F301164

General Info

Members Datasets Scaffolds Average Seq Length
196 125 392 101

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100906966|Ga0070711_1009069662
Length 111
Sequence MMPEATMESETPTIQSAATAAKRGQRKERIGKVISNKMTKTIIVRVERRFSHPKYKKVVTGYKKFYAHDEKAEAKVGDRVRIEETRPLSKTKRWRLVEIVEKGTGVAPVAV

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
65 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
89 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
90 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 2.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.04
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 18.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100906966 3300005439 Bacteria 752
2 Ga0070683_100665333 3300005329 Bacteria 997
3 Ga0070683_100820480 3300005329 Bacteria 892
4 Ga0070683_101182402 3300005329 Bacteria 735
5 Ga0070689_100698017 3300005340 Unclassified 886
6 Ga0070689_100998936 3300005340 Bacteria 744
7 Ga0070673_100867007 3300005364 Bacteria 836
8 Ga0070714_100579701 3300005435 Bacteria 1076
9 Ga0070711_100017546 3300005439 Bacteria 4560
10 Ga0070711_100056980 3300005439 Bacteria 2704
11 Ga0070711_100635093 3300005439 Bacteria 894
12 Ga0070681_10493017 3300005458 Unclassified 1138
13 Ga0070681_10789870 3300005458 Bacteria 866
14 Ga0070707_100747368 3300005468 Unclassified 941
15 Ga0070707_101727796 3300005468 Unclassified 593
16 Ga0070699_101565239 3300005518 Unclassified 604
17 Ga0070684_101829556 3300005535 Unclassified 573
18 Ga0070693_100584081 3300005547 Unclassified 804
19 Ga0068857_100001295 3300005577 Bacteria 19638
20 Ga0068859_100471414 3300005617 Bacteria 1351
21 Ga0068859_101526518 3300005617 Bacteria 737
22 Ga0068864_100019034 3300005618 Bacteria 5739
23 Ga0068864_102205816 3300005618 Bacteria 557
24 Ga0068863_100133493 3300005841 Bacteria 2371
25 Ga0068863_100277030 3300005841 Bacteria 1624
26 Ga0070715_10380200 3300006163 Bacteria 779
27 Ga0070712_100475243 3300006175 Bacteria 1044
28 Ga0070712_101521394 3300006175 Unclassified 585
29 Ga0097621_100008773 3300006237 Bacteria 7304
30 Ga0068871_100122908 3300006358 Bacteria 2194
31 Ga0068871_100407289 3300006358 Bacteria 1212
32 Ga0068871_101181822 3300006358 Bacteria 717
33 Ga0075428_101188702 3300006844 Bacteria 804
34 Ga0075428_101297568 3300006844 Bacteria 766
35 Ga0075436_100027386 3300006914 Bacteria 3923
36 Ga0097620_100471417 3300006931 Bacteria 1351
37 Ga0097620_101527008 3300006931 Bacteria 737
38 Ga0075435_100493567 3300007076 Bacteria 1058
39 Ga0099794_10231686 3300007265 Unclassified 950
40 Ga0099795_10066452 3300007788 Bacteria 1351
41 Ga0099795_10249217 3300007788 Bacteria 765
42 Ga0105240_10002989 3300009093 Bacteria 26600
43 Ga0111539_12911649 3300009094 Bacteria 554
44 Ga0105245_10387321 3300009098 Bacteria 1393
45 Ga0105245_12528154 3300009098 Unclassified 567
46 Ga0105241_10979545 3300009174 Unclassified 790
47 Ga0105242_11672367 3300009176 Unclassified 672
48 Ga0105242_12159180 3300009176 Bacteria 601
49 Ga0105238_10605009 3300009551 Bacteria 1104
50 Ga0105238_11947205 3300009551 Bacteria 621
51 Ga0105238_12116357 3300009551 Bacteria 597
52 Ga0157369_10788579 3300013105 Bacteria 976
53 Ga0157374_10355803 3300013296 Bacteria 1455
