F300421

General Info

Members Datasets Scaffolds Average Seq Length
195 138 195 332

Family's Representative Sequence

Representative Sequence 3300038705|Ga0237819_01728|Ga0237819_01728_627_1751
Length 374
Sequence MMTMPSAAAFFFMVWSIPRKTMAHPAPFDAAPQHGPRPLPLFLELLRSETAASPDRAAAAIRGLKAYQHARRADRGPPMPVAARIGRACLRDYGGSGRPAVFVPSLINPPFVLDLAPDNSLMRWVASQGIRPLLLDWGAPLPEESGMGIAGHVETLLLPLLDALGEDAALVGYCLGGTMAVAAASLHPVAGLALIAAPWHFSGFPQGARNDMTSLWEGAKPTCAALGYLPMEILQTAFWKLDPGRTVGKYERFGMLDPESAEARAFVALEDWANAGAPLTLEAGREAFEDLFGMDLPGNGRWHVGGKAIDPAGLSCPLLDVVSLSDRIVPAASSTGLAERLELSAGHVGMVVGSRAKAQLWQPLAAWLSHLHNH

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
98 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
99 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 2.05
Rhizosphere 76.92
Stem 0
Stem Tuber 0
Unclassified 13.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001893 3300000549 Bacteria 3028
2 JGI24739J22299_10037566 3300001989 Bacteria 1631
3 JGI24737J22298_10002157 3300001990 Bacteria 7020
4 JGI25165J46597_1000043 3300003214 Bacteria 264515
5 JGI25165J46597_1000445 3300003214 Bacteria 41632
6 Ga0065707_10146250 3300005295 Bacteria 1710
7 Ga0070676_10002939 3300005328 Bacteria 8793
8 Ga0070670_100006395 3300005331 Bacteria 9973
9 Ga0068869_100000096 3300005334 Bacteria 40808
10 Ga0070666_10000068 3300005335 Bacteria 76194
11 Ga0068868_100000149 3300005338 Bacteria 45719
12 Ga0070660_100111347 3300005339 Bacteria 2178
13 Ga0070669_100000018 3300005353 Bacteria 195789
14 Ga0070671_100000011 3300005355 Bacteria 202057
15 Ga0070674_100027647 3300005356 Bacteria 3718
16 Ga0070673_100000006 3300005364 Bacteria 184299
17 Ga0070659_100045028 3300005366 Bacteria 3456
18 Ga0070667_100000273 3300005367 Bacteria 58596
19 Ga0070705_100012154 3300005440 Bacteria 4368
20 Ga0068867_100000001 3300005459 Bacteria 427563
21 Ga0070665_100317532 3300005548 Bacteria 1562
22 Ga0068859_100000805 3300005617 Bacteria 31840
23 Ga0068859_100008172 3300005617 Bacteria 10616
24 Ga0068864_100000858 3300005618 Bacteria 25592
25 Ga0068864_100009279 3300005618 Bacteria 8114
26 Ga0068866_10025496 3300005718 Bacteria 2780
27 Ga0068861_100000046 3300005719 Bacteria 56414
28 Ga0068861_100001451 3300005719 Bacteria 14997
29 Ga0068863_100001370 3300005841 Bacteria 24218
30 Ga0068863_100003599 3300005841 Bacteria 15295
31 Ga0068858_100000439 3300005842 Bacteria 43456
32 Ga0068858_100012215 3300005842 Bacteria 8098
33 Ga0068860_100000269 3300005843 Bacteria 76230
34 Ga0068860_100003894 3300005843 Bacteria 15335
35 Ga0068862_100000877 3300005844 Bacteria 29301
36 Ga0068865_100000003 3300006881 Bacteria 231761
37 Ga0097620_100000805 3300006931 Bacteria 31840
38 Ga0097620_100008172 3300006931 Bacteria 10616
39 Ga0105251_10036551 3300009011 Bacteria 2416
40 Ga0105240_10014288 3300009093 Bacteria 10843
41 Ga0105240_10026739 3300009093 Bacteria 7568
42 Ga0105240_10062518 3300009093 Bacteria 4635
43 Ga0105245_10000113 3300009098 Bacteria 78545
