F300421
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 195 | 138 | 195 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300038705|Ga0237819_01728|Ga0237819_01728_627_1751 |
| Length | 374 |
| Sequence | MMTMPSAAAFFFMVWSIPRKTMAHPAPFDAAPQHGPRPLPLFLELLRSETAASPDRAAAAIRGLKAYQHARRADRGPPMPVAARIGRACLRDYGGSGRPAVFVPSLINPPFVLDLAPDNSLMRWVASQGIRPLLLDWGAPLPEESGMGIAGHVETLLLPLLDALGEDAALVGYCLGGTMAVAAASLHPVAGLALIAAPWHFSGFPQGARNDMTSLWEGAKPTCAALGYLPMEILQTAFWKLDPGRTVGKYERFGMLDPESAEARAFVALEDWANAGAPLTLEAGREAFEDLFGMDLPGNGRWHVGGKAIDPAGLSCPLLDVVSLSDRIVPAASSTGLAERLELSAGHVGMVVGSRAKAQLWQPLAAWLSHLHNH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 92 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 96 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 97 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 98 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 99 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 100 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 101 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 102 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 103 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 115 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 116 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 117 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 118 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 119 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 120 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 121 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 123 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 126 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 127 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 130 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 132 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 134 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 135 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 136 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 137 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 138 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.18 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 76.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001893 | 3300000549 | Bacteria | 3028 |
| 2 | JGI24739J22299_10037566 | 3300001989 | Bacteria | 1631 |
| 3 | JGI24737J22298_10002157 | 3300001990 | Bacteria | 7020 |
| 4 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 5 | JGI25165J46597_1000445 | 3300003214 | Bacteria | 41632 |
| 6 | Ga0065707_10146250 | 3300005295 | Bacteria | 1710 |
| 7 | Ga0070676_10002939 | 3300005328 | Bacteria | 8793 |
| 8 | Ga0070670_100006395 | 3300005331 | Bacteria | 9973 |
| 9 | Ga0068869_100000096 | 3300005334 | Bacteria | 40808 |
| 10 | Ga0070666_10000068 | 3300005335 | Bacteria | 76194 |
| 11 | Ga0068868_100000149 | 3300005338 | Bacteria | 45719 |
| 12 | Ga0070660_100111347 | 3300005339 | Bacteria | 2178 |
| 13 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 14 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 15 | Ga0070674_100027647 | 3300005356 | Bacteria | 3718 |
| 16 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 17 | Ga0070659_100045028 | 3300005366 | Bacteria | 3456 |
| 18 | Ga0070667_100000273 | 3300005367 | Bacteria | 58596 |
| 19 | Ga0070705_100012154 | 3300005440 | Bacteria | 4368 |
| 20 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 21 | Ga0070665_100317532 | 3300005548 | Bacteria | 1562 |
| 22 | Ga0068859_100000805 | 3300005617 | Bacteria | 31840 |
| 23 | Ga0068859_100008172 | 3300005617 | Bacteria | 10616 |
| 24 | Ga0068864_100000858 | 3300005618 | Bacteria | 25592 |
| 25 | Ga0068864_100009279 | 3300005618 | Bacteria | 8114 |
