F301244
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 196 | 164 | 190 | 61 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100913160|Ga0068853_1009131602 |
| Length | 69 |
| Sequence | MSDKQKKPAGSGKKIRVTLVKGLVGTIGKHRESVRGLGLRHREHTVELVDTPAVRGMINRVSYLVKVEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 3 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 4 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 5 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 87 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 88 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 89 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 90 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 92 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 97 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 107 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 108 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 109 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 110 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 111 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 112 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 113 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 121 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 122 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 137 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 147 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 151 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 152 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 156 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 157 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 158 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 159 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 160 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 162 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 164 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 4.08 |
| Isolates | 3.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.1 |
| Nodule | 1.53 |
| Rhizoplane | 2.04 |
| Rhizosphere | 87.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100281674 | 3300005331 | Bacteria | 1451 |
| 2 | Ga0068868_100083822 | 3300005338 | Bacteria | 2560 |
| 3 | Ga0070660_100001978 | 3300005339 | Bacteria | 14153 |
| 4 | Ga0070661_100008785 | 3300005344 | Bacteria | 6991 |
| 5 | Ga0070671_100219851 | 3300005355 | Bacteria | 1612 |
| 6 | Ga0070659_100004652 | 3300005366 | Bacteria | 9804 |
| 7 | Ga0070705_100034427 | 3300005440 | Bacteria | 2832 |
| 8 | Ga0070678_101772830 | 3300005456 | Bacteria | 582 |
| 9 | Ga0070662_100274424 | 3300005457 | Bacteria | 1362 |
| 10 | Ga0070681_10213518 | 3300005458 | Bacteria | 1846 |
| 11 | Ga0070707_100416642 | 3300005468 | Bacteria | 1304 |
| 12 | Ga0070699_100751592 | 3300005518 | Bacteria | 892 |
| 13 | Ga0070699_100932463 | 3300005518 | Bacteria | 795 |
| 14 | Ga0070697_100381580 | 3300005536 | Bacteria | 1221 |
| 15 | Ga0070697_101924846 | 3300005536 | Bacteria | 529 |
| 16 | Ga0068853_100913160 | 3300005539 | Bacteria | 844 |
| 17 | Ga0070696_100039330 | 3300005546 | Bacteria | 3266 |
| 18 | Ga0070693_100064126 | 3300005547 | Bacteria | 2143 |
| 19 | Ga0070693_100712980 | 3300005547 | Bacteria | 736 |
| 20 | Ga0070665_100121506 | 3300005548 | Bacteria | 2613 |
| 21 | Ga0068855_100056659 | 3300005563 | Bacteria | 4598 |
| 22 | Ga0070664_100005596 | 3300005564 | Bacteria | 10100 |
| 23 | Ga0068854_101691964 | 3300005578 | Bacteria | 578 |
| 24 | Ga0068859_100135761 | 3300005617 | Bacteria | 2533 |
| 25 | Ga0068864_100203018 | 3300005618 | Bacteria | 1822 |
| 26 | Ga0068864_100232459 | 3300005618 | Bacteria | 1706 |
| 27 | Ga0068863_100267993 | 3300005841 | Bacteria | 1652 |
| 28 | Ga0068860_102236801 | 3300005843 | Bacteria | 567 |
| 29 | Ga0075366_10111080 | 3300006195 | Bacteria | 1649 |
| 30 | Ga0075366_10829173 | 3300006195 | Bacteria | 575 |
| 31 | Ga0075370_10211292 | 3300006353 | Bacteria | 1146 |
| 32 | Ga0075428_101755609 | 3300006844 | Bacteria | 647 |
| 33 | Ga0075434_100195293 | 3300006871 | Bacteria | 2044 |
| 34 | Ga0075434_100803684 | 3300006871 | Bacteria | 957 |
| 35 | Ga0075436_100908192 | 3300006914 | Bacteria | 659 |
| 36 | Ga0097620_100135768 | 3300006931 | Bacteria | 2533 |
| 37 | Ga0079104_1013050 | 3300006946 | Bacteria | 2581 |
| 38 | Ga0105240_10390077 | 3300009093 | Bacteria | 1571 |
| 39 | Ga0105245_10197988 | 3300009098 | Bacteria | 1928 |
| 40 | Ga0105245_12663276 | 3300009098 | Bacteria | 553 |
| 41 | Ga0114129_10781329 | 3300009147 | Bacteria | 1220 |
| 42 | Ga0114129_13226100 | 3300009147 | Bacteria | 530 |
| 43 | Ga0105243_12258272 | 3300009148 | Bacteria | 581 |
| 44 | Ga0105241_10131178 | 3300009174 | Bacteria | 2029 |
| 45 | Ga0105242_12045956 | 3300009176 | Bacteria | 616 |
| 46 | Ga0105242_12067010 | 3300009176 | Bacteria | 613 |
| 47 | Ga0105248_11161825 | 3300009177 | Bacteria | 873 |
| 48 | Ga0105238_10955045 | 3300009551 | Bacteria | 877 |
| 49 | Ga0105249_11551745 | 3300009553 | Bacteria | 735 |
| 50 | Ga0105246_12023347 | 3300011119 | Bacteria | 556 |
| 51 | Ga0157370_10064358 | 3300013104 | Bacteria | 3472 |
| 52 | Ga0157378_10287522 | 3300013297 | Bacteria | 1587 |
| 53 | Ga0163162_10511298 | 3300013306 | Bacteria | 1331 |
| 54 | Ga0157372_10889466 | 3300013307 | Bacteria | 1033 |
| 55 | Ga0157372_11063348 | 3300013307 | Bacteria | 937 |
| 56 | Ga0157372_11115219 | 3300013307 | Bacteria | 913 |
| 57 | Ga0157375_13441238 | 3300013308 | Bacteria | 527 |
| 58 | Ga0163163_12122414 | 3300014325 | Bacteria | 621 |
| 59 | Ga0157380_12384854 | 3300014326 | Bacteria | 594 |
| 60 | Ga0157379_10227813 | 3300014968 | Bacteria | 1689 |
| 61 | Ga0157379_10233346 | 3300014968 | Bacteria | 1668 |
| 62 | Ga0157376_10472079 | 3300014969 | Bacteria | 1228 |
| 63 | Ga0163161_10007196 | 3300017792 | Bacteria | 7692 |
| 64 | Ga0207707_10063286 | 3300025912 | Bacteria | 3220 |
| 65 | Ga0207695_10493464 | 3300025913 | Bacteria | 1107 |
| 66 | Ga0207657_10001495 | 3300025919 | Bacteria | 25015 |
| 67 | Ga0207649_10020127 | 3300025920 | Bacteria | 3822 |
| 68 | Ga0207646_10382387 | 3300025922 | Bacteria | 1272 |
| 69 | Ga0207650_10169816 | 3300025925 | Bacteria | 1733 |
| 70 | Ga0207687_10198898 | 3300025927 | Bacteria | 1565 |
| 71 | Ga0207644_10023313 | 3300025931 | Bacteria | 4238 |
| 72 | Ga0207690_10000959 | 3300025932 | Bacteria | 18469 |
| 73 | Ga0207706_10496666 | 3300025933 | Bacteria | 1053 |
| 74 | Ga0207706_11010224 | 3300025933 | Bacteria | 698 |
| 75 | Ga0207686_10409383 | 3300025934 | Bacteria | 1035 |
| 76 | Ga0207709_11567325 | 3300025935 | Bacteria | 547 |
| 77 | Ga0207679_10002718 | 3300025945 | Bacteria | 10935 |
| 78 | Ga0207667_10019150 | 3300025949 | Bacteria | 7654 |
| 79 | Ga0207677_11027929 | 3300026023 | Bacteria | 748 |
| 80 | Ga0207703_10067259 | 3300026035 | Bacteria | 2949 |
| 81 | Ga0207678_10952616 | 3300026067 | Bacteria | 759 |
| 82 | Ga0207641_10297009 | 3300026088 | Bacteria | 1524 |
| 83 | Ga0207676_10090662 | 3300026095 | Bacteria | 2509 |
| 84 | Ga0207683_11851494 | 3300026121 | Bacteria | 552 |
| 85 | Ga0207698_10297306 | 3300026142 | Bacteria | 1501 |
| 86 | Ga0209281_1037060 | 3300027111 | Bacteria | 839 |
| 87 | Ga0209967_1044635 | 3300027364 | Bacteria | 676 |