54 Ga0157378_10838931 3300013297 Bacteria 947
55 Ga0157375_10000037 3300013308 Bacteria 176523
56 Ga0157375_13138416 3300013308 Bacteria 551
57 Ga0163163_10000212 3300014325 Bacteria 60199
58 Ga0163163_10057662 3300014325 Bacteria 3840
59 Ga0163163_11753405 3300014325 Bacteria 681
60 Ga0163163_11888609 3300014325 Bacteria 657
61 Ga0157380_12842765 3300014326 Bacteria 551
62 Ga0157379_10354614 3300014968 Bacteria 1343
63 Ga0157376_10246266 3300014969 Bacteria 1667
64 Ga0157376_10286361 3300014969 Bacteria 1554
65 Ga0157376_10383182 3300014969 Bacteria 1355
66 Ga0157376_11676394 3300014969 Bacteria 671
67 Ga0157376_12206275 3300014969 Unclassified 589
68 Ga0163161_10399878 3300017792 Bacteria 1101
69 Ga0207685_10471964 3300025905 Bacteria 656
70 Ga0207695_10012898 3300025913 Bacteria 10002
71 Ga0207695_10119951 3300025913 Bacteria 2599
72 Ga0207695_11451011 3300025913 Bacteria 566
73 Ga0207663_10014397 3300025916 Bacteria 4327
74 Ga0207663_10461205 3300025916 Bacteria 981
75 Ga0207663_11344299 3300025916 Bacteria 575
76 Ga0207694_10400633 3300025924 Bacteria 1141
77 Ga0207694_11313200 3300025924 Bacteria 612
78 Ga0207700_11487985 3300025928 Unclassified 601
79 Ga0207686_11734411 3300025934 Archaea 516
80 Ga0207670_10082651 3300025936 Bacteria 2251
81 Ga0207670_11072743 3300025936 Bacteria 679
82 Ga0207704_10188203 3300025938 Bacteria 1499
83 Ga0207665_11363096 3300025939 Unclassified 565
84 Ga0207661_10341684 3300025944 Bacteria 1349
85 Ga0207661_11431491 3300025944 Bacteria 634
86 Ga0207651_10770641 3300025960 Bacteria 851
87 Ga0207676_10328698 3300026095 Bacteria 1406
88 Ga0207676_11329319 3300026095 Bacteria 714
89 Ga0207674_10003110 3300026116 Bacteria 20480
90 Ga0265323_10000705 3300028653 Bacteria 18171
91 Ga0265336_10017147 3300028666 Bacteria 2360
92 Ga0265338_10010461 3300028800 Bacteria 10871
93 Ga0265338_10696764 3300028800 Bacteria 701
94 Ga0265338_10836274 3300028800 Unclassified 629
95 Ga0265324_10012740 3300029957 Bacteria 3161
96 Ga0265324_10063196 3300029957 Bacteria 1264
97 Ga0265760_10323173 3300031090 Bacteria 549
98 Ga0265320_10250185 3300031240 Bacteria 786
99 Ga0265316_10021617 3300031344 Bacteria 5444
100 Ga0265316_10418744 3300031344 Bacteria 963
101 Ga0265316_10668403 3300031344 Bacteria 734
102 Ga0265314_10149223 3300031711 Bacteria 1436
103 Ga0316576_10083354 3300031727 Bacteria 2375
104 Ga0316578_10089714 3300031728 Bacteria 1835
105 Ga0316577_10211518 3300031733 Bacteria 1096
106 Ga0316580_10072286 3300032139 Bacteria 1056
107 Ga0316593_10051246 3300032168 Bacteria 1395
108 Ga0316593_10185501 3300032168 Unclassified 766
109 Ga0316596_1184564 3300033541 Bacteria 578
110 Ga0373926_0046829 3300035083 Bacteria 1552
111 Ga0373951_0044125 3300035091 Bacteria 1082
112 Ga0373923_0178095 3300035111 Unclassified 976
113 Ga0373936_0211647 3300035113 Bacteria 858
114 Ga0373945_0013439 3300035116 Bacteria 2732
115 Ga0373954_0036046 3300035118 Bacteria 2295
116 Ga0373956_0550906 3300035119 Bacteria 550
117 Ga0373943_0032057 3300035170 Bacteria 2496
118 Ga0373962_0249313 3300035242 Unclassified 616
119 Ga0316574_0027177 3300035398 Bacteria 3445
120 Ga0373924_0162752 3300035410 Bacteria 979
121 Ga0373931_0461683 3300035691 Unclassified 814
122 Ga0373935_0025899 3300035692 Bacteria 3615
123 Ga0373935_0029930 3300035692 Bacteria 3372
124 Ga0373927_0001357 3300035695 Bacteria 18448
125 Ga0373933_0149313 3300035724 Bacteria 1479
126 Ga0373947_0005428 3300035725 Bacteria 7441
127 Ga0373947_0418748 3300035725 Bacteria 905
128 Ga0373937_0079629 3300036401 Bacteria 3028
129 Ga0373937_0109409 3300036401 Bacteria 2570
130 Ga0373937_1052034 3300036401 Bacteria 763
131 Ga0316582_0020374 3300036647 Bacteria 3899
132 Ga0316582_1230341 3300036647 Bacteria 509
133 Ga0316584_0065378 3300036712 Bacteria 2724
134 Ga0316584_0305773 3300036712 Bacteria 1150
135 Ga0373925_0005962 3300037068 Bacteria 9028
136 Ga0373925_0478860 3300037068 Bacteria 1021
137 Ga0451800_1048741 3300041459 Bacteria 965
138 Ga0451839_1190880 3300041496 Bacteria 744
139 Ga0451851_0900918 3300041507 Unclassified 1158
140 Ga0451855_0882926 3300041511 Bacteria 1046
141 Ga0451577_0018671 3300042876 Bacteria 6383
142 Ga0451577_0123421 3300042876 Bacteria 2320
143 Ga0451577_0286087 3300042876 Bacteria 1494
144 Ga0453684_0008216 3300044712 Bacteria 18819
145 Ga0453684_1479219 3300044712 Bacteria 701
146 Ga0451576_0108268 3300045051 Bacteria 2892
147 Ga0451576_0138936 3300045051 Bacteria 2534
148 Ga0451576_0345120 3300045051 Unclassified 1559
149 Ga0451576_0667839 3300045051 Bacteria 1092
150 Ga0451576_0969920 3300045051 Unclassified 891
151 Ga0495641_0054948 3300046461 Bacteria 1808
152 Ga0495651_0037446 3300046462 Bacteria 3776
153 Ga0495651_0843150 3300046462 Unclassified 563
154 Ga0495582_0177001 3300046473 Bacteria 1215
155 Ga0495639_0480401 3300046475 Unclassified 633
156 Ga0495639_0527181 3300046475 Unclassified 604
157 Ga0495618_0795985 3300046514 Bacteria 551
158 Ga0495628_0602260 3300046516 Bacteria 785
159 Ga0495628_0607203 3300046516 Bacteria 781
160 Ga0495628_1238420 3300046516 Bacteria 505
161 Ga0495630_0119862 3300046517 Bacteria 1996
162 Ga0495630_0164083 3300046517 Unclassified 1691
163 Ga0495630_0373163 3300046517 Bacteria 1092
164 Ga0495630_1140304 3300046517 Unclassified 590
165 Ga0495666_0012271 3300046526 Bacteria 4272
166 Ga0495652_0676180 3300046529 Bacteria 697
167 Ga0495665_0123207 3300046531 Unclassified 1358
168 Ga0495586_0006045 3300046535 Bacteria 6474
169 Ga0495586_0069099 3300046535 Unclassified 1928
170 Ga0495586_0840866 3300046535 Bacteria 529
171 Ga0495621_0384118 3300046539 Unclassified 593
172 Ga0495645_0029157 3300046543 Bacteria 4012
173 Ga0495645_0157096 3300046543 Bacteria 1575
174 Ga0495667_0363181 3300046559 Bacteria 914
175 Ga0495634_0028756 3300046642 Bacteria 3855
176 Ga0495634_0616000 3300046642 Unclassified 629
177 Ga0495599_0659680 3300046678 Unclassified 606
178 Ga0495647_0004472 3300046681 Bacteria 4545
179 Ga0495658_0024817 3300046683 Bacteria 3198
180 Ga0495613_0011194 3300046689 Bacteria 6664
181 Ga0495613_0557574 3300046689 Bacteria 766
182 Ga0495624_0062518 3300046690 Bacteria 2329
183 Ga0495581_0706176 3300047315 Unclassified 581
184 Ga0495604_0445116 3300047317 Bacteria 847
185 Ga0495676_0198525 3300047321 Bacteria 1395
186 Ga0495676_0530055 3300047321 Bacteria 771
187 Ga0495675_0193052 3300047444 Bacteria 1242
188 Ga0495684_0084239 3300047471 Bacteria 2412
189 Ga0495593_0590677 3300047673 Unclassified 557
190 Ga0496102_0003028 3300048905 Bacteria 14227
191 Ga0496105_0384705 3300048908 Bacteria 1116
192 Ga0496109_0995636 3300048912 Bacteria 776
193 Ga0501305_050232 3300049161 Unclassified 698
194 nmdc:mga0rr50_1295773_c1 3300050513 Unclassified 618
195 nmdc:mga0rr50_291261_c1 3300050513 Bacteria 1364
196 nmdc:mga08x19_522007_c1 3300050514 Bacteria 839
197 Ga0070711_100906966
198 Ga0070683_100665333
199 Ga0070683_100820480
200 Ga0070683_101182402
201 Ga0070689_100698017
202 Ga0070689_100998936
203 Ga0070673_100867007
204 Ga0070714_100579701
205 Ga0070711_100017546
206 Ga0070711_100056980
207 Ga0070711_100635093
208 Ga0070681_10493017
209 Ga0070681_10789870
210 Ga0070707_100747368
211 Ga0070707_101727796
212 Ga0070699_101565239
213 Ga0070684_101829556
214 Ga0070693_100584081
215 Ga0068857_100001295
216 Ga0068859_100471414
217 Ga0068859_101526518
218 Ga0068864_100019034
219 Ga0068864_102205816
220 Ga0068863_100133493
221 Ga0068863_100277030
222 Ga0070715_10380200
223 Ga0070712_100475243
224 Ga0070712_101521394
225 Ga0097621_100008773
226 Ga0068871_100122908
227 Ga0068871_100407289
228 Ga0068871_101181822
229 Ga0075428_101188702
230 Ga0075428_101297568
231 Ga0075436_100027386
232 Ga0097620_100471417
233 Ga0097620_101527008
234 Ga0075435_100493567
235 Ga0099794_10231686
236 Ga0099795_10066452
237 Ga0099795_10249217
238 Ga0105240_10002989
239 Ga0111539_12911649
240 Ga0105245_10387321
241 Ga0105245_12528154
242 Ga0105241_10979545
243 Ga0105242_11672367
244 Ga0105242_12159180
245 Ga0105238_10605009
246 Ga0105238_11947205
247 Ga0105238_12116357
248 Ga0157369_10788579
249 Ga0157374_10355803
250 Ga0157378_10838931
251 Ga0157375_10000037
252 Ga0157375_13138416
253 Ga0163163_10000212
254 Ga0163163_10057662
255 Ga0163163_11753405
256 Ga0163163_11888609
257 Ga0157380_12842765
258 Ga0157379_10354614
259 Ga0157376_10246266
260 Ga0157376_10286361
261 Ga0157376_10383182
262 Ga0157376_11676394
263 Ga0157376_12206275
264 Ga0163161_10399878
265 Ga0207685_10471964
266 Ga0207695_10012898
267 Ga0207695_10119951
268 Ga0207695_11451011
269 Ga0207663_10014397
270 Ga0207663_10461205
271 Ga0207663_11344299
272 Ga0207694_10400633
273 Ga0207694_11313200
274 Ga0207700_11487985
275 Ga0207686_11734411
276 Ga0207670_10082651
277 Ga0207670_11072743
278 Ga0207704_10188203
279 Ga0207665_11363096
280 Ga0207661_10341684
281 Ga0207661_11431491
282 Ga0207651_10770641
283 Ga0207676_10328698
284 Ga0207676_11329319
285 Ga0207674_10003110
286 Ga0265323_10000705
287 Ga0265336_10017147
288 Ga0265338_10010461
289 Ga0265338_10696764
290 Ga0265338_10836274
291 Ga0265324_10012740
292 Ga0265324_10063196
293 Ga0265760_10323173
294 Ga0265320_10250185
295 Ga0265316_10021617
296 Ga0265316_10418744
297 Ga0265316_10668403
298 Ga0265314_10149223
299 Ga0316576_10083354
300 Ga0316578_10089714
301 Ga0316577_10211518
302 Ga0316580_10072286
303 Ga0316593_10051246
304 Ga0316593_10185501
305 Ga0316596_1184564
306 Ga0373926_0046829
307 Ga0373951_0044125
308 Ga0373923_0178095
309 Ga0373936_0211647
310 Ga0373945_0013439
311 Ga0373954_0036046
312 Ga0373956_0550906
313 Ga0373943_0032057
314 Ga0373962_0249313
315 Ga0316574_0027177
316 Ga0373924_0162752
317 Ga0373931_0461683
318 Ga0373935_0025899
319 Ga0373935_0029930
320 Ga0373927_0001357
321 Ga0373933_0149313
322 Ga0373947_0005428
323 Ga0373947_0418748
324 Ga0373937_0079629
325 Ga0373937_0109409
326 Ga0373937_1052034
327 Ga0316582_0020374
328 Ga0316582_1230341
329 Ga0316584_0065378
330 Ga0316584_0305773
331 Ga0373925_0005962
332 Ga0373925_0478860
333 Ga0451800_1048741
334 Ga0451839_1190880
335 Ga0451851_0900918
336 Ga0451855_0882926
337 Ga0451577_0018671
338 Ga0451577_0123421
339 Ga0451577_0286087
340 Ga0453684_0008216
341 Ga0453684_1479219
342 Ga0451576_0108268
343 Ga0451576_0138936
344 Ga0451576_0345120
345 Ga0451576_0667839
346 Ga0451576_0969920
347 Ga0495641_0054948
348 Ga0495651_0037446
349 Ga0495651_0843150
350 Ga0495582_0177001
351 Ga0495639_0480401
352 Ga0495639_0527181
353 Ga0495618_0795985
354 Ga0495628_0602260
355 Ga0495628_0607203
356 Ga0495628_1238420
357 Ga0495630_0119862
358 Ga0495630_0164083
359 Ga0495630_0373163
360 Ga0495630_1140304
361 Ga0495666_0012271
362 Ga0495652_0676180
363 Ga0495665_0123207
364 Ga0495586_0006045
365 Ga0495586_0069099
366 Ga0495586_0840866
367 Ga0495621_0384118
368 Ga0495645_0029157
369 Ga0495645_0157096
370 Ga0495667_0363181
371 Ga0495634_0028756
372 Ga0495634_0616000
373 Ga0495599_0659680
374 Ga0495647_0004472
375 Ga0495658_0024817
376 Ga0495613_0011194
377 Ga0495613_0557574
378 Ga0495624_0062518
379 Ga0495581_0706176
380 Ga0495604_0445116
381 Ga0495676_0198525
382 Ga0495676_0530055
383 Ga0495675_0193052
384 Ga0495684_0084239
385 Ga0495593_0590677
386 Ga0496102_0003028
387 Ga0496105_0384705
388 Ga0496109_0995636
389 Ga0501305_050232
390 nmdc:mga0rr50_1295773_c1
391 nmdc:mga0rr50_291261_c1
392 nmdc:mga08x19_522007_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

31

98

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8j-assembly1.cif.gz_Q yeast mitochondrial small subunit assembly intermediate (state 1) 0.9711 21 98
8d8k-assembly1.cif.gz_Q yeast mitochondrial small subunit assembly intermediate (state 2) 0.9709 21 98
5mrc-assembly1.cif.gz_QQ structure of the yeast mitochondrial ribosome - class a 0.9664 21 97
8cwo-assembly1.cif.gz_Q cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9612 20 98
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.9596 21 99
ID Description Score Start End Superfamily
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9832 23 98 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9777 20 98 2.40.50.140
af_Q2FW15_6_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9674 21 100 2.40.50.140
af_Q4E4R7_93_168_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9573 25 97 2.40.50.140
3ms0Q00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9457 21 99 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3N5UGX2-F1-model_v4 Small ribosomal subunit protein uS17 0.9864 19 99 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3D5CDP2-F1-model_v4 30S ribosomal protein S17 0.9855 19 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-Q5Z1V4-F1-model_v4 Small ribosomal subunit protein uS17 (30S ribosomal protein S17) 0.984 19 98 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3A4VFC1-F1-model_v4 Small ribosomal subunit protein uS17 0.9837 20 96 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1Y1IKB9-F1-model_v4 Small ribosomal subunit protein uS17c 0.982 21 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map