| 26 | Ga0068866_10025496 | 3300005718 | Bacteria | 2780 |
| 27 | Ga0068861_100000046 | 3300005719 | Bacteria | 56414 |
| 28 | Ga0068861_100001451 | 3300005719 | Bacteria | 14997 |
| 29 | Ga0068863_100001370 | 3300005841 | Bacteria | 24218 |
| 30 | Ga0068863_100003599 | 3300005841 | Bacteria | 15295 |
| 31 | Ga0068858_100000439 | 3300005842 | Bacteria | 43456 |
| 32 | Ga0068858_100012215 | 3300005842 | Bacteria | 8098 |
| 33 | Ga0068860_100000269 | 3300005843 | Bacteria | 76230 |
| 34 | Ga0068860_100003894 | 3300005843 | Bacteria | 15335 |
| 35 | Ga0068862_100000877 | 3300005844 | Bacteria | 29301 |
| 36 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 37 | Ga0097620_100000805 | 3300006931 | Bacteria | 31840 |
| 38 | Ga0097620_100008172 | 3300006931 | Bacteria | 10616 |
| 39 | Ga0105251_10036551 | 3300009011 | Bacteria | 2416 |
| 40 | Ga0105240_10014288 | 3300009093 | Bacteria | 10843 |
| 41 | Ga0105240_10026739 | 3300009093 | Bacteria | 7568 |
| 42 | Ga0105240_10062518 | 3300009093 | Bacteria | 4635 |
| 43 | Ga0105245_10000113 | 3300009098 | Bacteria | 78545 |
| 44 | Ga0105245_10001504 | 3300009098 | Bacteria | 21087 |
| 45 | Ga0105247_10000758 | 3300009101 | Bacteria | 24920 |
| 46 | Ga0105247_10005724 | 3300009101 | Bacteria | 7778 |
| 47 | Ga0105243_10000373 | 3300009148 | Bacteria | 48115 |
| 48 | Ga0105243_10091178 | 3300009148 | Bacteria | 2509 |
| 49 | Ga0105242_10000448 | 3300009176 | Bacteria | 32719 |
| 50 | Ga0105248_10027144 | 3300009177 | Bacteria | 6370 |
| 51 | Ga0105248_10035610 | 3300009177 | Bacteria | 5569 |
| 52 | Ga0105237_10024064 | 3300009545 | Bacteria | 6231 |
| 53 | Ga0105238_10041202 | 3300009551 | Bacteria | 4678 |
| 54 | Ga0105249_10000574 | 3300009553 | Bacteria | 33721 |
| 55 | Ga0105249_10004128 | 3300009553 | Bacteria | 12544 |
| 56 | Ga0105249_10413906 | 3300009553 | Bacteria | 1381 |
| 57 | Ga0105239_10000694 | 3300010375 | Bacteria | 47928 |
| 58 | Ga0105246_10002472 | 3300011119 | Bacteria | 11164 |
| 59 | Ga0157373_10023039 | 3300013100 | Bacteria | 4516 |
| 60 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 61 | Ga0157369_10296755 | 3300013105 | Bacteria | 1682 |
| 62 | Ga0157374_10001004 | 3300013296 | Bacteria | 24430 |
| 63 | Ga0157378_10000902 | 3300013297 | Bacteria | 27366 |
| 64 | Ga0163162_10004913 | 3300013306 | Bacteria | 12887 |
| 65 | Ga0163162_10016649 | 3300013306 | Bacteria | 7186 |
| 66 | Ga0163162_10210202 | 3300013306 | Bacteria | 2075 |
| 67 | Ga0157372_10007993 | 3300013307 | Bacteria | 11249 |
| 68 | Ga0157372_10850655 | 3300013307 | Bacteria | 1059 |
| 69 | Ga0163163_10055016 | 3300014325 | Bacteria | 3933 |
| 70 | Ga0163163_10104198 | 3300014325 | Bacteria | 2862 |
| 71 | Ga0157379_10006792 | 3300014968 | Bacteria | 9891 |
| 72 | Ga0157379_10035672 | 3300014968 | Bacteria | 4434 |
| 73 | Ga0157376_10000089 | 3300014969 | Bacteria | 69351 |
| 74 | Ga0209026_1001328 | 3300025250 | Bacteria | 11105 |
| 75 | Ga0209148_1000996 | 3300025254 | Bacteria | 18233 |
| 76 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 77 | Ga0209233_1000313 | 3300025261 | Bacteria | 54941 |
| 78 | Ga0207697_10003329 | 3300025315 | Bacteria | 7999 |
| 79 | Ga0207697_10110020 | 3300025315 | Bacteria | 1179 |
| 80 | Ga0207710_10006122 | 3300025900 | Bacteria | 5152 |
| 81 | Ga0207680_10000341 | 3300025903 | Bacteria | 22237 |
| 82 | Ga0207647_10000195 | 3300025904 | Bacteria | 49520 |
| 83 | Ga0207647_10037703 | 3300025904 | Bacteria | 3063 |
| 84 | Ga0207645_10008876 | 3300025907 | Bacteria | 6980 |
| 85 | Ga0207705_10000802 | 3300025909 | Bacteria | 25817 |
| 86 | Ga0207695_10001501 | 3300025913 | Bacteria | 38827 |
| 87 | Ga0207695_10020680 | 3300025913 | Bacteria | 7531 |
| 88 | Ga0207695_10067705 | 3300025913 | Bacteria | 3661 |
| 89 | Ga0207671_10004851 | 3300025914 | Bacteria | 12657 |
| 90 | Ga0207657_10082528 | 3300025919 | Bacteria | 2698 |
| 91 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 92 | Ga0207694_10036612 | 3300025924 | Bacteria | 3767 |
| 93 | Ga0207687_10001599 | 3300025927 | Bacteria | 15593 |
| 94 | Ga0207687_10004766 | 3300025927 | Bacteria | 9021 |
| 95 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 96 | Ga0207644_10016139 | 3300025931 | Bacteria | 5024 |
| 97 | Ga0207706_10015334 | 3300025933 | Bacteria | 6925 |
| 98 | Ga0207686_10000412 | 3300025934 | Bacteria | 29644 |
| 99 | Ga0207709_10000173 | 3300025935 | Bacteria | 86350 |
| 100 | Ga0207709_10085722 | 3300025935 | Bacteria | 2043 |
| 101 | Ga0207669_10009473 | 3300025937 | Bacteria | 4642 |
| 102 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 103 | Ga0207711_10020390 | 3300025941 | Bacteria | 5527 |
| 104 | Ga0207711_10217881 | 3300025941 | Bacteria | 1745 |
| 105 | Ga0207689_10001595 | 3300025942 | Bacteria | 21464 |
| 106 | Ga0207667_10002169 | 3300025949 | Bacteria | 24595 |
| 107 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 108 | Ga0207712_10000476 | 3300025961 | Bacteria | 33733 |
| 109 | Ga0207668_10005394 | 3300025972 | Bacteria | 7527 |
| 110 | Ga0207640_10055845 | 3300025981 | Bacteria | 2589 |
| 111 | Ga0207658_10002605 | 3300025986 | Bacteria | 13093 |
| 112 | Ga0207677_10000030 | 3300026023 | Bacteria | 120692 |
| 113 | Ga0207703_10001250 | 3300026035 | Bacteria | 23825 |
| 114 | Ga0207703_10002089 | 3300026035 | Bacteria | 17556 |
| 115 | Ga0207641_10002987 | 3300026088 | Bacteria | 15303 |
| 116 | Ga0207641_10004855 | 3300026088 | Bacteria | 11569 |
| 117 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 118 | Ga0207676_10000504 | 3300026095 | Bacteria | 32958 |
| 119 | Ga0207676_10004372 | 3300026095 | Bacteria | 9991 |
| 120 | Ga0207675_100000122 | 3300026118 | Bacteria | 63834 |
| 121 | Ga0207675_100000822 | 3300026118 | Bacteria | 30908 |
| 122 | Ga0268266_10025911 | 3300028379 | Bacteria | 4989 |
| 123 | Ga0268266_10204139 | 3300028379 | Bacteria | 1810 |
| 124 | Ga0268265_10000064 | 3300028380 | Bacteria | 144164 |
| 125 | Ga0268265_10000424 | 3300028380 | Bacteria | 45348 |
| 126 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 127 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 128 | Ga0268264_10001182 | 3300028381 | Bacteria | 25302 |
| 129 | Ga0307513_10027618 | 3300031456 | Bacteria | 6511 |
| 130 | Ga0307508_10002479 | 3300031616 | Bacteria | 19477 |
| 131 | Ga0307410_10127635 | 3300031852 | Bacteria | 1864 |
| 132 | Ga0307412_10009421 | 3300031911 | Bacteria | 5603 |
| 133 | Ga0395899_0003766 | 3300037312 | Bacteria | 11972 |
| 134 | Ga0395900_0067300 | 3300037418 | Bacteria | 3680 |
| 135 | Ga0237819_01728 | 3300038705 | Bacteria | 5201 |
| 136 | Ga0237816_02751 | 3300039145 | Bacteria | 1326 |
| 137 | Ga0451804_0366730 | 3300041463 | Bacteria | 1384 |
| 138 | Ga0451853_3730709 | 3300041512 | Bacteria | 2752 |
| 139 | Ga0439448_0000793 | 3300042005 | Bacteria | 7679 |
| 140 | Ga0466970_0163596 | 3300044765 | Bacteria | 1231 |
| 141 | Ga0466957_0139760 | 3300044842 | Bacteria | 1559 |
| 142 | Ga0466958_0363264 | 3300045836 | Bacteria | 933 |
| 143 | Ga0495638_0001199 | 3300046460 | Bacteria | 24756 |
| 144 | Ga0495638_0059356 | 3300046460 | Bacteria | 2369 |
| 145 | Ga0495585_0040665 | 3300046492 | Bacteria | 2610 |
| 146 | Ga0495583_0000656 | 3300046506 | Bacteria | 45452 |
| 147 | Ga0495606_0009471 | 3300046507 | Bacteria | 8238 |
| 148 | Ga0495666_0078927 | 3300046526 | Bacteria | 1559 |
| 149 | Ga0495652_0205624 | 3300046529 | Bacteria | 1491 |
| 150 | Ga0495625_0091539 | 3300046660 | Bacteria | 2102 |
| 151 | Ga0495671_0101516 | 3300046692 | Bacteria | 1406 |
| 152 | Ga0495686_0000201 | 3300047472 | Bacteria | 110982 |
| 153 | Ga0495686_0000733 | 3300047472 | Bacteria | 43762 |
| 154 | Ga0495686_0002106 | 3300047472 | Bacteria | 19503 |
| 155 | Ga0495686_0002673 | 3300047472 | Bacteria | 16411 |
| 156 | Ga0495686_0013666 | 3300047472 | Bacteria | 5626 |
| 157 | Ga0495686_0146338 | 3300047472 | Bacteria | 1390 |
| 158 | Ga0496102_0000100 | 3300048905 | Bacteria | 123531 |
| 159 | Ga0496102_0296636 | 3300048905 | Bacteria | 1524 |
| 160 | Ga0496103_0000070 | 3300048906 | Bacteria | 121077 |
| 161 | Ga0496116_0002579 | 3300048919 | Bacteria | 18871 |
| 162 | Ga0496117_0000194 | 3300048920 | Bacteria | 123531 |
| 163 | Ga0496117_0025730 | 3300048920 | Bacteria | 4620 |
| 164 | Ga0496118_0000146 | 3300048921 | Bacteria | 123531 |
| 165 | Ga0496118_0006952 | 3300048921 | Bacteria | 12229 |
| 166 | Ga0496118_0019582 | 3300048921 | Bacteria | 6042 |
| 167 | Ga0496118_0040617 | 3300048921 | Bacteria | 3696 |
| 168 | Ga0496119_0012504 | 3300048922 | Bacteria | 6887 |
| 169 | Ga0496120_0053658 | 3300048923 | Bacteria | 2289 |
| 170 | Ga0496121_0003464 | 3300048924 | Bacteria | 22491 |
| 171 | Ga0496121_0008737 | 3300048924 | Bacteria | 11819 |
| 172 | Ga0496121_0011319 | 3300048924 | Bacteria | 9928 |
| 173 | Ga0496121_0028419 | 3300048924 | Bacteria | 5205 |
| 174 | Ga0496122_0002977 | 3300048925 | Bacteria | 23060 |
| 175 | Ga0496122_0029713 | 3300048925 | Bacteria | 4600 |
| 176 | Ga0496123_0016942 | 3300048926 | Bacteria | 5886 |
| 177 | Ga0496123_0028104 | 3300048926 | Bacteria | 4172 |
| 178 | Ga0496124_0000185 | 3300048927 | Bacteria | 123531 |
| 179 | Ga0496124_0014016 | 3300048927 | Bacteria | 7777 |
| 180 | Ga0496125_0035237 | 3300048928 | Bacteria | 4396 |
| 181 | Ga0496126_0015753 | 3300048929 | Bacteria | 7597 |
| 182 | Ga0495682_0016616 | 3300049460 | Bacteria | 2785 |
| 183 | Ga0501033_0098685 | 3300049570 | Bacteria | 2133 |
| 184 | Ga0501257_000171 | 3300049686 | Bacteria | 13114 |
| 185 | Ga0501044_0090826 | 3300049823 | Bacteria | 3081 |
| 186 | Ga0501044_0111222 | 3300049823 | Bacteria | 2747 |
| 187 | Ga0500643_001971 | 3300053087 | Bacteria | 11122 |
| 188 | Ga0500643_008514 | 3300053087 | Bacteria | 4025 |
| 189 | Ga0500555_001152 | 3300053103 | Bacteria | 8705 |
| 190 | Ga0500562_019227 | 3300053108 | Bacteria | 1766 |
| 191 | Ga0500592_000065 | 3300053116 | Bacteria | 28864 |
| 192 | Ga0500559_0010564 | 3300053136 | Bacteria | 3961 |
| 193 | Ga0500577_0027344 | 3300053142 | Bacteria | 1952 |
| 194 | Ga0500616_0010224 | 3300053153 | Bacteria | 5627 |
| 195 | Ga0500627_0000086 | 3300053158 | Bacteria | 31214 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0067300 | Ga0395900_0067300_2833_3654 | 273 |
| 2 | 3300005331 | Ga0070670_100006395 | Ga0070670_1000063958 | 292 |
| 3 | 3300005335 | Ga0070666_10000068 | Ga0070666_1000006858 | 292 |
| 4 | 3300005353 | Ga0070669_100000018 | Ga0070669_10000001875 | 292 |
| 5 | 3300005355 | Ga0070671_100000011 | Ga0070671_100000011121 | 292 |
| 6 | 3300005440 | Ga0070705_100012154 | Ga0070705_1000121543 | 292 |
| 7 | 3300005617 | Ga0068859_100000805 | Ga0068859_1000008053 | 292 |
| 8 | 3300005618 | Ga0068864_100009279 | Ga0068864_1000092795 | 292 |
| 9 | 3300005719 | Ga0068861_100001451 | Ga0068861_1000014519 | 292 |
| 10 | 3300006931 | Ga0097620_100000805 | Ga0097620_1000008053 | 292 |
| 11 | 3300025315 | Ga0207697_10003329 | Ga0207697_100033294 | 292 |
| 12 | 3300025903 | Ga0207680_10000341 | Ga0207680_100003418 | 292 |
| 13 | 3300025923 | Ga0207681_10000008 | Ga0207681_10000008302 | 292 |
| 14 | 3300025931 | Ga0207644_10000006 | Ga0207644_10000006293 | 292 |
| 15 | 3300025972 | Ga0207668_10005394 | Ga0207668_100053942 | 292 |
| 16 | 3300025986 | Ga0207658_10002605 | Ga0207658_100026053 | 292 |
| 17 | 3300026095 | Ga0207676_10004372 | Ga0207676_100043723 | 292 |
| 18 | 3300026118 | Ga0207675_100000822 | Ga0207675_1000008223 | 292 |
| 19 | 3300028379 | Ga0268266_10025911 | Ga0268266_100259113 | 292 |
| 20 | 3300028380 | Ga0268265_10000064 | Ga0268265_10000064116 | 292 |
| 21 | 3300028381 | Ga0268264_10000010 | Ga0268264_1000001086 | 292 |
| 22 | 3300025315 | Ga0207697_10110020 | Ga0207697_101100202 | 295 |
| 23 | 3300045836 | Ga0466958_0363264 | Ga0466958_0363264_29_916 | 295 |
| 24 | 3300053142 | Ga0500577_0027344 | Ga0500577_0027344_1024_1914 | 296 |
| 25 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043125 | 297 |
| 26 | 3300005339 | Ga0070660_100111347 | Ga0070660_1001113472 | 297 |
| 27 | 3300009093 | Ga0105240_10026739 | Ga0105240_100267394 | 297 |
| 28 | 3300013307 | Ga0157372_10850655 | Ga0157372_108506551 | 297 |
| 29 | 3300025250 | Ga0209026_1001328 | Ga0209026_10013284 | 297 |
| 30 | 3300025261 | Ga0209233_1000079 | Ga0209233_1000079144 | 297 |
| 31 | 3300025913 | Ga0207695_10067705 | Ga0207695_100677053 | 302 |
| 32 | 3300025904 | Ga0207647_10037703 | Ga0207647_100377032 | 306 |
| 33 | 3300048924 | Ga0496121_0008737 | Ga0496121_0008737_9937_10956 | 308 |
| 34 | 3300049686 | Ga0501257_000171 | Ga0501257_000171_6069_7190 | 308 |
| 35 | 3300025914 | Ga0207671_10004851 | Ga0207671_100048513 | 312 |
| 36 | 3300025981 | Ga0207640_10055845 | Ga0207640_100558452 | 312 |
| 37 | 3300009545 | Ga0105237_10024064 | Ga0105237_100240647 | 316 |
| 38 | 3300053153 | Ga0500616_0010224 | Ga0500616_0010224_3173_4165 | 321 |
| 39 | 3300009093 | Ga0105240_10014288 | Ga0105240_100142889 | 322 |
| 40 | 3300010375 | Ga0105239_10000694 | Ga0105239_1000069438 | 322 |
| 41 | 3300025913 | Ga0207695_10001501 | Ga0207695_1000150141 | 322 |
| 42 | 3300048924 | Ga0496121_0003464 | Ga0496121_0003464_10580_11581 | 322 |
| 43 | 3300048929 | Ga0496126_0015753 | Ga0496126_0015753_4515_5516 | 322 |
| 44 | 3300053136 | Ga0500559_0010564 | Ga0500559_0010564_656_1657 | 324 |
| 45 | 3300044765 | Ga0466970_0163596 | Ga0466970_0163596_70_1065 | 325 |
| 46 | 3300047472 | Ga0495686_0002106 | Ga0495686_0002106_14059_15045 | 328 |
| 47 | 3300048921 | Ga0496118_0040617 | Ga0496118_0040617_1325_2323 | 329 |
| 48 | 3300005367 | Ga0070667_100000273 | Ga0070667_10000027339 | 330 |
| 49 | 3300005618 | Ga0068864_100000858 | Ga0068864_1000008589 | 330 |
| 50 | 3300005841 | Ga0068863_100001370 | Ga0068863_10000137017 | 330 |
| 51 | 3300005842 | Ga0068858_100012215 | Ga0068858_1000122152 | 330 |
| 52 | 3300005843 | Ga0068860_100000269 | Ga0068860_10000026931 | 330 |
| 53 | 3300009093 | Ga0105240_10062518 | Ga0105240_100625185 | 330 |
| 54 | 3300009177 | Ga0105248_10027144 | Ga0105248_100271444 | 330 |
| 55 | 3300009553 | Ga0105249_10413906 | Ga0105249_104139062 | 330 |
| 56 | 3300025913 | Ga0207695_10020680 | Ga0207695_100206808 | 330 |
| 57 | 3300025941 | Ga0207711_10217881 | Ga0207711_102178812 | 330 |
| 58 | 3300026035 | Ga0207703_10001250 | Ga0207703_1000125023 | 330 |
| 59 | 3300026088 | Ga0207641_10004855 | Ga0207641_100048555 | 330 |
| 60 | 3300026095 | Ga0207676_10000504 | Ga0207676_100005049 | 330 |
| 61 | 3300028381 | Ga0268264_10000184 | Ga0268264_1000018498 | 330 |
| 62 | 3300031456 | Ga0307513_10027618 | Ga0307513_100276182 | 330 |
| 63 | 3300046506 | Ga0495583_0000656 | Ga0495583_0000656_7881_8885 | 330 |
| 64 | 3300046692 | Ga0495671_0101516 | Ga0495671_0101516_239_1243 | 330 |
| 65 | 3300047472 | Ga0495686_0000201 | Ga0495686_0000201_69011_70003 | 330 |
| 66 | 3300047472 | Ga0495686_0000733 | Ga0495686_0000733_22829_23872 | 330 |
| 67 | 3300047472 | Ga0495686_0002673 | Ga0495686_0002673_6183_7175 | 330 |
| 68 | 3300048925 | Ga0496122_0002977 | Ga0496122_0002977_16697_17692 | 330 |
| 69 | 3300048926 | Ga0496123_0016942 | Ga0496123_0016942_4565_5560 | 330 |
| 70 | 3300048927 | Ga0496124_0014016 | Ga0496124_0014016_2564_3559 | 330 |
| 71 | 3300049460 | Ga0495682_0016616 | Ga0495682_0016616_1672_2676 | 330 |
| 72 | 3300049570 | Ga0501033_0098685 | Ga0501033_0098685_224_1216 | 330 |
| 73 | 3300049823 | Ga0501044_0111222 | Ga0501044_0111222_304_1296 | 330 |
| 74 | 3300053103 | Ga0500555_001152 | Ga0500555_001152_6955_7959 | 330 |
| 75 | 3300001989 | JGI24739J22299_10037566 | JGI24739J22299_100375662 | 331 |
| 76 | 3300001990 | JGI24737J22298_10002157 | JGI24737J22298_100021572 | 331 |
| 77 | 3300005328 | Ga0070676_10002939 | Ga0070676_100029393 | 331 |
| 78 | 3300005334 | Ga0068869_100000096 | Ga0068869_10000009621 | 331 |
| 79 | 3300005338 | Ga0068868_100000149 | Ga0068868_10000014928 | 331 |
| 80 | 3300005356 | Ga0070674_100027647 | Ga0070674_1000276472 | 331 |
| 81 | 3300005364 | Ga0070673_100000006 | Ga0070673_10000000690 | 331 |
| 82 | 3300005366 | Ga0070659_100045028 | Ga0070659_1000450283 | 331 |
| 83 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001335 | 331 |
| 84 | 3300005548 | Ga0070665_100317532 | Ga0070665_1003175322 | 331 |
| 85 | 3300005718 | Ga0068866_10025496 | Ga0068866_100254963 | 331 |
| 86 | 3300005842 | Ga0068858_100000439 | Ga0068858_10000043940 | 331 |
| 87 | 3300006881 | Ga0068865_100000003 | Ga0068865_10000000374 | 331 |
| 88 | 3300009098 | Ga0105245_10000113 | Ga0105245_1000011318 | 331 |
| 89 | 3300009101 | Ga0105247_10000758 | Ga0105247_1000075816 | 331 |
| 90 | 3300009148 | Ga0105243_10000373 | Ga0105243_1000037311 | 331 |
| 91 | 3300009176 | Ga0105242_10000448 | Ga0105242_1000044810 | 331 |
| 92 | 3300009551 | Ga0105238_10041202 | Ga0105238_100412022 | 331 |
| 93 | 3300009553 | Ga0105249_10004128 | Ga0105249_100041285 | 331 |
| 94 | 3300011119 | Ga0105246_10002472 | Ga0105246_100024722 | 331 |
| 95 | 3300013100 | Ga0157373_10023039 | Ga0157373_100230393 | 331 |
| 96 | 3300013104 | Ga0157370_10000069 | Ga0157370_1000006912 | 331 |
| 97 | 3300013105 | Ga0157369_10296755 | Ga0157369_102967552 | 331 |
| 98 | 3300013296 | Ga0157374_10001004 | Ga0157374_1000100419 | 331 |
| 99 | 3300013297 | Ga0157378_10000902 | Ga0157378_1000090211 | 331 |
| 100 | 3300013306 | Ga0163162_10004913 | Ga0163162_100049131 | 331 |
| 101 | 3300013306 | Ga0163162_10210202 | Ga0163162_102102022 | 331 |
| 102 | 3300013307 | Ga0157372_10007993 | Ga0157372_100079937 | 331 |
| 103 | 3300014969 | Ga0157376_10000089 | Ga0157376_1000008919 | 331 |
| 104 | 3300025254 | Ga0209148_1000996 | Ga0209148_10009969 | 331 |
| 105 | 3300025904 | Ga0207647_10000195 | Ga0207647_100001956 | 331 |
| 106 | 3300025907 | Ga0207645_10008876 | Ga0207645_100088765 | 331 |
| 107 | 3300025909 | Ga0207705_10000802 | Ga0207705_1000080214 | 331 |
| 108 | 3300025919 | Ga0207657_10082528 | Ga0207657_100825282 | 331 |
| 109 | 3300025924 | Ga0207694_10036612 | Ga0207694_100366122 | 331 |
| 110 | 3300025927 | Ga0207687_10001599 | Ga0207687_100015998 | 331 |
| 111 | 3300025931 | Ga0207644_10016139 | Ga0207644_100161393 | 331 |
| 112 | 3300025933 | Ga0207706_10015334 | Ga0207706_100153342 | 331 |
| 113 | 3300025934 | Ga0207686_10000412 | Ga0207686_100004129 | 331 |
| 114 | 3300025935 | Ga0207709_10000173 | Ga0207709_1000017315 | 331 |
| 115 | 3300025937 | Ga0207669_10009473 | Ga0207669_100094732 | 331 |
| 116 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001445 | 331 |
| 117 | 3300025942 | Ga0207689_10001595 | Ga0207689_100015953 | 331 |
| 118 | 3300025949 | Ga0207667_10002169 | Ga0207667_1000216912 | 331 |
| 119 | 3300025960 | Ga0207651_10000002 | Ga0207651_10000002114 | 331 |
| 120 | 3300026023 | Ga0207677_10000030 | Ga0207677_1000003023 | 331 |
| 121 | 3300026035 | Ga0207703_10002089 | Ga0207703_100020897 | 331 |
| 122 | 3300026089 | Ga0207648_10000001 | Ga0207648_10000001114 | 331 |
| 123 | 3300028379 | Ga0268266_10204139 | Ga0268266_102041392 | 331 |
| 124 | 3300031616 | Ga0307508_10002479 | Ga0307508_100024792 | 331 |
| 125 | 3300037312 | Ga0395899_0003766 | Ga0395899_0003766_978_1973 | 331 |
| 126 | 3300041463 | Ga0451804_0366730 | Ga0451804_0366730_206_1201 | 331 |
| 127 | 3300041512 | Ga0451853_3730709 | Ga0451853_3730709_1117_2112 | 331 |
| 128 | 3300042005 | Ga0439448_0000793 | Ga0439448_0000793_5918_6913 | 331 |
| 129 | 3300044842 | Ga0466957_0139760 | Ga0466957_0139760_132_1127 | 331 |
| 130 | 3300046460 | Ga0495638_0001199 | Ga0495638_0001199_2400_3404 | 331 |
| 131 | 3300046492 | Ga0495585_0040665 | Ga0495585_0040665_1516_2520 | 331 |
| 132 | 3300046526 | Ga0495666_0078927 | Ga0495666_0078927_438_1490 | 331 |
| 133 | 3300048920 | Ga0496117_0025730 | Ga0496117_0025730_1017_2012 | 331 |
| 134 | 3300048921 | Ga0496118_0006952 | Ga0496118_0006952_7020_8015 | 331 |
| 135 | 3300048921 | Ga0496118_0019582 | Ga0496118_0019582_859_1854 | 331 |
| 136 | 3300048924 | Ga0496121_0011319 | Ga0496121_0011319_264_1259 | 331 |
| 137 | 3300048924 | Ga0496121_0028419 | Ga0496121_0028419_1132_2127 | 331 |
| 138 | 3300048925 | Ga0496122_0029713 | Ga0496122_0029713_2448_3443 | 331 |
| 139 | 3300048926 | Ga0496123_0028104 | Ga0496123_0028104_448_1443 | 331 |
| 140 | 3300048928 | Ga0496125_0035237 | Ga0496125_0035237_90_1085 | 331 |
| 141 | 3300049823 | Ga0501044_0090826 | Ga0501044_0090826_914_1972 | 331 |
| 142 | 3300053108 | Ga0500562_019227 | Ga0500562_019227_495_1499 | 331 |
| 143 | 3300005617 | Ga0068859_100008172 | Ga0068859_1000081727 | 332 |
| 144 | 3300005719 | Ga0068861_100000046 | Ga0068861_1000000465 | 332 |
| 145 | 3300006931 | Ga0097620_100008172 | Ga0097620_1000081727 | 332 |
| 146 | 3300009177 | Ga0105248_10035610 | Ga0105248_100356106 | 332 |
| 147 | 3300014968 | Ga0157379_10035672 | Ga0157379_100356725 | 332 |
| 148 | 3300025941 | Ga0207711_10020390 | Ga0207711_100203906 | 332 |
| 149 | 3300026118 | Ga0207675_100000122 | Ga0207675_1000001225 | 332 |
| 150 | 3300046660 | Ga0495625_0091539 | Ga0495625_0091539_62_1066 | 332 |
| 151 | 3300009011 | Ga0105251_10036551 | Ga0105251_100365512 | 333 |
| 152 | 3300014325 | Ga0163163_10055016 | Ga0163163_100550162 | 333 |
| 153 | 3300014968 | Ga0157379_10006792 | Ga0157379_100067923 | 333 |
| 154 | 3300053087 | Ga0500643_001971 | Ga0500643_001971_2381_3466 | 333 |
| 155 | 3300053087 | Ga0500643_008514 | Ga0500643_008514_2490_3548 | 333 |
| 156 | 3300005295 | Ga0065707_10146250 | Ga0065707_101462501 | 334 |
| 157 | 3300005841 | Ga0068863_100003599 | Ga0068863_1000035995 | 334 |
| 158 | 3300005843 | Ga0068860_100003894 | Ga0068860_1000038949 | 334 |
| 159 | 3300005844 | Ga0068862_100000877 | Ga0068862_10000087728 | 334 |
| 160 | 3300009101 | Ga0105247_10005724 | Ga0105247_100057243 | 334 |
| 161 | 3300009553 | Ga0105249_10000574 | Ga0105249_1000057430 | 334 |
| 162 | 3300013306 | Ga0163162_10016649 | Ga0163162_100166493 | 334 |
| 163 | 3300014325 | Ga0163163_10104198 | Ga0163163_101041982 | 334 |
| 164 | 3300025900 | Ga0207710_10006122 | Ga0207710_100061224 | 334 |
| 165 | 3300025961 | Ga0207712_10000476 | Ga0207712_100004767 | 334 |
| 166 | 3300026088 | Ga0207641_10002987 | Ga0207641_100029875 | 334 |
| 167 | 3300028380 | Ga0268265_10000424 | Ga0268265_1000042446 | 334 |
| 168 | 3300028381 | Ga0268264_10001182 | Ga0268264_1000118221 | 334 |
| 169 | 3300031852 | Ga0307410_10127635 | Ga0307410_101276352 | 334 |
| 170 | 3300031911 | Ga0307412_10009421 | Ga0307412_100094213 | 334 |
| 171 | 3300038705 | Ga0237819_01728 | Ga0237819_01728_627_1751 | 334 |
| 172 | 3300039145 | Ga0237816_02751 | Ga0237816_02751_97_1101 | 334 |
| 173 | 3300046507 | Ga0495606_0009471 | Ga0495606_0009471_6153_7157 | 334 |
| 174 | 3300048905 | Ga0496102_0000100 | Ga0496102_0000100_105782_106789 | 334 |
| 175 | 3300048905 | Ga0496102_0296636 | Ga0496102_0296636_376_1407 | 334 |
| 176 | 3300048906 | Ga0496103_0000070 | Ga0496103_0000070_105763_106770 | 334 |
| 177 | 3300048919 | Ga0496116_0002579 | Ga0496116_0002579_3645_4652 | 334 |
| 178 | 3300048920 | Ga0496117_0000194 | Ga0496117_0000194_105782_106789 | 334 |
| 179 | 3300048921 | Ga0496118_0000146 | Ga0496118_0000146_105782_106789 | 334 |
| 180 | 3300048922 | Ga0496119_0012504 | Ga0496119_0012504_3715_4722 | 334 |
| 181 | 3300048923 | Ga0496120_0053658 | Ga0496120_0053658_1179_2186 | 334 |
| 182 | 3300048927 | Ga0496124_0000185 | Ga0496124_0000185_16743_17750 | 334 |
| 183 | 3300053116 | Ga0500592_000065 | Ga0500592_000065_9063_10187 | 334 |
| 184 | 3300053158 | Ga0500627_0000086 | Ga0500627_0000086_18604_19728 | 334 |
| 185 | 3300000549 | LJQas_1001893 | LJQas_10018933 | 335 |
| 186 | 3300003214 | JGI25165J46597_1000445 | JGI25165J46597_100044516 | 335 |
| 187 | 3300009098 | Ga0105245_10001504 | Ga0105245_1000150417 | 335 |
| 188 | 3300009148 | Ga0105243_10091178 | Ga0105243_100911782 | 335 |
| 189 | 3300025261 | Ga0209233_1000313 | Ga0209233_100031327 | 335 |
| 190 | 3300025927 | Ga0207687_10004766 | Ga0207687_100047667 | 335 |
| 191 | 3300025935 | Ga0207709_10085722 | Ga0207709_100857221 | 335 |
| 192 | 3300046460 | Ga0495638_0059356 | Ga0495638_0059356_118_1242 | 335 |
| 193 | 3300046529 | Ga0495652_0205624 | Ga0495652_0205624_40_1056 | 335 |
| 194 | 3300047472 | Ga0495686_0013666 | Ga0495686_0013666_3620_4744 | 335 |
| 195 | 3300047472 | Ga0495686_0146338 | Ga0495686_0146338_224_1240 | 335 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k3c-assembly1.cif.gz_A | crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. | 0.7601 | 31 | 329 |
| 6k5e-assembly2.cif.gz_F | crystal structure of bioh from klebsiella pneumonia | 0.7461 | 48 | 331 |
| 5xav-assembly1.cif.gz_A | structure of phac from chromobacterium sp. usm2 | 0.7455 | 31 | 334 |
| 6k5e-assembly2.cif.gz_F | crystal structure of bioh from klebsiella pneumonia | 0.7406 | 48 | 331 |
| 2qjw-assembly2.cif.gz_D | crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution | 0.736 | 57 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33185_49_361_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8463 | 48 | 329 | 3.40.50.1820 |
| af_A0A1D6J508_11_202_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7903 | 56 | 157 | 3.40.50.1820 |
| af_B7Z150_335_565_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7689 | 125 | 158 | 3.40.50.1820 |
| af_O33185_49_361_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7667 | 48 | 329 | 3.40.50.1820 |
| af_A0A1P8BAJ1_50_318_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7445 | 125 | 159 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A031JDW0-F1-model_v4 | deleted | 0.9909 | 52 | 329 |
|
| AF-A0A4Q3AQ98-F1-model_v4 | Alpha/beta fold hydrolase | 0.9849 | 110 | 335 |
|
| AF-A0A1G3K1Y6-F1-model_v4 | Poly-beta-hydroxybutyrate polymerase | 0.9825 | 18 | 329 |
|
| AF-A0A5E7YHX3-F1-model_v4 | Poly-beta-hydroxybutyrate polymerase (EC 2.3.1.-) | 0.982 | 38 | 329 |
GO:0016746
|
| AF-A0A1E3LSF4-F1-model_v4 | Poly-beta-hydroxybutyrate polymerase | 0.9806 | 2 | 335 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar