 1565
71 Ga0207644_10023313 3300025931 Bacteria 4238
72 Ga0207690_10000959 3300025932 Bacteria 18469
73 Ga0207706_10496666 3300025933 Bacteria 1053
74 Ga0207706_11010224 3300025933 Bacteria 698
75 Ga0207686_10409383 3300025934 Bacteria 1035
76 Ga0207709_11567325 3300025935 Bacteria 547
77 Ga0207679_10002718 3300025945 Bacteria 10935
78 Ga0207667_10019150 3300025949 Bacteria 7654
79 Ga0207677_11027929 3300026023 Bacteria 748
80 Ga0207703_10067259 3300026035 Bacteria 2949
81 Ga0207678_10952616 3300026067 Bacteria 759
82 Ga0207641_10297009 3300026088 Bacteria 1524
83 Ga0207676_10090662 3300026095 Bacteria 2509
84 Ga0207683_11851494 3300026121 Bacteria 552
85 Ga0207698_10297306 3300026142 Bacteria 1501
86 Ga0209281_1037060 3300027111 Bacteria 839
87 Ga0209967_1044635 3300027364 Bacteria 676
88 Ga0209999_1084179 3300027543 Bacteria 614
89 Ga0209970_1001181 3300027614 Bacteria 4591
90 Ga0209983_1004673 3300027665 Bacteria 2868
91 Ga0209974_10004577 3300027876 Bacteria 4918
92 Ga0268266_10981147 3300028379 Bacteria 817
93 Ga0268264_10214317 3300028381 Bacteria 1770
94 Ga0307517_10073423 3300028786 Bacteria 3032
95 Ga0307509_10186873 3300031507 Bacteria 1929
96 Ga0307509_10357489 3300031507 Bacteria 1181
97 Ga0316576_10831569 3300031727 Bacteria 664
98 Ga0316576_11261448 3300031727 Unclassified 521
99 Ga0316578_10194084 3300031728 Bacteria 1223
100 Ga0307405_10881906 3300031731 Bacteria 755
101 Ga0307410_10686337 3300031852 Bacteria 862
102 Ga0307407_11416340 3300031903 Bacteria 548
103 Ga0307412_10281388 3300031911 Bacteria 1306
104 Ga0307412_10447790 3300031911 Bacteria 1063
105 Ga0307409_100127952 3300031995 Bacteria 2164
106 Ga0307409_100400842 3300031995 Bacteria 1310
107 Ga0307416_100415923 3300032002 Bacteria 1387
108 Ga0307416_101097712 3300032002 Bacteria 900
109 Ga0307416_101515476 3300032002 Bacteria 776
110 Ga0316585_10078609 3300032137 Bacteria 1074
111 Ga0316593_10001899 3300032168 Bacteria 4793
112 Ga0316593_10387377 3300032168 Bacteria 539
113 Ga0316586_1038685 3300033527 Unclassified 834
114 Ga0316596_1000881 3300033541 Bacteria 5651
115 Ga0373928_0125286 3300035084 Bacteria 692
116 Ga0316574_0000085 3300035398 Bacteria 26529
117 Ga0373931_0048480 3300035691 Bacteria 2252
118 Ga0373937_0440679 3300036401 Bacteria 1237
119 Ga0316582_0002224 3300036647 Bacteria 9011
120 Ga0316582_0135300 3300036647 Bacteria 1658
121 Ga0316584_0163155 3300036712 Bacteria 1655
122 Ga0451843_0602173 3300041509 Bacteria 635
123 Ga0451855_0186774 3300041511 Bacteria 576
124 Ga0439441_006145 3300042001 Bacteria 1894
125 Ga0450921_030360 3300042123 Bacteria 549
126 Ga0450896_021278 3300042133 Bacteria 953
127 Ga0450898_028179 3300042134 Bacteria 1020
128 Ga0439458_0075490 3300042157 Bacteria 855
129 Ga0466972_0000140 3300044658 Bacteria 59505
130 Ga0466972_0147745 3300044658 Bacteria 1105
131 Ga0466972_0189621 3300044658 Bacteria 964
132 Ga0466965_0011760 3300044683 Bacteria 4108
133 Ga0466966_0050829 3300044684 Bacteria 2636
134 Ga0466966_0249215 3300044684 Bacteria 1070
135 Ga0466961_0346027 3300044693 Bacteria 905
136 Ga0466964_0014714 3300044706 Bacteria 2976
137 Ga0466964_0306266 3300044706 Bacteria 802