| 88 | Ga0209999_1084179 | 3300027543 | Bacteria | 614 |
| 89 | Ga0209970_1001181 | 3300027614 | Bacteria | 4591 |
| 90 | Ga0209983_1004673 | 3300027665 | Bacteria | 2868 |
| 91 | Ga0209974_10004577 | 3300027876 | Bacteria | 4918 |
| 92 | Ga0268266_10981147 | 3300028379 | Bacteria | 817 |
| 93 | Ga0268264_10214317 | 3300028381 | Bacteria | 1770 |
| 94 | Ga0307517_10073423 | 3300028786 | Bacteria | 3032 |
| 95 | Ga0307509_10186873 | 3300031507 | Bacteria | 1929 |
| 96 | Ga0307509_10357489 | 3300031507 | Bacteria | 1181 |
| 97 | Ga0316576_10831569 | 3300031727 | Bacteria | 664 |
| 98 | Ga0316576_11261448 | 3300031727 | Unclassified | 521 |
| 99 | Ga0316578_10194084 | 3300031728 | Bacteria | 1223 |
| 100 | Ga0307405_10881906 | 3300031731 | Bacteria | 755 |
| 101 | Ga0307410_10686337 | 3300031852 | Bacteria | 862 |
| 102 | Ga0307407_11416340 | 3300031903 | Bacteria | 548 |
| 103 | Ga0307412_10281388 | 3300031911 | Bacteria | 1306 |
| 104 | Ga0307412_10447790 | 3300031911 | Bacteria | 1063 |
| 105 | Ga0307409_100127952 | 3300031995 | Bacteria | 2164 |
| 106 | Ga0307409_100400842 | 3300031995 | Bacteria | 1310 |
| 107 | Ga0307416_100415923 | 3300032002 | Bacteria | 1387 |
| 108 | Ga0307416_101097712 | 3300032002 | Bacteria | 900 |
| 109 | Ga0307416_101515476 | 3300032002 | Bacteria | 776 |
| 110 | Ga0316585_10078609 | 3300032137 | Bacteria | 1074 |
| 111 | Ga0316593_10001899 | 3300032168 | Bacteria | 4793 |
| 112 | Ga0316593_10387377 | 3300032168 | Bacteria | 539 |
| 113 | Ga0316586_1038685 | 3300033527 | Unclassified | 834 |
| 114 | Ga0316596_1000881 | 3300033541 | Bacteria | 5651 |
| 115 | Ga0373928_0125286 | 3300035084 | Bacteria | 692 |
| 116 | Ga0316574_0000085 | 3300035398 | Bacteria | 26529 |
| 117 | Ga0373931_0048480 | 3300035691 | Bacteria | 2252 |
| 118 | Ga0373937_0440679 | 3300036401 | Bacteria | 1237 |
| 119 | Ga0316582_0002224 | 3300036647 | Bacteria | 9011 |
| 120 | Ga0316582_0135300 | 3300036647 | Bacteria | 1658 |
| 121 | Ga0316584_0163155 | 3300036712 | Bacteria | 1655 |
| 122 | Ga0451843_0602173 | 3300041509 | Bacteria | 635 |
| 123 | Ga0451855_0186774 | 3300041511 | Bacteria | 576 |
| 124 | Ga0439441_006145 | 3300042001 | Bacteria | 1894 |
| 125 | Ga0450921_030360 | 3300042123 | Bacteria | 549 |
| 126 | Ga0450896_021278 | 3300042133 | Bacteria | 953 |
| 127 | Ga0450898_028179 | 3300042134 | Bacteria | 1020 |
| 128 | Ga0439458_0075490 | 3300042157 | Bacteria | 855 |
| 129 | Ga0466972_0000140 | 3300044658 | Bacteria | 59505 |
| 130 | Ga0466972_0147745 | 3300044658 | Bacteria | 1105 |
| 131 | Ga0466972_0189621 | 3300044658 | Bacteria | 964 |
| 132 | Ga0466965_0011760 | 3300044683 | Bacteria | 4108 |
| 133 | Ga0466966_0050829 | 3300044684 | Bacteria | 2636 |
| 134 | Ga0466966_0249215 | 3300044684 | Bacteria | 1070 |
| 135 | Ga0466961_0346027 | 3300044693 | Bacteria | 905 |
| 136 | Ga0466964_0014714 | 3300044706 | Bacteria | 2976 |
| 137 | Ga0466964_0306266 | 3300044706 | Bacteria | 802 |
| 138 | Ga0466968_0038579 | 3300044735 | Bacteria | 2007 |
| 139 | Ga0466957_0004472 | 3300044842 | Bacteria | 7796 |
| 140 | Ga0466957_0590009 | 3300044842 | Bacteria | 777 |
| 141 | Ga0466960_0165878 | 3300044901 | Bacteria | 1189 |
| 142 | Ga0466959_0194087 | 3300045049 | Bacteria | 1416 |
| 143 | Ga0451576_1854134 | 3300045051 | Bacteria | 623 |
| 144 | Ga0466958_0338140 | 3300045836 | Bacteria | 968 |
| 145 | Ga0495664_0370635 | 3300046477 | Bacteria | 861 |
| 146 | Ga0495632_0312768 | 3300046519 | Bacteria | 695 |
| 147 | Ga0495586_0480203 | 3300046535 | Bacteria | 717 |
| 148 | Ga0495597_0162519 | 3300046542 | Bacteria | 910 |
| 149 | Ga0495668_0528899 | 3300046616 | Bacteria | 650 |
| 150 | Ga0495611_0407472 | 3300046648 | Bacteria | 621 |
| 151 | Ga0495646_0707710 | 3300046680 | Bacteria | 506 |
| 152 | Ga0495675_0350777 | 3300047444 | Bacteria | 868 |
| 153 | Ga0496109_0240948 | 3300048912 | Bacteria | 1702 |
| 154 | Ga0496111_0262791 | 3300048914 | Bacteria | 1281 |
| 155 | Ga0496112_0691999 | 3300048915 | Bacteria | 948 |
| 156 | Ga0496115_0477306 | 3300048918 | Bacteria | 1004 |
| 157 | Ga0501292_089351 | 3300049515 | Bacteria | 597 |
| 158 | Ga0501318_066706 | 3300049534 | Bacteria | 562 |
| 159 | Ga0501320_046268 | 3300049536 | Bacteria | 583 |
| 160 | Ga0501326_03405 | 3300049542 | Bacteria | 814 |
| 161 | Ga0501036_0231452 | 3300049572 | Bacteria | 1551 |
| 162 | Ga0501036_1680710 | 3300049572 | Bacteria | 512 |
| 163 | Ga0501039_0994109 | 3300049575 | Bacteria | 652 |
| 164 | Ga0501047_0005455 | 3300049581 | Bacteria | 11968 |
| 165 | Ga0501047_0911798 | 3300049581 | Bacteria | 692 |
| 166 | Ga0501072_0157412 | 3300049588 | Bacteria | 1812 |
| 167 | Ga0501072_0291595 | 3300049588 | Bacteria | 1297 |
| 168 | Ga0501072_0759560 | 3300049588 | Bacteria | 760 |
| 169 | Ga0501073_0210179 | 3300049589 | Bacteria | 1345 |
| 170 | Ga0501074_0367848 | 3300049590 | Bacteria | 1020 |
| 171 | Ga0501199_010595 | 3300049650 | Bacteria | 988 |
| 172 | Ga0501233_137343 | 3300049668 | Bacteria | 673 |
| 173 | Ga0501079_0810602 | 3300049741 | Bacteria | 737 |
| 174 | Ga0501079_1301339 | 3300049741 | Bacteria | 572 |
| 175 | Ga0501080_0564807 | 3300049742 | Bacteria | 1012 |
| 176 | nmdc:mga0k408_112738_c1 | 3300050493 | Bacteria | 1608 |
| 177 | nmdc:mga07m45_911349_c1 | 3300050496 | Bacteria | 503 |
| 178 | nmdc:mga05p37_1248040_c1 | 3300050507 | Bacteria | 763 |
| 179 | nmdc:mga0n895_282734_c1 | 3300050512 | Bacteria | 1682 |
| 180 | nmdc:mga08x19_1059287_c1 | 3300050514 | Bacteria | 576 |
| 181 | Ga0500607_007242 | 3300053121 | Bacteria | 6883 |
| 182 | Ga0500559_0018535 | 3300053136 | Bacteria | 2941 |
| 183 | Ga0500636_0000546 | 3300053177 | Bacteria | 20487 |
| 184 | Ga0500637_0186649 | 3300053178 | Bacteria | 1186 |
| 185 | Ga0500625_003794 | 3300053729 | Bacteria | 6042 |
| 186 | Ga0501084_0021259 | 3300054114 | Bacteria | 5410 |
| 187 | Ga0501084_1732059 | 3300054114 | Bacteria | 522 |
| 188 | Ga0590077_126115 | 3300059426 | Bacteria | 607 |
| 189 | Ga0587072_001765 | 3300059643 | Bacteria | 2769 |
| 190 | Ga0466962_0440430 | 3300061719 | Bacteria | 655 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2526164512 | 2526214049 | 55 |
| 2 | iso_pu_bacteria | 2891633521 | 2891635727 | 55 |
| 3 | iso_pu_bacteria | 639633007 | 639788561 | 55 |
| 4 | iso_pu_bacteria | 2831864461 | 2831867519 | 56 |
| 5 | iso_pu_bacteria | 2886848708 | 2886854499 | 56 |
| 6 | iso_pu_bacteria | 2904479285 | 2904482745 | 56 |
| 7 | 3300005536 | Ga0070697_101924846 | Ga0070697_1019248462 | 57 |
| 8 | 3300006871 | Ga0075434_100195293 | Ga0075434_1001952933 | 57 |
| 9 | 3300006871 | Ga0075434_100803684 | Ga0075434_1008036842 | 57 |
| 10 | 3300006914 | Ga0075436_100908192 | Ga0075436_1009081922 | 57 |
| 11 | 3300009147 | Ga0114129_10781329 | Ga0114129_107813292 | 57 |
| 12 | 3300035084 | Ga0373928_0125286 | Ga0373928_0125286_39_215 | 57 |
| 13 | 3300048918 | Ga0496115_0477306 | Ga0496115_0477306_431_607 | 57 |
| 14 | 3300049515 | Ga0501292_089351 | Ga0501292_089351_208_387 | 57 |
| 15 | 3300049534 | Ga0501318_066706 | Ga0501318_066706_185_364 | 57 |
| 16 | 3300049536 | Ga0501320_046268 | Ga0501320_046268_69_245 | 57 |
| 17 | 3300049588 | Ga0501072_0759560 | Ga0501072_0759560_372_548 | 57 |
| 18 | 3300049650 | Ga0501199_010595 | Ga0501199_010595_242_421 | 57 |
| 19 | 3300049668 | Ga0501233_137343 | Ga0501233_137343_427_606 | 57 |
| 20 | 3300049741 | Ga0501079_0810602 | Ga0501079_0810602_150_326 | 57 |
| 21 | 3300050507 | nmdc:mga05p37_1248040_c1 | nmdc:mga05p37_1248040_c1_408_584 | 57 |
| 22 | 3300050512 | nmdc:mga0n895_282734_c1 | nmdc:mga0n895_282734_c1_396_572 | 57 |
| 23 | 3300050514 | nmdc:mga08x19_1059287_c1 | nmdc:mga08x19_1059287_c1_214_390 | 57 |
| 24 | 3300005339 | Ga0070660_100001978 | Ga0070660_1000019789 | 58 |
| 25 | 3300005344 | Ga0070661_100008785 | Ga0070661_10000878514 | 58 |
| 26 | 3300005366 | Ga0070659_100004652 | Ga0070659_10000465221 | 58 |
| 27 | 3300005457 | Ga0070662_100274424 | Ga0070662_1002744243 | 58 |
| 28 | 3300005564 | Ga0070664_100005596 | Ga0070664_10000559614 | 58 |
| 29 | 3300005578 | Ga0068854_101691964 | Ga0068854_1016919642 | 58 |
| 30 | 3300006946 | Ga0079104_1013050 | Ga0079104_10130504 | 58 |
| 31 | 3300017792 | Ga0163161_10007196 | Ga0163161_100071963 | 58 |
| 32 | 3300025919 | Ga0207657_10001495 | Ga0207657_1000149525 | 58 |
| 33 | 3300025920 | Ga0207649_10020127 | Ga0207649_100201275 | 58 |
| 34 | 3300025932 | Ga0207690_10000959 | Ga0207690_1000095921 | 58 |
| 35 | 3300025933 | Ga0207706_10496666 | Ga0207706_104966663 | 58 |
| 36 | 3300025945 | Ga0207679_10002718 | Ga0207679_1000271821 | 58 |
| 37 | 3300026067 | Ga0207678_10952616 | Ga0207678_109526162 | 58 |
| 38 | 3300027111 | Ga0209281_1037060 | Ga0209281_10370603 | 58 |
| 39 | 3300031727 | Ga0316576_11261448 | Ga0316576_112614481 | 58 |
| 40 | 3300032168 | Ga0316593_10001899 | Ga0316593_100018993 | 58 |
| 41 | 3300032168 | Ga0316593_10387377 | Ga0316593_103873772 | 58 |
| 42 | 3300033527 | Ga0316586_1038685 | Ga0316586_10386851 | 58 |
| 43 | 3300036647 | Ga0316582_0135300 | Ga0316582_0135300_723_905 | 58 |
| 44 | 3300042157 | Ga0439458_0075490 | Ga0439458_0075490_647_826 | 58 |
| 45 | 3300044658 | Ga0466972_0000140 | Ga0466972_0000140_57794_57973 | 58 |
| 46 | 3300044658 | Ga0466972_0147745 | Ga0466972_0147745_475_654 | 58 |
| 47 | 3300044658 | Ga0466972_0189621 | Ga0466972_0189621_25_204 | 58 |
| 48 | 3300044683 | Ga0466965_0011760 | Ga0466965_0011760_3456_3635 | 58 |
| 49 | 3300044706 | Ga0466964_0014714 | Ga0466964_0014714_1607_1786 | 58 |
| 50 | 3300044706 | Ga0466964_0306266 | Ga0466964_0306266_417_596 | 58 |
| 51 | 3300044735 | Ga0466968_0038579 | Ga0466968_0038579_1434_1613 | 58 |
| 52 | 3300044842 | Ga0466957_0590009 | Ga0466957_0590009_229_408 | 58 |
| 53 | 3300044901 | Ga0466960_0165878 | Ga0466960_0165878_148_327 | 58 |
| 54 | 3300046535 | Ga0495586_0480203 | Ga0495586_0480203_96_275 | 58 |
| 55 | 3300049581 | Ga0501047_0911798 | Ga0501047_0911798_152_331 | 58 |
| 56 | 3300049542 | Ga0501326_03405 | Ga0501326_03405_342_524 | 59 |
| 57 | 3300049589 | Ga0501073_0210179 | Ga0501073_0210179_395_577 | 59 |
| 58 | 3300053121 | Ga0500607_007242 | Ga0500607_007242_1021_1203 | 59 |
| 59 | 3300053136 | Ga0500559_0018535 | Ga0500559_0018535_255_437 | 59 |
| 60 | 3300053177 | Ga0500636_0000546 | Ga0500636_0000546_2255_2437 | 59 |
| 61 | 3300053178 | Ga0500637_0186649 | Ga0500637_0186649_417_599 | 59 |
| 62 | 3300053729 | Ga0500625_003794 | Ga0500625_003794_4893_5075 | 59 |
| 63 | 3300059643 | Ga0587072_001765 | Ga0587072_001765_521_703 | 59 |
| 64 | 3300005331 | Ga0070670_100281674 | Ga0070670_1002816743 | 60 |
| 65 | 3300005338 | Ga0068868_100083822 | Ga0068868_1000838223 | 60 |
| 66 | 3300005355 | Ga0070671_100219851 | Ga0070671_1002198514 | 60 |
| 67 | 3300005440 | Ga0070705_100034427 | Ga0070705_1000344274 | 60 |
| 68 | 3300005456 | Ga0070678_101772830 | Ga0070678_1017728302 | 60 |
| 69 | 3300005458 | Ga0070681_10213518 | Ga0070681_102135182 | 60 |
| 70 | 3300005468 | Ga0070707_100416642 | Ga0070707_1004166422 | 60 |
| 71 | 3300005518 | Ga0070699_100751592 | Ga0070699_1007515922 | 60 |
| 72 | 3300005518 | Ga0070699_100932463 | Ga0070699_1009324632 | 60 |
| 73 | 3300005536 | Ga0070697_100381580 | Ga0070697_1003815803 | 60 |
| 74 | 3300005539 | Ga0068853_100913160 | Ga0068853_1009131602 | 60 |
| 75 | 3300005546 | Ga0070696_100039330 | Ga0070696_1000393303 | 60 |
| 76 | 3300005547 | Ga0070693_100064126 | Ga0070693_1000641263 | 60 |
| 77 | 3300005547 | Ga0070693_100712980 | Ga0070693_1007129802 | 60 |
| 78 | 3300005548 | Ga0070665_100121506 | Ga0070665_1001215063 | 60 |
| 79 | 3300005563 | Ga0068855_100056659 | Ga0068855_1000566593 | 60 |
| 80 | 3300005617 | Ga0068859_100135761 | Ga0068859_1001357614 | 60 |
| 81 | 3300005618 | Ga0068864_100203018 | Ga0068864_1002030182 | 60 |
| 82 | 3300005618 | Ga0068864_100232459 | Ga0068864_1002324593 | 60 |
| 83 | 3300005841 | Ga0068863_100267993 | Ga0068863_1002679932 | 60 |
| 84 | 3300005843 | Ga0068860_102236801 | Ga0068860_1022368012 | 60 |
| 85 | 3300006195 | Ga0075366_10111080 | Ga0075366_101110804 | 60 |
| 86 | 3300006195 | Ga0075366_10829173 | Ga0075366_108291732 | 60 |
| 87 | 3300006353 | Ga0075370_10211292 | Ga0075370_102112922 | 60 |
| 88 | 3300006844 | Ga0075428_101755609 | Ga0075428_1017556092 | 60 |
| 89 | 3300006931 | Ga0097620_100135768 | Ga0097620_1001357683 | 60 |
| 90 | 3300009093 | Ga0105240_10390077 | Ga0105240_103900773 | 60 |
| 91 | 3300009098 | Ga0105245_10197988 | Ga0105245_101979883 | 60 |
| 92 | 3300009098 | Ga0105245_12663276 | Ga0105245_126632762 | 60 |
| 93 | 3300009147 | Ga0114129_13226100 | Ga0114129_132261001 | 60 |
| 94 | 3300009148 | Ga0105243_12258272 | Ga0105243_122582722 | 60 |
| 95 | 3300009174 | Ga0105241_10131178 | Ga0105241_101311783 | 60 |
| 96 | 3300009176 | Ga0105242_12045956 | Ga0105242_120459562 | 60 |
| 97 | 3300009176 | Ga0105242_12067010 | Ga0105242_120670102 | 60 |
| 98 | 3300009177 | Ga0105248_11161825 | Ga0105248_111618252 | 60 |
| 99 | 3300009551 | Ga0105238_10955045 | Ga0105238_109550452 | 60 |
| 100 | 3300009553 | Ga0105249_11551745 | Ga0105249_115517452 | 60 |
| 101 | 3300011119 | Ga0105246_12023347 | Ga0105246_120233472 | 60 |
| 102 | 3300013104 | Ga0157370_10064358 | Ga0157370_100643584 | 60 |
| 103 | 3300013297 | Ga0157378_10287522 | Ga0157378_102875223 | 60 |
| 104 | 3300013306 | Ga0163162_10511298 | Ga0163162_105112982 | 60 |
| 105 | 3300013307 | Ga0157372_10889466 | Ga0157372_108894662 | 60 |
| 106 | 3300013307 | Ga0157372_11063348 | Ga0157372_110633482 | 60 |
| 107 | 3300013307 | Ga0157372_11115219 | Ga0157372_111152191 | 60 |
| 108 | 3300013308 | Ga0157375_13441238 | Ga0157375_134412382 | 60 |
| 109 | 3300014325 | Ga0163163_12122414 | Ga0163163_121224142 | 60 |
| 110 | 3300014326 | Ga0157380_12384854 | Ga0157380_123848542 | 60 |
| 111 | 3300014968 | Ga0157379_10227813 | Ga0157379_102278133 | 60 |
| 112 | 3300014968 | Ga0157379_10233346 | Ga0157379_102333464 | 60 |
| 113 | 3300014969 | Ga0157376_10472079 | Ga0157376_104720793 | 60 |
| 114 | 3300025912 | Ga0207707_10063286 | Ga0207707_100632864 | 60 |
| 115 | 3300025913 | Ga0207695_10493464 | Ga0207695_104934642 | 60 |
| 116 | 3300025922 | Ga0207646_10382387 | Ga0207646_103823872 | 60 |
| 117 | 3300025925 | Ga0207650_10169816 | Ga0207650_101698163 | 60 |
| 118 | 3300025927 | Ga0207687_10198898 | Ga0207687_101988983 | 60 |
| 119 | 3300025931 | Ga0207644_10023313 | Ga0207644_100233132 | 60 |
| 120 | 3300025933 | Ga0207706_11010224 | Ga0207706_110102241 | 60 |
| 121 | 3300025934 | Ga0207686_10409383 | Ga0207686_104093833 | 60 |
| 122 | 3300025935 | Ga0207709_11567325 | Ga0207709_115673252 | 60 |
| 123 | 3300025949 | Ga0207667_10019150 | Ga0207667_100191503 | 60 |
| 124 | 3300026023 | Ga0207677_11027929 | Ga0207677_110279292 | 60 |
| 125 | 3300026035 | Ga0207703_10067259 | Ga0207703_100672592 | 60 |
| 126 | 3300026088 | Ga0207641_10297009 | Ga0207641_102970093 | 60 |
| 127 | 3300026095 | Ga0207676_10090662 | Ga0207676_100906625 | 60 |
| 128 | 3300026121 | Ga0207683_11851494 | Ga0207683_118514942 | 60 |
| 129 | 3300026142 | Ga0207698_10297306 | Ga0207698_102973064 | 60 |
| 130 | 3300027364 | Ga0209967_1044635 | Ga0209967_10446352 | 60 |
| 131 | 3300027543 | Ga0209999_1084179 | Ga0209999_10841792 | 60 |
| 132 | 3300027614 | Ga0209970_1001181 | Ga0209970_10011813 | 60 |
| 133 | 3300027665 | Ga0209983_1004673 | Ga0209983_10046734 | 60 |
| 134 | 3300027876 | Ga0209974_10004577 | Ga0209974_100045773 | 60 |
| 135 | 3300028379 | Ga0268266_10981147 | Ga0268266_109811472 | 60 |
| 136 | 3300028381 | Ga0268264_10214317 | Ga0268264_102143172 | 60 |
| 137 | 3300028786 | Ga0307517_10073423 | Ga0307517_100734234 | 60 |
| 138 | 3300031507 | Ga0307509_10186873 | Ga0307509_101868733 | 60 |
| 139 | 3300031507 | Ga0307509_10357489 | Ga0307509_103574892 | 60 |
| 140 | 3300031727 | Ga0316576_10831569 | Ga0316576_108315692 | 60 |
| 141 | 3300031728 | Ga0316578_10194084 | Ga0316578_101940841 | 60 |
| 142 | 3300031731 | Ga0307405_10881906 | Ga0307405_108819062 | 60 |
| 143 | 3300031852 | Ga0307410_10686337 | Ga0307410_106863372 | 60 |
| 144 | 3300031903 | Ga0307407_11416340 | Ga0307407_114163402 | 60 |
| 145 | 3300031911 | Ga0307412_10281388 | Ga0307412_102813882 | 60 |
| 146 | 3300031911 | Ga0307412_10447790 | Ga0307412_104477902 | 60 |
| 147 | 3300031995 | Ga0307409_100127952 | Ga0307409_1001279522 | 60 |
| 148 | 3300031995 | Ga0307409_100400842 | Ga0307409_1004008423 | 60 |
| 149 | 3300032002 | Ga0307416_100415923 | Ga0307416_1004159232 | 60 |
| 150 | 3300032002 | Ga0307416_101097712 | Ga0307416_1010977121 | 60 |
| 151 | 3300032002 | Ga0307416_101515476 | Ga0307416_1015154762 | 60 |
| 152 | 3300032137 | Ga0316585_10078609 | Ga0316585_100786092 | 60 |
| 153 | 3300033541 | Ga0316596_1000881 | Ga0316596_10008812 | 60 |
| 154 | 3300035398 | Ga0316574_0000085 | Ga0316574_0000085_9383_9568 | 60 |
| 155 | 3300035691 | Ga0373931_0048480 | Ga0373931_0048480_1350_1559 | 60 |
| 156 | 3300036401 | Ga0373937_0440679 | Ga0373937_0440679_237_443 | 60 |
| 157 | 3300036647 | Ga0316582_0002224 | Ga0316582_0002224_3138_3323 | 60 |
| 158 | 3300036712 | Ga0316584_0163155 | Ga0316584_0163155_456_641 | 60 |
| 159 | 3300041509 | Ga0451843_0602173 | Ga0451843_0602173_306_488 | 60 |
| 160 | 3300041511 | Ga0451855_0186774 | Ga0451855_0186774_70_252 | 60 |
| 161 | 3300042001 | Ga0439441_006145 | Ga0439441_006145_102_308 | 60 |
| 162 | 3300042123 | Ga0450921_030360 | Ga0450921_030360_153_344 | 60 |
| 163 | 3300042133 | Ga0450896_021278 | Ga0450896_021278_424_615 | 60 |
| 164 | 3300042134 | Ga0450898_028179 | Ga0450898_028179_592_783 | 60 |
| 165 | 3300044684 | Ga0466966_0050829 | Ga0466966_0050829_1383_1571 | 60 |
| 166 | 3300044684 | Ga0466966_0249215 | Ga0466966_0249215_822_1025 | 60 |
| 167 | 3300044693 | Ga0466961_0346027 | Ga0466961_0346027_335_523 | 60 |
| 168 | 3300044842 | Ga0466957_0004472 | Ga0466957_0004472_2015_2203 | 60 |
| 169 | 3300045049 | Ga0466959_0194087 | Ga0466959_0194087_214_402 | 60 |
| 170 | 3300045051 | Ga0451576_1854134 | Ga0451576_1854134_154_342 | 60 |
| 171 | 3300045836 | Ga0466958_0338140 | Ga0466958_0338140_385_573 | 60 |
| 172 | 3300046477 | Ga0495664_0370635 | Ga0495664_0370635_223_429 | 60 |
| 173 | 3300046519 | Ga0495632_0312768 | Ga0495632_0312768_192_374 | 60 |
| 174 | 3300046542 | Ga0495597_0162519 | Ga0495597_0162519_409_597 | 60 |
| 175 | 3300046616 | Ga0495668_0528899 | Ga0495668_0528899_355_537 | 60 |
| 176 | 3300046648 | Ga0495611_0407472 | Ga0495611_0407472_185_367 | 60 |
| 177 | 3300046680 | Ga0495646_0707710 | Ga0495646_0707710_49_255 | 60 |
| 178 | 3300047444 | Ga0495675_0350777 | Ga0495675_0350777_626_832 | 60 |
| 179 | 3300048912 | Ga0496109_0240948 | Ga0496109_0240948_1358_1540 | 60 |
| 180 | 3300048914 | Ga0496111_0262791 | Ga0496111_0262791_248_430 | 60 |
| 181 | 3300048915 | Ga0496112_0691999 | Ga0496112_0691999_25_231 | 60 |
| 182 | 3300049572 | Ga0501036_0231452 | Ga0501036_0231452_913_1098 | 60 |
| 183 | 3300049572 | Ga0501036_1680710 | Ga0501036_1680710_154_339 | 60 |
| 184 | 3300049575 | Ga0501039_0994109 | Ga0501039_0994109_15_200 | 60 |
| 185 | 3300049581 | Ga0501047_0005455 | Ga0501047_0005455_256_441 | 60 |
| 186 | 3300049588 | Ga0501072_0157412 | Ga0501072_0157412_1353_1538 | 60 |
| 187 | 3300049588 | Ga0501072_0291595 | Ga0501072_0291595_187_375 | 60 |
| 188 | 3300049590 | Ga0501074_0367848 | Ga0501074_0367848_303_488 | 60 |
| 189 | 3300049741 | Ga0501079_1301339 | Ga0501079_1301339_136_321 | 60 |
| 190 | 3300049742 | Ga0501080_0564807 | Ga0501080_0564807_87_272 | 60 |
| 191 | 3300050493 | nmdc:mga0k408_112738_c1 | nmdc:mga0k408_112738_c1_168_350 | 60 |
| 192 | 3300050496 | nmdc:mga07m45_911349_c1 | nmdc:mga07m45_911349_c1_20_202 | 60 |
| 193 | 3300054114 | Ga0501084_0021259 | Ga0501084_0021259_1823_2008 | 60 |
| 194 | 3300054114 | Ga0501084_1732059 | Ga0501084_1732059_186_371 | 60 |
| 195 | 3300059426 | Ga0590077_126115 | Ga0590077_126115_174_359 | 60 |
| 196 | 3300061719 | Ga0466962_0440430 | Ga0466962_0440430_153_341 | 60 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g34-assembly1.cif.gz_Z | time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate | 0.9956 | 5 | 59 |
| 6ogf-assembly1.cif.gz_z | 70s termination complex with rf2 bound to the uga codon. partially rotated ribosome with rf2 bound (structure iii). | 0.9924 | 5 | 60 |
| 6enu-assembly1.cif.gz_Z | polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) | 0.991 | 5 | 60 |
| 7nhn-assembly1.cif.gz_3 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9902 | 7 | 60 |
| 4v9p-assembly1.cif.gz_AZ | control of ribosomal subunit rotation by elongation factor g | 0.9892 | 6 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6SIL2_19_102_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9908 | 5 | 60 | 3.30.1390.20 |
| 4wfbW00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9892 | 5 | 60 | 3.30.1390.20 |
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9884 | 5 | 60 | 3.30.1390.20 |
| 4tomZ00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9877 | 5 | 60 | 3.30.1390.20 |
| af_Q54GH8_53_110_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9863 | 7 | 60 | 3.30.1390.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C9C4K1-F1-model_v4 | Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] | 1.01 | 5 | 60 |
GO:0003735
GO:0005737 GO:0006412 GO:0015934 GO:0015935 GO:0019843 |
| AF-A0A6B0Z3A2-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.01 | 5 | 60 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5J4SI69-F1-model_v4 | 50S ribosomal protein L30 | 1.01 | 5 | 60 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A845CXN1-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.009 | 6 | 60 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A443YTC8-F1-model_v4 | 50S ribosomal protein L30 | 1.009 | 5 | 60 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar