F300761

General Info

Members Datasets Scaffolds Average Seq Length
195 110 195 233

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000742|Ga0500635_0000742_7037_7744
Length 227
Sequence MTVDEIMAELKARGDDKIKNILVKHGVKEPFFGVKVEYLKPIQKKVKKDYQLAKDLYATGNADAQYLAGLIADDNQMSAADLQTWVEQALSNNISEYTVPWVAAESNHGFDMATHIAAAGWATLSNLVALKPDEELRLDTLKGLIDRVVNTIHSSPDRVRSVMNIFIISAGSYVSALNTYANEAAKKIGVVTIDKNGTSCKVPDAIEYMAKAQARGSLTKKKKTVKC

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
104 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
105 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
106 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
109 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0
Rhizoplane 0
Rhizosphere 88.72
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000234 3300000545 Bacteria 6828
2 rootH1_10191265 3300003316 Unclassified 1481
3 rootH2_10008353 3300003320 Bacteria 41961
4 rootL2_10227982 3300003322 Bacteria 3582
5 rootH1_10091465 3300003323 Bacteria 9887
6 rootH1_10208180 3300003323 Bacteria 3207
7 Ga0065714_10010779 3300005288 Bacteria 2053
8 Ga0065714_10071399 3300005288 Bacteria 3589
9 Ga0065714_10071686 3300005288 Bacteria 3505
10 Ga0070658_10000032 3300005327 Bacteria 147726
11 Ga0070676_10000819 3300005328 Bacteria 15368
12 Ga0068868_100017164 3300005338 Bacteria 5387
13 Ga0068868_100235117 3300005338 Bacteria 1538
14 Ga0070660_100000282 3300005339 Bacteria 33859
15 Ga0070673_100000911 3300005364 Bacteria 16687
16 Ga0070688_100223768 3300005365 Bacteria 1327
17 Ga0070678_100021369 3300005456 Bacteria 4267
18 Ga0068867_100001069 3300005459 Bacteria 18702
19 Ga0070679_100071771 3300005530 Bacteria 3454
20 Ga0068853_100005717 3300005539 Bacteria 9786
21 Ga0068853_100183128 3300005539 Bacteria 1900
22 Ga0068853_100245702 3300005539 Unclassified 1641
23 Ga0070665_100000001 3300005548 Bacteria 1083363
24 Ga0070665_100000034 3300005548 Bacteria 324289
25 Ga0068855_100000156 3300005563 Bacteria 86845
26 Ga0068855_100000388 3300005563 Bacteria 54070
27 Ga0068855_100014673 3300005563 Bacteria 9437
28 Ga0068857_100024390 3300005577 Bacteria 5324
29 Ga0068856_100024593 3300005614 Bacteria 5863
30 Ga0068856_100052003 3300005614 Bacteria 4039
31 Ga0068856_100068840 3300005614 Unclassified 3499
32 Ga0068856_100098111 3300005614 Bacteria 2920
33 Ga0068852_100001291 3300005616 Bacteria 16734
34 Ga0068852_100046944 3300005616 Bacteria 3682
35 Ga0068852_100716487 3300005616 Unclassified 1011
36 Ga0068858_100146955 3300005842 Bacteria 2214
37 Ga0068860_100000046 3300005843 Bacteria 214800
38 Ga0068860_100000880 3300005843 Bacteria 33319
39 Ga0075366_10010122 3300006195 Bacteria 5288
40 Ga0097621_100000182 3300006237 Bacteria 39957
41 Ga0068865_100000178 3300006881 Bacteria 35174
42 Ga0105240_10000520 3300009093 Bacteria 70859
43 Ga0105240_10001726 3300009093 Bacteria 36894
44 Ga0105240_10004401 3300009093 Bacteria 21482
45 Ga0105240_10006272 3300009093 Bacteria 17495
46 Ga0105240_10009698 3300009093 Bacteria 13600
47 Ga0105240_10136365 3300009093 Bacteria 2939
48 Ga0105240_10201294 3300009093 Bacteria 2333
49 Ga0105240_10258964 3300009093 Bacteria 2008
50 Ga0105241_10000254 3300009174 Bacteria 40113
51 Ga0105241_10003066 3300009174 Bacteria 12459
52 Ga0105241_10060734 3300009174 Bacteria 2909
53 Ga0105241_10113654 3300009174 Bacteria 2171
54 Ga0105242_10007075 3300009176 Bacteria 8667
55 Ga0105242_10192806 3300009176 Unclassified 1805
56 Ga0105237_10001092 3300009545 Bacteria 36314
57 Ga0105237_10001530 3300009545 Bacteria 30283
58 Ga0105237_10008693 3300009545 Bacteria 10971
59 Ga0105237_10025300 3300009545 Bacteria 6072
60 Ga0105237_10027062 3300009545 Bacteria 5858
61 Ga0105237_10118437 3300009545 Bacteria 2642
62 Ga0105238_10008083 3300009551 Bacteria 10522
63 Ga0105238_10059675 3300009551 Bacteria 3820
64 Ga0105239_10000002 3300010375 Bacteria 610298
65 Ga0105239_10001853 3300010375 Bacteria 27666
66 Ga0105239_10019907 3300010375 Bacteria 7406
67 Ga0105239_10025363 3300010375 Bacteria 6527
68 Ga0105239_10243723 3300010375 Bacteria 2018
69 Ga0157370_10002675 3300013104 Bacteria 21354
70 Ga0157369_10085191 3300013105 Bacteria 3377
71 Ga0157369_11147080 3300013105 Unclassified 794
72 Ga0157374_10001740 3300013296 Bacteria 18260
73 Ga0157374_10002996 3300013296 Bacteria 14134
74 Ga0157374_10242467 3300013296 Bacteria 1773
75 Ga0157374_10333787 3300013296 Bacteria 1504
76 Ga0157378_10004615 3300013297 Bacteria 12088
77 Ga0157378_10247352 3300013297 Bacteria 1706
78 Ga0163162_10000116 3300013306 Bacteria 70911
79 Ga0157372_10013390 3300013307 Bacteria 8757
80 Ga0157375_10100510 3300013308 Unclassified 2973
81 Ga0157375_10117203 3300013308 Bacteria 2768
82 Ga0157375_10169421 3300013308 Bacteria 2331
83 Ga0157376_10122264 3300014969 Unclassified 2309
84 Ga0157376_10265864 3300014969 Bacteria 1609
85 Ga0163161_10127988 3300017792 Bacteria 1914
86 Ga0213872_10002913 3300021361 Bacteria 9734
87 Ga0209233_1033963 3300025261 Unclassified 1166
88 Ga0209455_1000740 3300025272 Bacteria 18705
89 Ga0207647_10004200 3300025904 Bacteria 10682
90 Ga0207645_10000169 3300025907 Bacteria 51953
91 Ga0207705_10000032 3300025909 Bacteria 224376
92 Ga0207654_10047648 3300025911 Bacteria 2449
93 Ga0207654_10049514 3300025911 Bacteria 2410
94 Ga0207654_10069760 3300025911 Bacteria 2084
95 Ga0207695_10003890 3300025913 Bacteria 20675
96 Ga0207695_10011839 3300025913 Bacteria 10523
97 Ga0207695_10037714 3300025913 Bacteria 5213
98 Ga0207695_10071363 3300025913 Bacteria 3547
99 Ga0207695_10087900 3300025913 Bacteria 3130
100 Ga0207695_10541792 3300025913 Bacteria 1045
101 Ga0207671_10003117 3300025914 Bacteria 16850
102 Ga0207671_10012221 3300025914 Bacteria 6919
103 Ga0207671_10015751 3300025914 Bacteria 5905
104 Ga0207671_10026651 3300025914 Bacteria 4328
105 Ga0207671_10068193 3300025914 Bacteria 2650
106 Ga0207657_10000746 3300025919 Bacteria 34480
107 Ga0207652_10054272 3300025921 Bacteria 3445
108 Ga0207694_10044398 3300025924 Unclassified 3432
109 Ga0207669_10241207 3300025937 Bacteria 1340
110 Ga0207704_10000114 3300025938 Bacteria 44748
111 Ga0207667_10000070 3300025949 Bacteria 180479
112 Ga0207667_10003026 3300025949 Bacteria 20864
113 Ga0207667_10008503 3300025949 Bacteria 12187
114 Ga0207667_10014689 3300025949 Bacteria 8913
115 Ga0207667_10084987 3300025949 Bacteria 3276
116 Ga0207651_10019043 3300025960 Bacteria 4103
117 Ga0207658_10326370 3300025986 Unclassified 1330
118 Ga0207677_10051472 3300026023 Bacteria 2793
119 Ga0207677_10215019 3300026023 Bacteria 1538
120 Ga0207639_10043248 3300026041 Bacteria 3381
121 Ga0207639_10361408 3300026041 Unclassified 1299
122 Ga0207678_10444512 3300026067 Bacteria 1126
123 Ga0207702_10093847 3300026078 Unclassified 2633
124 Ga0207702_10316079 3300026078 Bacteria 1486
125 Ga0207702_10626475 3300026078 Unclassified 1057
126 Ga0207648_10000123 3300026089 Bacteria 76156
127 Ga0207674_10017354 3300026116 Bacteria 7854
128 Ga0207683_10041746 3300026121 Bacteria 4006
129 Ga0207698_10333477 3300026142 Unclassified 1426
130 Ga0207698_10664854 3300026142 Unclassified 1033
131 Ga0268266_10000049 3300028379 Bacteria 307763
132 Ga0268266_10000111 3300028379 Bacteria 169743
133 Ga0268264_10000041 3300028381 Bacteria 372501
134 Ga0268264_10001773 3300028381 Bacteria 19737
135 Ga0307515_10000778 3300028794 Bacteria 73451
136 Ga0307515_10003061 3300028794 Bacteria 35405
137 Ga0265327_10000164 3300031251 Bacteria 143027
138 Ga0265327_10022045 3300031251 Bacteria 3824
139 Ga0265327_10081733 3300031251 Bacteria 1595
140 Ga0307513_10097374 3300031456 Bacteria 2976
141 Ga0307509_10030097 3300031507 Bacteria 6011
142 Ga0307516_10113061 3300031730 Bacteria 2514
143 Ga0307414_10041654 3300032004 Bacteria 3113
144 Ga0307507_10002030 3300033179 Bacteria 43887
145 Ga0307510_10000444 3300033180 Bacteria 40146
146 Ga0373941_0044351 3300035115 Bacteria 1387
147 Ga0395899_0000001 3300037312 Bacteria 1750322
148 Ga0395899_0000289 3300037312 Bacteria 64799
149 Ga0395899_0108249 3300037312 Unclassified 2000
150 Ga0395900_0000095 3300037418 Bacteria 164383
151 Ga0395900_0000370 3300037418 Bacteria 64745
152 Ga0395900_0015778 3300037418 Bacteria 7701
153 Ga0395898_0421681 3300037466 Bacteria 1272
154 Ga0395905_0000411 3300037471 Bacteria 60254
155 Ga0395905_0000529 3300037471 Bacteria 52320
156 Ga0395901_0000580 3300038443 Bacteria 42442
157 Ga0395901_0019801 3300038443 Bacteria 6882
158 Ga0436361_0269064 3300039447 Bacteria 23413
159 Ga0466959_0187106 3300045049 Bacteria 1446
160 Ga0495629_0094523 3300046459 Bacteria 2086
161 Ga0495651_0208030 3300046462 Bacteria 1364
162 Ga0495651_0209230 3300046462 Bacteria 1359
163 Ga0495651_0262114 3300046462 Bacteria 1176
164 Ga0495585_0000429 3300046492 Bacteria 40273
165 Ga0495606_0014460 3300046507 Bacteria 6156
166 Ga0495606_0019875 3300046507 Bacteria 4974
167 Ga0495630_0291985 3300046517 Unclassified 1246
168 Ga0495631_0062798 3300046518 Bacteria 1609
169 Ga0495631_0109944 3300046518 Bacteria 1185
170 Ga0495644_0001604 3300046523 Bacteria 9217
171 Ga0495648_0002802 3300046524 Bacteria 15700
172 Ga0495648_0011571 3300046524 Bacteria 6637
173 Ga0495622_0097823 3300046557 Bacteria 1346
174 Ga0495633_0000035 3300046558 Bacteria 185403
175 Ga0495668_0000032 3300046616 Bacteria 254951
176 Ga0495668_0002089 3300046616 Bacteria 17290
177 Ga0495625_0000227 3300046660 Bacteria 88834
178 Ga0495625_0006872 3300046660 Bacteria 10047
179 Ga0495625_0416625 3300046660 Bacteria 836
180 Ga0495658_0045597 3300046683 Bacteria 2461
181 Ga0495683_0023636 3300047323 Bacteria 3158
182 Ga0495687_000001 3300047443 Bacteria 1215582
183 Ga0495687_002557 3300047443 Bacteria 14388
184 Ga0495677_0086579 3300047445 Bacteria 1178
185 Ga0495686_0001013 3300047472 Bacteria 34054
186 Ga0495686_0366720 3300047472 Bacteria 780
187 Ga0495614_0050895 3300048089 Bacteria 1775
188 Ga0501227_003082 3300049665 Bacteria 3626
189 nmdc:mga0k408_5136_c1 3300050493 Bacteria 6935
190 Ga0500635_0000742 3300053080 Bacteria 8157
191 Ga0500644_0216691 3300053088 Unclassified 797
192 Ga0500583_0008004 3300053092 Bacteria 3762
193 Ga0500618_000003 3300053125 Bacteria 338706
194 Ga0500642_0009287 3300053130 Bacteria 3406
195 Ga0500568_0019986 3300053139 Bacteria 2905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10059675 Ga0105238_100596752 191
2 3300025937 Ga0207669_10241207 Ga0207669_102412072 198
3 3300053088 Ga0500644_0216691 Ga0500644_0216691_32_673 213
4 3300026041 Ga0207639_10361408 Ga0207639_103614082 216
5 3300025914 Ga0207671_10015751 Ga0207671_100157517 217
6 3300031251 Ga0265327_10000164 Ga0265327_1000016443 218
7 3300005614 Ga0068856_100098111 Ga0068856_1000981114 222
8 3300009093 Ga0105240_10000520 Ga0105240_1000052034 222
9 3300009174 Ga0105241_10000254 Ga0105241_1000025431 222
10 3300009545 Ga0105237_10118437 Ga0105237_101184373 222
11 3300009551 Ga0105238_10008083 Ga0105238_100080838 222
12 3300010375 Ga0105239_10025363 Ga0105239_100253633 222
13 3300013105 Ga0157369_11147080 Ga0157369_111470801 222
14 3300025913 Ga0207695_10003890 Ga0207695_100038904 222
15 3300025914 Ga0207671_10026651 Ga0207671_100266512 222
16 3300026078 Ga0207702_10626475 Ga0207702_106264752 222
17 3300005539 Ga0068853_100245702 Ga0068853_1002457021 223
18 3300009093 Ga0105240_10001726 Ga0105240_1000172620 223
19 3300009545 Ga0105237_10027062 Ga0105237_100270622 223
20 3300025913 Ga0207695_10071363 Ga0207695_100713633 223
21 3300025924 Ga0207694_10044398 Ga0207694_100443983 223
22 3300053080 Ga0500635_0000742 Ga0500635_0000742_7037_7744 227
23 3300033180 Ga0307510_10000444 Ga0307510_1000044429 229
24 3300046462 Ga0495651_0262114 Ga0495651_0262114_475_1164 229
25 3300047472 Ga0495686_0366720 Ga0495686_0366720_17_706 229
26 3300009093 Ga0105240_10258964 Ga0105240_102589642 231
27 3300005563 Ga0068855_100000156 Ga0068855_10000015651 234
28 3300005563 Ga0068855_100000388 Ga0068855_1000003885 234
29 3300005614 Ga0068856_100024593 Ga0068856_1000245936 234
30 3300005614 Ga0068856_100068840 Ga0068856_1000688403 234
31 3300025949 Ga0207667_10000070 Ga0207667_1000007050 234
32 3300025949 Ga0207667_10003026 Ga0207667_1000302620 234
33 3300026078 Ga0207702_10093847 Ga0207702_100938472 234
34 3300000545 CNXas_1000234 CNXas_10002344 235
35 3300003316 rootH1_10191265 rootH1_101912651 235
36 3300003320 rootH2_10008353 rootH2_1000835324 235
37 3300003322 rootL2_10227982 rootL2_102279822 235
38 3300003323 rootH1_10091465 rootH1_100914658 235
39 3300003323 rootH1_10208180 rootH1_102081803 235
40 3300005288 Ga0065714_10010779 Ga0065714_100107792 235
41 3300005288 Ga0065714_10071399 Ga0065714_100713993 235
42 3300005288 Ga0065714_10071686 Ga0065714_100716863 235
43 3300005327 Ga0070658_10000032 Ga0070658_1000003274 235
44 3300005328 Ga0070676_10000819 Ga0070676_100008194 235
45 3300005338 Ga0068868_100017164 Ga0068868_1000171643 235
46 3300005338 Ga0068868_100235117 Ga0068868_1002351172 235
47 3300005339 Ga0070660_100000282 Ga0070660_10000028229 235
48 3300005364 Ga0070673_100000911 Ga0070673_1000009112 235
49 3300005365 Ga0070688_100223768 Ga0070688_1002237681 235
50 3300005456 Ga0070678_100021369 Ga0070678_1000213692 235
51 3300005459 Ga0068867_100001069 Ga0068867_10000106913 235
52 3300005530 Ga0070679_100071771 Ga0070679_1000717713 235
53 3300005539 Ga0068853_100005717 Ga0068853_1000057172 235
54 3300005539 Ga0068853_100183128 Ga0068853_1001831282 235
55 3300005548 Ga0070665_100000001 Ga0070665_100000001844 235
56 3300005548 Ga0070665_100000034 Ga0070665_100000034313 235
57 3300005563 Ga0068855_100014673 Ga0068855_1000146732 235
58 3300005577 Ga0068857_100024390 Ga0068857_1000243906 235
59 3300005614 Ga0068856_100052003 Ga0068856_1000520032 235
60 3300005616 Ga0068852_100001291 Ga0068852_1000012912 235
61 3300005616 Ga0068852_100046944 Ga0068852_1000469442 235
62 3300005616 Ga0068852_100716487 Ga0068852_1007164872 235
63 3300005842 Ga0068858_100146955 Ga0068858_1001469551 235
64 3300005843 Ga0068860_100000046 Ga0068860_100000046150 235
65 3300005843 Ga0068860_100000880 Ga0068860_10000088029 235
66 3300006195 Ga0075366_10010122 Ga0075366_100101222 235
67 3300006237 Ga0097621_100000182 Ga0097621_10000018225 235
68 3300006881 Ga0068865_100000178 Ga0068865_1000001784 235
69 3300009093 Ga0105240_10004401 Ga0105240_1000440118 235
70 3300009093 Ga0105240_10006272 Ga0105240_100062722 235
71 3300009093 Ga0105240_10009698 Ga0105240_100096989 235
72 3300009093 Ga0105240_10136365 Ga0105240_101363653 235
73 3300009093 Ga0105240_10201294 Ga0105240_102012942 235
74 3300009174 Ga0105241_10003066 Ga0105241_100030665 235
75 3300009174 Ga0105241_10060734 Ga0105241_100607343 235
76 3300009174 Ga0105241_10113654 Ga0105241_101136542 235
77 3300009176 Ga0105242_10007075 Ga0105242_100070752 235
78 3300009176 Ga0105242_10192806 Ga0105242_101928062 235
79 3300009545 Ga0105237_10001092 Ga0105237_1000109221 235
80 3300009545 Ga0105237_10001530 Ga0105237_1000153013 235
81 3300009545 Ga0105237_10008693 Ga0105237_100086933 235
82 3300009545 Ga0105237_10025300 Ga0105237_100253003 235
83 3300010375 Ga0105239_10000002 Ga0105239_1000000291 235
84 3300010375 Ga0105239_10001853 Ga0105239_1000185324 235
85 3300010375 Ga0105239_10019907 Ga0105239_100199073 235
86 3300010375 Ga0105239_10243723 Ga0105239_102437232 235
87 3300013104 Ga0157370_10002675 Ga0157370_100026757 235
88 3300013105 Ga0157369_10085191 Ga0157369_100851913 235
89 3300013296 Ga0157374_10001740 Ga0157374_1000174010 235
90 3300013296 Ga0157374_10002996 Ga0157374_100029966 235
91 3300013296 Ga0157374_10242467 Ga0157374_102424672 235
92 3300013296 Ga0157374_10333787 Ga0157374_103337871 235
93 3300013297 Ga0157378_10004615 Ga0157378_100046155 235
94 3300013297 Ga0157378_10247352 Ga0157378_102473522 235
95 3300013306 Ga0163162_10000116 Ga0163162_1000011629 235
96 3300013307 Ga0157372_10013390 Ga0157372_100133905 235
97 3300013308 Ga0157375_10100510 Ga0157375_101005103 235
98 3300013308 Ga0157375_10117203 Ga0157375_101172032 235
99 3300013308 Ga0157375_10169421 Ga0157375_101694213 235
100 3300014969 Ga0157376_10122264 Ga0157376_101222643 235
101 3300014969 Ga0157376_10265864 Ga0157376_102658642 235
102 3300017792 Ga0163161_10127988 Ga0163161_101279883 235
103 3300021361 Ga0213872_10002913 Ga0213872_100029139 235
104 3300025261 Ga0209233_1033963 Ga0209233_10339632 235
105 3300025272 Ga0209455_1000740 Ga0209455_100074011 235
106 3300025904 Ga0207647_10004200 Ga0207647_100042007 235
107 3300025907 Ga0207645_10000169 Ga0207645_1000016924 235
108 3300025909 Ga0207705_10000032 Ga0207705_10000032148 235
109 3300025911 Ga0207654_10047648 Ga0207654_100476482 235
110 3300025911 Ga0207654_10049514 Ga0207654_100495143 235
111 3300025911 Ga0207654_10069760 Ga0207654_100697602 235
112 3300025913 Ga0207695_10011839 Ga0207695_1001183911 235
113 3300025913 Ga0207695_10037714 Ga0207695_100377142 235
114 3300025913 Ga0207695_10087900 Ga0207695_100879001 235
115 3300025913 Ga0207695_10541792 Ga0207695_105417922 235
116 3300025914 Ga0207671_10003117 Ga0207671_100031174 235
117 3300025914 Ga0207671_10012221 Ga0207671_100122213 235
118 3300025914 Ga0207671_10068193 Ga0207671_100681932 235
119 3300025919 Ga0207657_10000746 Ga0207657_100007466 235
120 3300025921 Ga0207652_10054272 Ga0207652_100542723 235
121 3300025938 Ga0207704_10000114 Ga0207704_1000011430 235
122 3300025949 Ga0207667_10008503 Ga0207667_1000850310 235
123 3300025949 Ga0207667_10014689 Ga0207667_100146892 235
124 3300025949 Ga0207667_10084987 Ga0207667_100849874 235
125 3300025960 Ga0207651_10019043 Ga0207651_100190433 235
126 3300025986 Ga0207658_10326370 Ga0207658_103263702 235
127 3300026023 Ga0207677_10051472 Ga0207677_100514723 235
128 3300026023 Ga0207677_10215019 Ga0207677_102150192 235
129 3300026041 Ga0207639_10043248 Ga0207639_100432483 235
130 3300026067 Ga0207678_10444512 Ga0207678_104445121 235
131 3300026078 Ga0207702_10316079 Ga0207702_103160792 235
132 3300026089 Ga0207648_10000123 Ga0207648_1000012353 235
133 3300026116 Ga0207674_10017354 Ga0207674_100173546 235
134 3300026121 Ga0207683_10041746 Ga0207683_100417464 235
135 3300026142 Ga0207698_10333477 Ga0207698_103334772 235
136 3300026142 Ga0207698_10664854 Ga0207698_106648542 235
137 3300028379 Ga0268266_10000049 Ga0268266_10000049205 235
138 3300028379 Ga0268266_10000111 Ga0268266_10000111139 235
139 3300028381 Ga0268264_10000041 Ga0268264_10000041177 235
140 3300028381 Ga0268264_10001773 Ga0268264_100017732 235
141 3300028794 Ga0307515_10000778 Ga0307515_1000077855 235
142 3300028794 Ga0307515_10003061 Ga0307515_1000306115 235
143 3300031251 Ga0265327_10022045 Ga0265327_100220454 235
144 3300031251 Ga0265327_10081733 Ga0265327_100817332 235
145 3300031456 Ga0307513_10097374 Ga0307513_100973743 235
146 3300031507 Ga0307509_10030097 Ga0307509_100300973 235
147 3300031730 Ga0307516_10113061 Ga0307516_101130613 235
148 3300032004 Ga0307414_10041654 Ga0307414_100416541 235
149 3300033179 Ga0307507_10002030 Ga0307507_100020309 235
150 3300035115 Ga0373941_0044351 Ga0373941_0044351_103_810 235
151 3300037312 Ga0395899_0000001 Ga0395899_0000001_1748321_1749028 235
152 3300037312 Ga0395899_0000289 Ga0395899_0000289_54703_55410 235
153 3300037312 Ga0395899_0108249 Ga0395899_0108249_962_1669 235
154 3300037418 Ga0395900_0000095 Ga0395900_0000095_47574_48281 235
155 3300037418 Ga0395900_0000370 Ga0395900_0000370_35549_36256 235
156 3300037418 Ga0395900_0015778 Ga0395900_0015778_5099_5806 235
157 3300037466 Ga0395898_0421681 Ga0395898_0421681_279_986 235
158 3300037471 Ga0395905_0000411 Ga0395905_0000411_42817_43524 235
159 3300037471 Ga0395905_0000529 Ga0395905_0000529_16295_17002 235
160 3300038443 Ga0395901_0000580 Ga0395901_0000580_35319_36026 235
161 3300038443 Ga0395901_0019801 Ga0395901_0019801_520_1227 235
162 3300039447 Ga0436361_0269064 Ga0436361_0269064_12271_12978 235
163 3300045049 Ga0466959_0187106 Ga0466959_0187106_500_1207 235
164 3300046459 Ga0495629_0094523 Ga0495629_0094523_714_1421 235
165 3300046462 Ga0495651_0208030 Ga0495651_0208030_418_1125 235
166 3300046462 Ga0495651_0209230 Ga0495651_0209230_143_850 235
167 3300046492 Ga0495585_0000429 Ga0495585_0000429_39059_39766 235
168 3300046507 Ga0495606_0014460 Ga0495606_0014460_215_922 235
169 3300046507 Ga0495606_0019875 Ga0495606_0019875_3819_4526 235
170 3300046517 Ga0495630_0291985 Ga0495630_0291985_526_1233 235
171 3300046518 Ga0495631_0062798 Ga0495631_0062798_327_1037 235
172 3300046518 Ga0495631_0109944 Ga0495631_0109944_133_840 235
173 3300046523 Ga0495644_0001604 Ga0495644_0001604_2195_2905 235
174 3300046524 Ga0495648_0002802 Ga0495648_0002802_4391_5098 235
175 3300046524 Ga0495648_0011571 Ga0495648_0011571_394_1101 235
176 3300046557 Ga0495622_0097823 Ga0495622_0097823_46_753 235
177 3300046558 Ga0495633_0000035 Ga0495633_0000035_75243_75950 235
178 3300046616 Ga0495668_0000032 Ga0495668_0000032_124588_125295 235
179 3300046616 Ga0495668_0002089 Ga0495668_0002089_10479_11186 235
180 3300046660 Ga0495625_0000227 Ga0495625_0000227_19577_20284 235
181 3300046660 Ga0495625_0006872 Ga0495625_0006872_9150_9857 235
182 3300046660 Ga0495625_0416625 Ga0495625_0416625_94_801 235
183 3300046683 Ga0495658_0045597 Ga0495658_0045597_1400_2107 235
184 3300047323 Ga0495683_0023636 Ga0495683_0023636_1963_2670 235
185 3300047443 Ga0495687_000001 Ga0495687_000001_206325_207032 235
186 3300047443 Ga0495687_002557 Ga0495687_002557_6279_6986 235
187 3300047445 Ga0495677_0086579 Ga0495677_0086579_390_1100 235
188 3300047472 Ga0495686_0001013 Ga0495686_0001013_9929_10639 235
189 3300048089 Ga0495614_0050895 Ga0495614_0050895_112_819 235
190 3300049665 Ga0501227_003082 Ga0501227_003082_1499_2209 235
191 3300050493 nmdc:mga0k408_5136_c1 nmdc:mga0k408_5136_c1_2400_3107 235
192 3300053092 Ga0500583_0008004 Ga0500583_0008004_628_1335 235
193 3300053125 Ga0500618_000003 Ga0500618_000003_190522_191229 235
194 3300053130 Ga0500642_0009287 Ga0500642_0009287_797_1504 235
195 3300053139 Ga0500568_0019986 Ga0500568_0019986_316_1023 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

6

127

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zbo-assembly2.cif.gz_B a new family of proteins related to the heat-like repeat dna glycosylases with affinity for branched dna structures 0.9259 1 235
6xte-assembly1.cif.gz_A human karyopherin ranbp5 (isoform-1) 0.6594 43 195
1te4-assembly1.cif.gz_A solution structure of mth187. ontario centre for structural proteomics target mth0187_1_111; northeast structural genomics target tt740 0.6576 107 222
6fvy-assembly1.cif.gz_N 26s proteasome, s6 state 0.6315 50 196
7abg-assembly1.cif.gz_u human pre-bact-1 spliceosome 0.6104 51 228
ID Description Score Start End Superfamily
af_A4I110_693_1108_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7216 63 179 1.25.10.10
4l7mB00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6531 75 196 1.25.10.10
af_G5EF07_183_462_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6503 36 196 1.25.10.10
af_P40069_12_1113_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.65 33 196 1.20.1740.10
af_Q9XIE4_194_291_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6468 119 222 1.25.10.10
ID Description Score Start End GO Terms
AF-M6HXE9-F1-model_v4 DNA alkylation repair enzyme domain protein 0.9958 94 230
AF-M6RNR6-F1-model_v4 DNA alkylation repair enzyme domain protein 0.9938 94 235
AF-A0A2R7ZR02-F1-model_v4 deleted 0.9916 77 235
AF-A0A350KKA9-F1-model_v4 deleted 0.9896 34 235
AF-M7AEU6-F1-model_v4 DNA alkylation repair enzyme domain protein 0.9886 65 230

Feature Viewer

pLDDT pTM Quality
96.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map