138 Ga0466968_0038579 3300044735 Bacteria 2007
139 Ga0466957_0004472 3300044842 Bacteria 7796
140 Ga0466957_0590009 3300044842 Bacteria 777
141 Ga0466960_0165878 3300044901 Bacteria 1189
142 Ga0466959_0194087 3300045049 Bacteria 1416
143 Ga0451576_1854134 3300045051 Bacteria 623
144 Ga0466958_0338140 3300045836 Bacteria 968
145 Ga0495664_0370635 3300046477 Bacteria 861
146 Ga0495632_0312768 3300046519 Bacteria 695
147 Ga0495586_0480203 3300046535 Bacteria 717
148 Ga0495597_0162519 3300046542 Bacteria 910
149 Ga0495668_0528899 3300046616 Bacteria 650
150 Ga0495611_0407472 3300046648 Bacteria 621
151 Ga0495646_0707710 3300046680 Bacteria 506
152 Ga0495675_0350777 3300047444 Bacteria 868
153 Ga0496109_0240948 3300048912 Bacteria 1702
154 Ga0496111_0262791 3300048914 Bacteria 1281
155 Ga0496112_0691999 3300048915 Bacteria 948
156 Ga0496115_0477306 3300048918 Bacteria 1004
157 Ga0501292_089351 3300049515 Bacteria 597
158 Ga0501318_066706 3300049534 Bacteria 562
159 Ga0501320_046268 3300049536 Bacteria 583
160 Ga0501326_03405 3300049542 Bacteria 814
161 Ga0501036_0231452 3300049572 Bacteria 1551
162 Ga0501036_1680710 3300049572 Bacteria 512
163 Ga0501039_0994109 3300049575 Bacteria 652
164 Ga0501047_0005455 3300049581 Bacteria 11968
165 Ga0501047_0911798 3300049581 Bacteria 692
166 Ga0501072_0157412 3300049588 Bacteria 1812
167 Ga0501072_0291595 3300049588 Bacteria 1297
168 Ga0501072_0759560 3300049588 Bacteria 760
169 Ga0501073_0210179 3300049589 Bacteria 1345
170 Ga0501074_0367848 3300049590 Bacteria 1020
171 Ga0501199_010595 3300049650 Bacteria 988
172 Ga0501233_137343 3300049668 Bacteria 673
173 Ga0501079_0810602 3300049741 Bacteria 737
174 Ga0501079_1301339 3300049741 Bacteria 572
175 Ga0501080_0564807 3300049742 Bacteria 1012
176 nmdc:mga0k408_112738_c1 3300050493 Bacteria 1608
177 nmdc:mga07m45_911349_c1 3300050496 Bacteria 503
178 nmdc:mga05p37_1248040_c1 3300050507 Bacteria 763
179 nmdc:mga0n895_282734_c1 3300050512 Bacteria 1682
180 nmdc:mga08x19_1059287_c1 3300050514 Bacteria 576
181 Ga0500607_007242 3300053121 Bacteria 6883
182 Ga0500559_0018535 3300053136 Bacteria 2941
183 Ga0500636_0000546 3300053177 Bacteria 20487
184 Ga0500637_0186649 3300053178 Bacteria 1186
185 Ga0500625_003794 3300053729 Bacteria 6042
186 Ga0501084_0021259 3300054114 Bacteria 5410
187 Ga0501084_1732059 3300054114 Bacteria 522
188 Ga0590077_126115 3300059426 Bacteria 607
189 Ga0587072_001765 3300059643 Bacteria 2769
190 Ga0466962_0440430 3300061719 Bacteria 655

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2526164512 2526214049 55
2 iso_pu_bacteria 2891633521 2891635727 55
3 iso_pu_bacteria 639633007 639788561 55
4 iso_pu_bacteria 2831864461 2831867519 56
5 iso_pu_bacteria 2886848708 2886854499 56
6 iso_pu_bacteria 2904479285 2904482745 56
7 3300005536 Ga0070697_101924846 Ga0070697_1019248462 57
8 3300006871 Ga0075434_100195293 Ga0075434_1001952933 57
9 3300006871 Ga0075434_100803684 Ga0075434_1008036842 57
10 3300006914 Ga0075436_100908192 Ga0075436_1009081922 57
11 3300009147 Ga0114129_10781329 Ga0114129_107813292 57
12 3300035084 Ga0373928_0125286 Ga0373928_0125286_39_215 57
13 3300048918 Ga0496115_0477306 Ga0496115_0477306_431_607 57
14 3300049515 Ga0501292_089351 Ga0501292_089351_208_387 57
15 3300049534 Ga0501318_066706 Ga0501318_066706_185_364 57
16 3300049536 Ga0501320_046268 Ga0501320_046268_69_245 57
17 3300049588 Ga0501072_0759560 Ga0501072_0759560_372_548 57
18 3300049650 Ga0501199_010595 Ga0501199_010595_242_421 57
19 3300049668 Ga0501233_137343 Ga0501233_137343_427_606 57
20 3300049741 Ga0501079_0810602 Ga0501079_0810602_150_326 57
21 3300050507 nmdc:mga05p37_1248040_c1 nmdc:mga05p37_1248040_c1_408_584 57
22 3300050512 nmdc:mga0n895_282734_c1 nmdc:mga0n895_282734_c1_396_572 57
23 3300050514 nmdc:mga08x19_1059287_c1 nmdc:mga08x19_1059287_c1_214_390 57
24 3300005339 Ga0070660_100001978 Ga0070660_1000019789 58
25 3300005344 Ga0070661_100008785 Ga0070661_10000878514 58
26 3300005366 Ga0070659_100004652 Ga0070659_10000465221 58
27 3300005457 Ga0070662_100274424 Ga0070662_1002744243 58
28 3300005564 Ga0070664_100005596 Ga0070664_10000559614 58
29 3300005578 Ga0068854_101691964 Ga0068854_1016919642 58
30 3300006946 Ga0079104_1013050 Ga0079104_10130504 58
31 3300017792 Ga0163161_10007196 Ga0163161_100071963 58
32 3300025919 Ga0207657_10001495 Ga0207657_1000149525 58
33 3300025920 Ga0207649_10020127 Ga0207649_100201275 58
34 3300025932 Ga0207690_10000959 Ga0207690_1000095921 58
35 3300025933 Ga0207706_10496666 Ga0207706_104966663 58
36 3300025945 Ga0207679_10002718 Ga0207679_1000271821 58
37 3300026067 Ga0207678_10952616 Ga0207678_109526162 58
38 3300027111 Ga0209281_1037060 Ga0209281_10370603 58
39 3300031727 Ga0316576_11261448 Ga0316576_112614481 58
40 3300032168 Ga0316593_10001899 Ga0316593_100018993 58
41 3300032168 Ga0316593_10387377 Ga0316593_103873772 58
42 3300033527 Ga0316586_1038685 Ga0316586_10386851 58
43 3300036647 Ga0316582_0135300 Ga0316582_0135300_723_905 58
44 3300042157 Ga0439458_0075490 Ga0439458_0075490_647_826 58
45 3300044658 Ga0466972_0000140 Ga0466972_0000140_57794_57973 58
46 3300044658 Ga0466972_0147745 Ga0466972_0147745_475_654 58
47 3300044658 Ga0466972_0189621 Ga0466972_0189621_25_204 58
48 3300044683 Ga0466965_0011760 Ga0466965_0011760_3456_3635 58
49 3300044706 Ga0466964_0014714 Ga0466964_0014714_1607_1786 58
50 3300044706 Ga0466964_0306266 Ga0466964_0306266_417_596 58
51 3300044735 Ga0466968_0038579 Ga0466968_0038579_1434_1613 58
52 3300044842 Ga0466957_0590009 Ga0466957_0590009_229_408 58
53 3300044901 Ga0466960_0165878 Ga0466960_0165878_148_327 58
54 3300046535 Ga0495586_0480203 Ga0495586_0480203_96_275 58
55 3300049581 Ga0501047_0911798 Ga0501047_0911798_152_331 58
56 3300049542 Ga0501326_03405 Ga0501326_03405_342_524 59
57 3300049589 Ga0501073_0210179 Ga0501073_0210179_395_577 59
58 3300053121 Ga0500607_007242 Ga0500607_007242_1021_1203 59
59 3300053136 Ga0500559_0018535 Ga0500559_0018535_255_437 59
60 3300053177 Ga0500636_0000546 Ga0500636_0000546_2255_2437 59
61 3300053178 Ga0500637_0186649 Ga0500637_0186649_417_599 59
62 3300053729 Ga0500625_003794 Ga0500625_003794_4893_5075 59
63 3300059643 Ga0587072_001765 Ga0587072_001765_521_703 59
64 3300005331 Ga0070670_100281674 Ga0070670_1002816743 60
65 3300005338 Ga0068868_100083822 Ga0068868_1000838223 60
66 3300005355 Ga0070671_100219851 Ga0070671_1002198514 60
67 3300005440 Ga0070705_100034427 Ga0070705_1000344274 60
68 3300005456 Ga0070678_101772830 Ga0070678_1017728302 60
69 3300005458 Ga0070681_10213518 Ga0070681_102135182 60
70 3300005468 Ga0070707_100416642 Ga0070707_1004166422 60
71 3300005518 Ga0070699_100751592 Ga0070699_1007515922 60
72 3300005518 Ga0070699_100932463 Ga0070699_1009324632 60
73 3300005536 Ga0070697_100381580 Ga0070697_1003815803 60
74 3300005539 Ga0068853_100913160 Ga0068853_1009131602 60
75 3300005546 Ga0070696_100039330 Ga0070696_1000393303 60
76 3300005547 Ga0070693_100064126 Ga0070693_1000641263 60
77 3300005547 Ga0070693_100712980 Ga0070693_1007129802 60
78 3300005548 Ga0070665_100121506 Ga0070665_1001215063 60
79 3300005563 Ga0068855_100056659 Ga0068855_1000566593 60
80 3300005617 Ga0068859_100135761 Ga0068859_1001357614 60
81 3300005618 Ga0068864_100203018 Ga0068864_1002030182 60
82 3300005618 Ga0068864_100232459 Ga0068864_1002324593 60
83 3300005841 Ga0068863_100267993 Ga0068863_1002679932 60
84 3300005843 Ga0068860_102236801 Ga0068860_1022368012 60
85 3300006195 Ga0075366_10111080 Ga0075366_101110804 60
86 3300006195 Ga0075366_10829173 Ga0075366_108291732 60
87 3300006353 Ga0075370_10211292 Ga0075370_102112922 60
88 3300006844 Ga0075428_101755609 Ga0075428_1017556092 60
89 3300006931 Ga0097620_100135768 Ga0097620_1001357683 60
90 3300009093 Ga0105240_10390077 Ga0105240_103900773 60
91 3300009098 Ga0105245_10197988 Ga0105245_101979883 60
92 3300009098 Ga0105245_12663276 Ga0105245_126632762 60
93 3300009147 Ga0114129_13226100 Ga0114129_132261001 60
94 3300009148 Ga0105243_12258272 Ga0105243_122582722 60
95 3300009174 Ga0105241_10131178 Ga0105241_101311783 60
96 3300009176 Ga0105242_12045956 Ga0105242_120459562 60
97 3300009176 Ga0105242_12067010 Ga0105242_120670102 60
98 3300009177 Ga0105248_11161825 Ga0105248_111618252 60
99 3300009551 Ga0105238_10955045 Ga0105238_109550452 60
100 3300009553 Ga0105249_11551745 Ga0105249_115517452 60
101 3300011119 Ga0105246_12023347 Ga0105246_120233472 60
102 3300013104 Ga0157370_10064358 Ga0157370_100643584 60
103 3300013297 Ga0157378_10287522 Ga0157378_102875223 60
104 3300013306 Ga0163162_10511298 Ga0163162_105112982 60
105 3300013307 Ga0157372_10889466 Ga0157372_108894662 60
106 3300013307 Ga0157372_11063348 Ga0157372_110633482 60
107 3300013307 Ga0157372_11115219 Ga0157372_111152191 60
108 3300013308 Ga0157375_13441238 Ga0157375_134412382 60
109 3300014325 Ga0163163_12122414 Ga0163163_121224142 60
110 3300014326 Ga0157380_12384854 Ga0157380_123848542 60
111 3300014968 Ga0157379_10227813 Ga0157379_102278133 60
112 3300014968 Ga0157379_10233346 Ga0157379_102333464 60
113 3300014969 Ga0157376_10472079 Ga0157376_104720793 60
114 3300025912 Ga0207707_10063286 Ga0207707_100632864 60
115 3300025913 Ga0207695_10493464 Ga0207695_104934642 60
116 3300025922 Ga0207646_10382387 Ga0207646_103823872 60
117 3300025925 Ga0207650_10169816 Ga0207650_101698163 60
118 3300025927 Ga0207687_10198898 Ga0207687_101988983 60
119 3300025931 Ga0207644_10023313 Ga0207644_100233132 60
120 3300025933 Ga0207706_11010224 Ga0207706_110102241 60
121 3300025934 Ga0207686_10409383 Ga0207686_104093833 60
122 3300025935 Ga0207709_11567325 Ga0207709_115673252 60
123 3300025949 Ga0207667_10019150 Ga0207667_100191503 60
124 3300026023 Ga0207677_11027929 Ga0207677_110279292 60
125 3300026035 Ga0207703_10067259 Ga0207703_100672592 60
126 3300026088 Ga0207641_10297009 Ga0207641_102970093 60
127 3300026095 Ga0207676_10090662 Ga0207676_100906625 60
128 3300026121 Ga0207683_11851494 Ga0207683_118514942 60
129 3300026142 Ga0207698_10297306 Ga0207698_102973064 60
130 3300027364 Ga0209967_1044635 Ga0209967_10446352 60
131 3300027543 Ga0209999_1084179 Ga0209999_10841792 60
132 3300027614 Ga0209970_1001181 Ga0209970_10011813 60
133 3300027665 Ga0209983_1004673 Ga0209983_10046734 60
134 3300027876 Ga0209974_10004577 Ga0209974_100045773 60
135 3300028379 Ga0268266_10981147 Ga0268266_109811472 60
136 3300028381 Ga0268264_10214317 Ga0268264_102143172 60
137 3300028786 Ga0307517_10073423 Ga0307517_100734234 60
138 3300031507 Ga0307509_10186873 Ga0307509_101868733 60
139 3300031507 Ga0307509_10357489 Ga0307509_103574892 60
140 3300031727 Ga0316576_10831569 Ga0316576_108315692 60
141 3300031728 Ga0316578_10194084 Ga0316578_101940841 60
142 3300031731 Ga0307405_10881906 Ga0307405_108819062 60
143 3300031852 Ga0307410_10686337 Ga0307410_106863372 60
144 3300031903 Ga0307407_11416340 Ga0307407_114163402 60
145 3300031911 Ga0307412_10281388 Ga0307412_102813882 60
146 3300031911 Ga0307412_10447790 Ga0307412_104477902 60
147 3300031995 Ga0307409_100127952 Ga0307409_1001279522 60
148 3300031995 Ga0307409_100400842 Ga0307409_1004008423 60
149 3300032002 Ga0307416_100415923 Ga0307416_1004159232 60
150 3300032002 Ga0307416_101097712 Ga0307416_1010977121 60
151 3300032002 Ga0307416_101515476 Ga0307416_1015154762 60
152 3300032137 Ga0316585_10078609 Ga0316585_100786092 60
153 3300033541 Ga0316596_1000881 Ga0316596_10008812 60
154 3300035398 Ga0316574_0000085 Ga0316574_0000085_9383_9568 60
155 3300035691 Ga0373931_0048480 Ga0373931_0048480_1350_1559 60
156 3300036401 Ga0373937_0440679 Ga0373937_0440679_237_443 60
157 3300036647 Ga0316582_0002224 Ga0316582_0002224_3138_3323 60
158 3300036712 Ga0316584_0163155 Ga0316584_0163155_456_641 60
159 3300041509 Ga0451843_0602173 Ga0451843_0602173_306_488 60
160 3300041511 Ga0451855_0186774 Ga0451855_0186774_70_252 60
161 3300042001 Ga0439441_006145 Ga0439441_006145_102_308 60
162 3300042123 Ga0450921_030360 Ga0450921_030360_153_344 60
163 3300042133 Ga0450896_021278 Ga0450896_021278_424_615 60
164 3300042134 Ga0450898_028179 Ga0450898_028179_592_783 60
165 3300044684 Ga0466966_0050829 Ga0466966_0050829_1383_1571 60
166 3300044684 Ga0466966_0249215 Ga0466966_0249215_822_1025 60
167 3300044693 Ga0466961_0346027 Ga0466961_0346027_335_523 60
168 3300044842 Ga0466957_0004472 Ga0466957_0004472_2015_2203 60
169 3300045049 Ga0466959_0194087 Ga0466959_0194087_214_402 60
170 3300045051 Ga0451576_1854134 Ga0451576_1854134_154_342 60
171 3300045836 Ga0466958_0338140 Ga0466958_0338140_385_573 60
172 3300046477 Ga0495664_0370635 Ga0495664_0370635_223_429 60
173 3300046519 Ga0495632_0312768 Ga0495632_0312768_192_374 60
174 3300046542 Ga0495597_0162519 Ga0495597_0162519_409_597 60
175 3300046616 Ga0495668_0528899 Ga0495668_0528899_355_537 60
176 3300046648 Ga0495611_0407472 Ga0495611_0407472_185_367 60
177 3300046680 Ga0495646_0707710 Ga0495646_0707710_49_255 60
178 3300047444 Ga0495675_0350777 Ga0495675_0350777_626_832 60
179 3300048912 Ga0496109_0240948 Ga0496109_0240948_1358_1540 60
180 3300048914 Ga0496111_0262791 Ga0496111_0262791_248_430 60
181 3300048915 Ga0496112_0691999 Ga0496112_0691999_25_231 60
182 3300049572 Ga0501036_0231452 Ga0501036_0231452_913_1098 60
183 3300049572 Ga0501036_1680710 Ga0501036_1680710_154_339 60
184 3300049575 Ga0501039_0994109 Ga0501039_0994109_15_200 60
185 3300049581 Ga0501047_0005455 Ga0501047_0005455_256_441 60
186 3300049588 Ga0501072_0157412 Ga0501072_0157412_1353_1538 60
187 3300049588 Ga0501072_0291595 Ga0501072_0291595_187_375 60
188 3300049590 Ga0501074_0367848 Ga0501074_0367848_303_488 60
189 3300049741 Ga0501079_1301339 Ga0501079_1301339_136_321 60
190 3300049742 Ga0501080_0564807 Ga0501080_0564807_87_272 60
191 3300050493 nmdc:mga0k408_112738_c1 nmdc:mga0k408_112738_c1_168_350 60
192 3300050496 nmdc:mga07m45_911349_c1 nmdc:mga07m45_911349_c1_20_202 60
193 3300054114 Ga0501084_0021259 Ga0501084_0021259_1823_2008 60
194 3300054114 Ga0501084_1732059 Ga0501084_1732059_186_371 60
195 3300059426 Ga0590077_126115 Ga0590077_126115_174_359 60
196 3300061719 Ga0466962_0440430 Ga0466962_0440430_153_341 60

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

15

65

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g34-assembly1.cif.gz_Z time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate 0.9956 5 59
6ogf-assembly1.cif.gz_z 70s termination complex with rf2 bound to the uga codon. partially rotated ribosome with rf2 bound (structure iii). 0.9924 5 60
6enu-assembly1.cif.gz_Z polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.991 5 60
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9902 7 60
4v9p-assembly1.cif.gz_AZ control of ribosomal subunit rotation by elongation factor g 0.9892 6 60
ID Description Score Start End Superfamily
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9908 5 60 3.30.1390.20
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9892 5 60 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9884 5 60 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9877 5 60 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9863 7 60 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A5C9C4K1-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 1.01 5 60 GO:0003735
GO:0005737
GO:0006412
GO:0015934
GO:0015935
GO:0019843
AF-A0A6B0Z3A2-F1-model_v4 Large ribosomal subunit protein uL30 1.01 5 60 GO:0003735
GO:0006412
GO:0022625
AF-A0A5J4SI69-F1-model_v4 50S ribosomal protein L30 1.01 5 60 GO:0003735
GO:0006412
GO:0022625
AF-A0A845CXN1-F1-model_v4 Large ribosomal subunit protein uL30 1.009 6 60 GO:0003735
GO:0006412
GO:0022625
AF-A0A443YTC8-F1-model_v4 50S ribosomal protein L30 1.009 5 60 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.11 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map