44 Ga0105245_10001504 3300009098 Bacteria 21087
45 Ga0105247_10000758 3300009101 Bacteria 24920
46 Ga0105247_10005724 3300009101 Bacteria 7778
47 Ga0105243_10000373 3300009148 Bacteria 48115
48 Ga0105243_10091178 3300009148 Bacteria 2509
49 Ga0105242_10000448 3300009176 Bacteria 32719
50 Ga0105248_10027144 3300009177 Bacteria 6370
51 Ga0105248_10035610 3300009177 Bacteria 5569
52 Ga0105237_10024064 3300009545 Bacteria 6231
53 Ga0105238_10041202 3300009551 Bacteria 4678
54 Ga0105249_10000574 3300009553 Bacteria 33721
55 Ga0105249_10004128 3300009553 Bacteria 12544
56 Ga0105249_10413906 3300009553 Bacteria 1381
57 Ga0105239_10000694 3300010375 Bacteria 47928
58 Ga0105246_10002472 3300011119 Bacteria 11164
59 Ga0157373_10023039 3300013100 Bacteria 4516
60 Ga0157370_10000069 3300013104 Bacteria 112889
61 Ga0157369_10296755 3300013105 Bacteria 1682
62 Ga0157374_10001004 3300013296 Bacteria 24430
63 Ga0157378_10000902 3300013297 Bacteria 27366
64 Ga0163162_10004913 3300013306 Bacteria 12887
65 Ga0163162_10016649 3300013306 Bacteria 7186
66 Ga0163162_10210202 3300013306 Bacteria 2075
67 Ga0157372_10007993 3300013307 Bacteria 11249
68 Ga0157372_10850655 3300013307 Bacteria 1059
69 Ga0163163_10055016 3300014325 Bacteria 3933
70 Ga0163163_10104198 3300014325 Bacteria 2862
71 Ga0157379_10006792 3300014968 Bacteria 9891
72 Ga0157379_10035672 3300014968 Bacteria 4434
73 Ga0157376_10000089 3300014969 Bacteria 69351
74 Ga0209026_1001328 3300025250 Bacteria 11105
75 Ga0209148_1000996 3300025254 Bacteria 18233
76 Ga0209233_1000079 3300025261 Bacteria 346944
77 Ga0209233_1000313 3300025261 Bacteria 54941
78 Ga0207697_10003329 3300025315 Bacteria 7999
79 Ga0207697_10110020 3300025315 Bacteria 1179
80 Ga0207710_10006122 3300025900 Bacteria 5152
81 Ga0207680_10000341 3300025903 Bacteria 22237
82 Ga0207647_10000195 3300025904 Bacteria 49520
83 Ga0207647_10037703 3300025904 Bacteria 3063
84 Ga0207645_10008876 3300025907 Bacteria 6980
85 Ga0207705_10000802 3300025909 Bacteria 25817
86 Ga0207695_10001501 3300025913 Bacteria 38827
87 Ga0207695_10020680 3300025913 Bacteria 7531
88 Ga0207695_10067705 3300025913 Bacteria 3661
89 Ga0207671_10004851 3300025914 Bacteria 12657
90 Ga0207657_10082528 3300025919 Bacteria 2698
91 Ga0207681_10000008 3300025923 Bacteria 414329
92 Ga0207694_10036612 3300025924 Bacteria 3767
93 Ga0207687_10001599 3300025927 Bacteria 15593
94 Ga0207687_10004766 3300025927 Bacteria 9021
95 Ga0207644_10000006 3300025931 Bacteria 408793
96 Ga0207644_10016139 3300025931 Bacteria 5024
97 Ga0207706_10015334 3300025933 Bacteria 6925
98 Ga0207686_10000412 3300025934 Bacteria 29644
99 Ga0207709_10000173 3300025935 Bacteria 86350
100 Ga0207709_10085722 3300025935 Bacteria 2043
101 Ga0207669_10009473 3300025937 Bacteria 4642
102 Ga0207704_10000001 3300025938 Bacteria 716296
103 Ga0207711_10020390 3300025941 Bacteria 5527
104 Ga0207711_10217881 3300025941 Bacteria 1745
105 Ga0207689_10001595 3300025942 Bacteria 21464
106 Ga0207667_10002169 3300025949 Bacteria 24595
107 Ga0207651_10000002 3300025960 Bacteria 427663
108 Ga0207712_10000476 3300025961 Bacteria 33733
109 Ga0207668_10005394 3300025972 Bacteria 7527
110 Ga0207640_10055845 3300025981 Bacteria 2589
111 Ga0207658_10002605 3300025986 Bacteria 13093
112 Ga0207677_10000030 3300026023 Bacteria 120692
113 Ga0207703_10001250 3300026035 Bacteria 23825
114 Ga0207703_10002089 3300026035 Bacteria 17556
115 Ga0207641_10002987 3300026088 Bacteria 15303
116 Ga0207641_10004855 3300026088 Bacteria 11569
117 Ga0207648_10000001 3300026089 Bacteria 427499
118 Ga0207676_10000504 3300026095 Bacteria 32958
119 Ga0207676_10004372 3300026095 Bacteria 9991
120 Ga0207675_100000122 3300026118 Bacteria 63834
121 Ga0207675_100000822 3300026118 Bacteria 30908
122 Ga0268266_10025911 3300028379 Bacteria 4989
123 Ga0268266_10204139 3300028379 Bacteria 1810
124 Ga0268265_10000064 3300028380 Bacteria 144164
125 Ga0268265_10000424 3300028380 Bacteria 45348
126 Ga0268264_10000010 3300028381 Bacteria 596543
127 Ga0268264_10000184 3300028381 Bacteria 131402
128 Ga0268264_10001182 3300028381 Bacteria 25302
129 Ga0307513_10027618 3300031456 Bacteria 6511
130 Ga0307508_10002479 3300031616 Bacteria 19477
131 Ga0307410_10127635 3300031852 Bacteria 1864
132 Ga0307412_10009421 3300031911 Bacteria 5603
133 Ga0395899_0003766 3300037312 Bacteria 11972
134 Ga0395900_0067300 3300037418 Bacteria 3680
135 Ga0237819_01728 3300038705 Bacteria 5201
136 Ga0237816_02751 3300039145 Bacteria 1326
137 Ga0451804_0366730 3300041463 Bacteria 1384
138 Ga0451853_3730709 3300041512 Bacteria 2752
139 Ga0439448_0000793 3300042005 Bacteria 7679
140 Ga0466970_0163596 3300044765 Bacteria 1231
141 Ga0466957_0139760 3300044842 Bacteria 1559
142 Ga0466958_0363264 3300045836 Bacteria 933
143 Ga0495638_0001199 3300046460 Bacteria 24756
144 Ga0495638_0059356 3300046460 Bacteria 2369
145 Ga0495585_0040665 3300046492 Bacteria 2610
146 Ga0495583_0000656 3300046506 Bacteria 45452
147 Ga0495606_0009471 3300046507 Bacteria 8238
148 Ga0495666_0078927 3300046526 Bacteria 1559
149 Ga0495652_0205624 3300046529 Bacteria 1491
150 Ga0495625_0091539 3300046660 Bacteria 2102
151 Ga0495671_0101516 3300046692 Bacteria 1406
152 Ga0495686_0000201 3300047472 Bacteria 110982
153 Ga0495686_0000733 3300047472 Bacteria 43762
154 Ga0495686_0002106 3300047472 Bacteria 19503
155 Ga0495686_0002673 3300047472 Bacteria 16411
156 Ga0495686_0013666 3300047472 Bacteria 5626
157 Ga0495686_0146338 3300047472 Bacteria 1390
158 Ga0496102_0000100 3300048905 Bacteria 123531
159 Ga0496102_0296636 3300048905 Bacteria 1524
160 Ga0496103_0000070 3300048906 Bacteria 121077
161 Ga0496116_0002579 3300048919 Bacteria 18871
162 Ga0496117_0000194 3300048920 Bacteria 123531
163 Ga0496117_0025730 3300048920 Bacteria 4620
164 Ga0496118_0000146 3300048921 Bacteria 123531
165 Ga0496118_0006952 3300048921 Bacteria 12229
166 Ga0496118_0019582 3300048921 Bacteria 6042
167 Ga0496118_0040617 3300048921 Bacteria 3696
168 Ga0496119_0012504 3300048922 Bacteria 6887
169 Ga0496120_0053658 3300048923 Bacteria 2289
170 Ga0496121_0003464 3300048924 Bacteria 22491
171 Ga0496121_0008737 3300048924 Bacteria 11819
172 Ga0496121_0011319 3300048924 Bacteria 9928
173 Ga0496121_0028419 3300048924 Bacteria 5205
174 Ga0496122_0002977 3300048925 Bacteria 23060
175 Ga0496122_0029713 3300048925 Bacteria 4600
176 Ga0496123_0016942 3300048926 Bacteria 5886
177 Ga0496123_0028104 3300048926 Bacteria 4172
178 Ga0496124_0000185 3300048927 Bacteria 123531
179 Ga0496124_0014016 3300048927 Bacteria 7777
180 Ga0496125_0035237 3300048928 Bacteria 4396
181 Ga0496126_0015753 3300048929 Bacteria 7597
182 Ga0495682_0016616 3300049460 Bacteria 2785
183 Ga0501033_0098685 3300049570 Bacteria 2133
184 Ga0501257_000171 3300049686 Bacteria 13114
185 Ga0501044_0090826 3300049823 Bacteria 3081
186 Ga0501044_0111222 3300049823 Bacteria 2747
187 Ga0500643_001971 3300053087 Bacteria 11122
188 Ga0500643_008514 3300053087 Bacteria 4025
189 Ga0500555_001152 3300053103 Bacteria 8705
190 Ga0500562_019227 3300053108 Bacteria 1766
191 Ga0500592_000065 3300053116 Bacteria 28864
192 Ga0500559_0010564 3300053136 Bacteria 3961
193 Ga0500577_0027344 3300053142 Bacteria 1952
194 Ga0500616_0010224 3300053153 Bacteria 5627
195 Ga0500627_0000086 3300053158 Bacteria 31214

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0067300 Ga0395900_0067300_2833_3654 273
2 3300005331 Ga0070670_100006395 Ga0070670_1000063958 292
3 3300005335 Ga0070666_10000068 Ga0070666_1000006858 292
4 3300005353 Ga0070669_100000018 Ga0070669_10000001875 292
5 3300005355 Ga0070671_100000011 Ga0070671_100000011121 292
6 3300005440 Ga0070705_100012154 Ga0070705_1000121543 292
7 3300005617 Ga0068859_100000805 Ga0068859_1000008053 292
8 3300005618 Ga0068864_100009279 Ga0068864_1000092795 292
9 3300005719 Ga0068861_100001451 Ga0068861_1000014519 292
10 3300006931 Ga0097620_100000805 Ga0097620_1000008053 292
11 3300025315 Ga0207697_10003329 Ga0207697_100033294 292
12 3300025903 Ga0207680_10000341 Ga0207680_100003418 292
13 3300025923 Ga0207681_10000008 Ga0207681_10000008302 292
14 3300025931 Ga0207644_10000006 Ga0207644_10000006293 292
15 3300025972 Ga0207668_10005394 Ga0207668_100053942 292
16 3300025986 Ga0207658_10002605 Ga0207658_100026053 292
17 3300026095 Ga0207676_10004372 Ga0207676_100043723 292
18 3300026118 Ga0207675_100000822 Ga0207675_1000008223 292
19 3300028379 Ga0268266_10025911 Ga0268266_100259113 292
20 3300028380 Ga0268265_10000064 Ga0268265_10000064116 292
21 3300028381 Ga0268264_10000010 Ga0268264_1000001086 292
22 3300025315 Ga0207697_10110020 Ga0207697_101100202 295
23 3300045836 Ga0466958_0363264 Ga0466958_0363264_29_916 295
24 3300053142 Ga0500577_0027344 Ga0500577_0027344_1024_1914 296
25 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043125 297
26 3300005339 Ga0070660_100111347 Ga0070660_1001113472 297
27 3300009093 Ga0105240_10026739 Ga0105240_100267394 297
28 3300013307 Ga0157372_10850655 Ga0157372_108506551 297
29 3300025250 Ga0209026_1001328 Ga0209026_10013284 297
30 3300025261 Ga0209233_1000079 Ga0209233_1000079144 297
31 3300025913 Ga0207695_10067705 Ga0207695_100677053 302
32 3300025904 Ga0207647_10037703 Ga0207647_100377032 306
33 3300048924 Ga0496121_0008737 Ga0496121_0008737_9937_10956 308
34 3300049686 Ga0501257_000171 Ga0501257_000171_6069_7190 308
35 3300025914 Ga0207671_10004851 Ga0207671_100048513 312
36 3300025981 Ga0207640_10055845 Ga0207640_100558452 312
37 3300009545 Ga0105237_10024064 Ga0105237_100240647 316
38 3300053153 Ga0500616_0010224 Ga0500616_0010224_3173_4165 321
39 3300009093 Ga0105240_10014288 Ga0105240_100142889 322
40 3300010375 Ga0105239_10000694 Ga0105239_1000069438 322
41 3300025913 Ga0207695_10001501 Ga0207695_1000150141 322
42 3300048924 Ga0496121_0003464 Ga0496121_0003464_10580_11581 322
43 3300048929 Ga0496126_0015753 Ga0496126_0015753_4515_5516 322
44 3300053136 Ga0500559_0010564 Ga0500559_0010564_656_1657 324
45 3300044765 Ga0466970_0163596 Ga0466970_0163596_70_1065 325
46 3300047472 Ga0495686_0002106 Ga0495686_0002106_14059_15045 328
47 3300048921 Ga0496118_0040617 Ga0496118_0040617_1325_2323 329
48 3300005367 Ga0070667_100000273 Ga0070667_10000027339 330
49 3300005618 Ga0068864_100000858 Ga0068864_1000008589 330
50 3300005841 Ga0068863_100001370 Ga0068863_10000137017 330
51 3300005842 Ga0068858_100012215 Ga0068858_1000122152 330
52 3300005843 Ga0068860_100000269 Ga0068860_10000026931 330
53 3300009093 Ga0105240_10062518 Ga0105240_100625185 330
54 3300009177 Ga0105248_10027144 Ga0105248_100271444 330
55 3300009553 Ga0105249_10413906 Ga0105249_104139062 330
56 3300025913 Ga0207695_10020680 Ga0207695_100206808 330
57 3300025941 Ga0207711_10217881 Ga0207711_102178812 330
58 3300026035 Ga0207703_10001250 Ga0207703_1000125023 330
59 3300026088 Ga0207641_10004855 Ga0207641_100048555 330
60 3300026095 Ga0207676_10000504 Ga0207676_100005049 330
61 3300028381 Ga0268264_10000184 Ga0268264_1000018498 330
62 3300031456 Ga0307513_10027618 Ga0307513_100276182 330
63 3300046506 Ga0495583_0000656 Ga0495583_0000656_7881_8885 330
64 3300046692 Ga0495671_0101516 Ga0495671_0101516_239_1243 330
65 3300047472 Ga0495686_0000201 Ga0495686_0000201_69011_70003 330
66 3300047472 Ga0495686_0000733 Ga0495686_0000733_22829_23872 330
67 3300047472 Ga0495686_0002673 Ga0495686_0002673_6183_7175 330
68 3300048925 Ga0496122_0002977 Ga0496122_0002977_16697_17692 330
69 3300048926 Ga0496123_0016942 Ga0496123_0016942_4565_5560 330
70 3300048927 Ga0496124_0014016 Ga0496124_0014016_2564_3559 330
71 3300049460 Ga0495682_0016616 Ga0495682_0016616_1672_2676 330
72 3300049570 Ga0501033_0098685 Ga0501033_0098685_224_1216 330
73 3300049823 Ga0501044_0111222 Ga0501044_0111222_304_1296 330
74 3300053103 Ga0500555_001152 Ga0500555_001152_6955_7959 330
75 3300001989 JGI24739J22299_10037566 JGI24739J22299_100375662 331
76 3300001990 JGI24737J22298_10002157 JGI24737J22298_100021572 331
77 3300005328 Ga0070676_10002939 Ga0070676_100029393 331
78 3300005334 Ga0068869_100000096 Ga0068869_10000009621 331
79 3300005338 Ga0068868_100000149 Ga0068868_10000014928 331
80 3300005356 Ga0070674_100027647 Ga0070674_1000276472 331
81 3300005364 Ga0070673_100000006 Ga0070673_10000000690 331
82 3300005366 Ga0070659_100045028 Ga0070659_1000450283 331
83 3300005459 Ga0068867_100000001 Ga0068867_100000001335 331
84 3300005548 Ga0070665_100317532 Ga0070665_1003175322 331
85 3300005718 Ga0068866_10025496 Ga0068866_100254963 331
86 3300005842 Ga0068858_100000439 Ga0068858_10000043940 331
87 3300006881 Ga0068865_100000003 Ga0068865_10000000374 331
88 3300009098 Ga0105245_10000113 Ga0105245_1000011318 331
89 3300009101 Ga0105247_10000758 Ga0105247_1000075816 331
90 3300009148 Ga0105243_10000373 Ga0105243_1000037311 331
91 3300009176 Ga0105242_10000448 Ga0105242_1000044810 331
92 3300009551 Ga0105238_10041202 Ga0105238_100412022 331
93 3300009553 Ga0105249_10004128 Ga0105249_100041285 331
94 3300011119 Ga0105246_10002472 Ga0105246_100024722 331
95 3300013100 Ga0157373_10023039 Ga0157373_100230393 331
96 3300013104 Ga0157370_10000069 Ga0157370_1000006912 331
97 3300013105 Ga0157369_10296755 Ga0157369_102967552 331
98 3300013296 Ga0157374_10001004 Ga0157374_1000100419 331
99 3300013297 Ga0157378_10000902 Ga0157378_1000090211 331
100 3300013306 Ga0163162_10004913 Ga0163162_100049131 331
101 3300013306 Ga0163162_10210202 Ga0163162_102102022 331
102 3300013307 Ga0157372_10007993 Ga0157372_100079937 331
103 3300014969 Ga0157376_10000089 Ga0157376_1000008919 331
104 3300025254 Ga0209148_1000996 Ga0209148_10009969 331
105 3300025904 Ga0207647_10000195 Ga0207647_100001956 331
106 3300025907 Ga0207645_10008876 Ga0207645_100088765 331
107 3300025909 Ga0207705_10000802 Ga0207705_1000080214 331
108 3300025919 Ga0207657_10082528 Ga0207657_100825282 331
109 3300025924 Ga0207694_10036612 Ga0207694_100366122 331
110 3300025927 Ga0207687_10001599 Ga0207687_100015998 331
111 3300025931 Ga0207644_10016139 Ga0207644_100161393 331
112 3300025933 Ga0207706_10015334 Ga0207706_100153342 331
113 3300025934 Ga0207686_10000412 Ga0207686_100004129 331
114 3300025935 Ga0207709_10000173 Ga0207709_1000017315 331
115 3300025937 Ga0207669_10009473 Ga0207669_100094732 331
116 3300025938 Ga0207704_10000001 Ga0207704_10000001445 331
117 3300025942 Ga0207689_10001595 Ga0207689_100015953 331
118 3300025949 Ga0207667_10002169 Ga0207667_1000216912 331
119 3300025960 Ga0207651_10000002 Ga0207651_10000002114 331
120 3300026023 Ga0207677_10000030 Ga0207677_1000003023 331
121 3300026035 Ga0207703_10002089 Ga0207703_100020897 331
122 3300026089 Ga0207648_10000001 Ga0207648_10000001114 331
123 3300028379 Ga0268266_10204139 Ga0268266_102041392 331
124 3300031616 Ga0307508_10002479 Ga0307508_100024792 331
125 3300037312 Ga0395899_0003766 Ga0395899_0003766_978_1973 331
126 3300041463 Ga0451804_0366730 Ga0451804_0366730_206_1201 331
127 3300041512 Ga0451853_3730709 Ga0451853_3730709_1117_2112 331
128 3300042005 Ga0439448_0000793 Ga0439448_0000793_5918_6913 331
129 3300044842 Ga0466957_0139760 Ga0466957_0139760_132_1127 331
130 3300046460 Ga0495638_0001199 Ga0495638_0001199_2400_3404 331
131 3300046492 Ga0495585_0040665 Ga0495585_0040665_1516_2520 331
132 3300046526 Ga0495666_0078927 Ga0495666_0078927_438_1490 331
133 3300048920 Ga0496117_0025730 Ga0496117_0025730_1017_2012 331
134 3300048921 Ga0496118_0006952 Ga0496118_0006952_7020_8015 331
135 3300048921 Ga0496118_0019582 Ga0496118_0019582_859_1854 331
136 3300048924 Ga0496121_0011319 Ga0496121_0011319_264_1259 331
137 3300048924 Ga0496121_0028419 Ga0496121_0028419_1132_2127 331
138 3300048925 Ga0496122_0029713 Ga0496122_0029713_2448_3443 331
139 3300048926 Ga0496123_0028104 Ga0496123_0028104_448_1443 331
140 3300048928 Ga0496125_0035237 Ga0496125_0035237_90_1085 331
141 3300049823 Ga0501044_0090826 Ga0501044_0090826_914_1972 331
142 3300053108 Ga0500562_019227 Ga0500562_019227_495_1499 331
143 3300005617 Ga0068859_100008172 Ga0068859_1000081727 332
144 3300005719 Ga0068861_100000046 Ga0068861_1000000465 332
145 3300006931 Ga0097620_100008172 Ga0097620_1000081727 332
146 3300009177 Ga0105248_10035610 Ga0105248_100356106 332
147 3300014968 Ga0157379_10035672 Ga0157379_100356725 332
148 3300025941 Ga0207711_10020390 Ga0207711_100203906 332
149 3300026118 Ga0207675_100000122 Ga0207675_1000001225 332
150 3300046660 Ga0495625_0091539 Ga0495625_0091539_62_1066 332
151 3300009011 Ga0105251_10036551 Ga0105251_100365512 333
152 3300014325 Ga0163163_10055016 Ga0163163_100550162 333
153 3300014968 Ga0157379_10006792 Ga0157379_100067923 333
154 3300053087 Ga0500643_001971 Ga0500643_001971_2381_3466 333
155 3300053087 Ga0500643_008514 Ga0500643_008514_2490_3548 333
156 3300005295 Ga0065707_10146250 Ga0065707_101462501 334
157 3300005841 Ga0068863_100003599 Ga0068863_1000035995 334
158 3300005843 Ga0068860_100003894 Ga0068860_1000038949 334
159 3300005844 Ga0068862_100000877 Ga0068862_10000087728 334
160 3300009101 Ga0105247_10005724 Ga0105247_100057243 334
161 3300009553 Ga0105249_10000574 Ga0105249_1000057430 334
162 3300013306 Ga0163162_10016649 Ga0163162_100166493 334
163 3300014325 Ga0163163_10104198 Ga0163163_101041982 334
164 3300025900 Ga0207710_10006122 Ga0207710_100061224 334
165 3300025961 Ga0207712_10000476 Ga0207712_100004767 334
166 3300026088 Ga0207641_10002987 Ga0207641_100029875 334
167 3300028380 Ga0268265_10000424 Ga0268265_1000042446 334
168 3300028381 Ga0268264_10001182 Ga0268264_1000118221 334
169 3300031852 Ga0307410_10127635 Ga0307410_101276352 334
170 3300031911 Ga0307412_10009421 Ga0307412_100094213 334
171 3300038705 Ga0237819_01728 Ga0237819_01728_627_1751 334
172 3300039145 Ga0237816_02751 Ga0237816_02751_97_1101 334
173 3300046507 Ga0495606_0009471 Ga0495606_0009471_6153_7157 334
174 3300048905 Ga0496102_0000100 Ga0496102_0000100_105782_106789 334
175 3300048905 Ga0496102_0296636 Ga0496102_0296636_376_1407 334
176 3300048906 Ga0496103_0000070 Ga0496103_0000070_105763_106770 334
177 3300048919 Ga0496116_0002579 Ga0496116_0002579_3645_4652 334
178 3300048920 Ga0496117_0000194 Ga0496117_0000194_105782_106789 334
179 3300048921 Ga0496118_0000146 Ga0496118_0000146_105782_106789 334
180 3300048922 Ga0496119_0012504 Ga0496119_0012504_3715_4722 334
181 3300048923 Ga0496120_0053658 Ga0496120_0053658_1179_2186 334
182 3300048927 Ga0496124_0000185 Ga0496124_0000185_16743_17750 334
183 3300053116 Ga0500592_000065 Ga0500592_000065_9063_10187 334
184 3300053158 Ga0500627_0000086 Ga0500627_0000086_18604_19728 334
185 3300000549 LJQas_1001893 LJQas_10018933 335
186 3300003214 JGI25165J46597_1000445 JGI25165J46597_100044516 335
187 3300009098 Ga0105245_10001504 Ga0105245_1000150417 335
188 3300009148 Ga0105243_10091178 Ga0105243_100911782 335
189 3300025261 Ga0209233_1000313 Ga0209233_100031327 335
190 3300025927 Ga0207687_10004766 Ga0207687_100047667 335
191 3300025935 Ga0207709_10085722 Ga0207709_100857221 335
192 3300046460 Ga0495638_0059356 Ga0495638_0059356_118_1242 335
193 3300046529 Ga0495652_0205624 Ga0495652_0205624_40_1056 335
194 3300047472 Ga0495686_0013666 Ga0495686_0013666_3620_4744 335
195 3300047472 Ga0495686_0146338 Ga0495686_0146338_224_1240 335

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k3c-assembly1.cif.gz_A crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. 0.7601 31 329
6k5e-assembly2.cif.gz_F crystal structure of bioh from klebsiella pneumonia 0.7461 48 331
5xav-assembly1.cif.gz_A structure of phac from chromobacterium sp. usm2 0.7455 31 334
6k5e-assembly2.cif.gz_F crystal structure of bioh from klebsiella pneumonia 0.7406 48 331
2qjw-assembly2.cif.gz_D crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.736 57 331
ID Description Score Start End Superfamily
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8463 48 329 3.40.50.1820
af_A0A1D6J508_11_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7903 56 157 3.40.50.1820
af_B7Z150_335_565_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7689 125 158 3.40.50.1820
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7667 48 329 3.40.50.1820
af_A0A1P8BAJ1_50_318_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7445 125 159 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A031JDW0-F1-model_v4 deleted 0.9909 52 329
AF-A0A4Q3AQ98-F1-model_v4 Alpha/beta fold hydrolase 0.9849 110 335
AF-A0A1G3K1Y6-F1-model_v4 Poly-beta-hydroxybutyrate polymerase 0.9825 18 329
AF-A0A5E7YHX3-F1-model_v4 Poly-beta-hydroxybutyrate polymerase (EC 2.3.1.-) 0.982 38 329 GO:0016746
AF-A0A1E3LSF4-F1-model_v4 Poly-beta-hydroxybutyrate polymerase 0.9806 2 335

Feature Viewer

pLDDT pTM Quality
92.59 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map