F300108

General Info

Members Datasets Scaffolds Average Seq Length
195 113 390 184

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10615297|Ga0157378_106152971
Length 213
Sequence MNHGGGVIVAPRNPIRRRLTYFGRWSDHRYHLLERNMNRRFFISSSMALGGLTILSRLPSWAHVNNRETNPGQGQDAKTKSKGLKKVMKTDAEWKAQLTPEQYDVLRHEGTEYAFSSPLNDIHDHGTFVCAGCELPVFSSAQKFDSGTGWPSFWAPIKKENVIEETDRSLGMTRTKVSCAQCDGHLGHVFDDGPKPTGLRYCMNGVAMKFVKG

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.03
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10615297 3300013297 Bacteria 1099
2 LJQas_1000230 3300000549 Bacteria 10262
3 Ga0065704_10030244 3300005289 Bacteria 1516
4 Ga0065704_10154616 3300005289 Bacteria 1401
5 Ga0065704_10304641 3300005289 Bacteria 868
6 Ga0065715_10108474 3300005293 Bacteria 2717
7 Ga0065707_10005299 3300005295 Bacteria 4469
8 Ga0065707_10115742 3300005295 Bacteria 2258
9 Ga0065707_10118431 3300005295 Bacteria 2178
10 Ga0065707_10333751 3300005295 Bacteria 945
11 Ga0070660_100075863 3300005339 Bacteria 2633
12 Ga0070687_100296744 3300005343 Bacteria 1024
13 Ga0070668_100008878 3300005347 Bacteria 7464
14 Ga0070675_100807149 3300005354 Unclassified 858
15 Ga0070673_100433759 3300005364 Bacteria 1180
16 Ga0070703_10000884 3300005406 Bacteria 9604
17 Ga0070709_10348077 3300005434 Bacteria 1094
18 Ga0070701_10159055 3300005438 Unclassified 1307
19 Ga0070705_101205541 3300005440 Bacteria 624
20 Ga0070700_100075422 3300005441 Bacteria 2163
21 Ga0070700_100377043 3300005441 Unclassified 1060
22 Ga0070694_100015032 3300005444 Bacteria 4852
23 Ga0070694_100025287 3300005444 Bacteria 3841
24 Ga0070708_100021337 3300005445 Bacteria 5474
25 Ga0070708_100122512 3300005445 Bacteria 2400
26 Ga0070708_100841506 3300005445 Bacteria 862
27 Ga0068867_100411711 3300005459 Bacteria 1143
28 Ga0068867_101003676 3300005459 Bacteria 757
29 Ga0070706_100015059 3300005467 Bacteria 7142
30 Ga0070706_100068537 3300005467 Bacteria 3281
31 Ga0070706_100306294 3300005467 Bacteria 1482
32 Ga0070706_100340945 3300005467 Bacteria 1397
33 Ga0070706_100753851 3300005467 Bacteria 902
34 Ga0070706_100988746 3300005467 Unclassified 776
35 Ga0070707_100033288 3300005468 Unclassified 4914
36 Ga0070707_100180624 3300005468 Bacteria 2057
37 Ga0070698_100009562 3300005471 Bacteria 10377
38 Ga0070698_100009848 3300005471 Bacteria 10217
39 Ga0070698_100106136 3300005471 Bacteria 2778
40 Ga0070698_100165205 3300005471 Bacteria 2156
41 Ga0070698_100849582 3300005471 Bacteria 858
42 Ga0070699_100011575 3300005518 Bacteria 7617
43 Ga0070699_100045314 3300005518 Bacteria 3806
44 Ga0070699_100357184 3300005518 Bacteria 1317
45 Ga0070699_100406148 3300005518 Unclassified 1232
46 Ga0070699_100574434 3300005518 Bacteria 1027
47 Ga0070699_100984944 3300005518 Bacteria 773
48 Ga0070697_100005070 3300005536 Bacteria 10120
49 Ga0070697_100009957 3300005536 Bacteria 7418
50 Ga0070697_100090567 3300005536 Bacteria 2528
51 Ga0070697_100355396 3300005536 Unclassified 1266
52 Ga0068853_100047039 3300005539 Bacteria 3702
53 Ga0070686_100009051 3300005544 Bacteria 5585
54 Ga0070686_100097688 3300005544 Bacteria 1977
55 Ga0070695_100053738 3300005545 Bacteria 2591
56 Ga0070696_100395164 3300005546 Bacteria 1080
57 Ga0070696_100414186 3300005546 Bacteria 1057
58 Ga0070704_100029992 3300005549 Unclassified 3639
59 Ga0068855_100034574 3300005563 Bacteria 6026
60 Ga0068856_100073320 3300005614 Bacteria 3390
61 Ga0070702_100435613 3300005615 Bacteria 947
62 Ga0070702_100669471 3300005615 Unclassified 787
63 Ga0068859_100005477 3300005617 Bacteria 12918
64 Ga0068859_100522729 3300005617 Bacteria 1282
65 Ga0068859_101398673 3300005617 Bacteria 772
66 Ga0068863_100412229 3300005841 Bacteria 1323
67 Ga0068860_100105585 3300005843 Bacteria 2690
68 Ga0070716_100208668 3300006173 Bacteria 1304
69 Ga0075428_101021777 3300006844 Bacteria 875
70 Ga0075430_100201236 3300006846 Unclassified 1654
71 Ga0075429_100123966 3300006880 Bacteria 2259
72 Ga0075436_100000005 3300006914 Bacteria 360336
73 Ga0075436_100329997 3300006914 Bacteria 1097
74 Ga0097620_100005477 3300006931 Bacteria 12918
75 Ga0097620_100522733 3300006931 Bacteria 1282
76 Ga0097620_101398784 3300006931 Bacteria 772
77 Ga0075435_100000631 3300007076 Bacteria 21613
78 Ga0075435_100257195 3300007076 Bacteria 1487
79 Ga0111539_10021426 3300009094 Bacteria 7954
80 Ga0105245_11439855 3300009098 Bacteria 739
81 Ga0105243_10000638 3300009148 Bacteria 34678
82 Ga0105243_10399583 3300009148 Bacteria 1276
83 Ga0105243_10436999 3300009148 Bacteria 1224
84 Ga0105242_10001647 3300009176 Bacteria 17653
85 Ga0105242_10247977 3300009176 Bacteria 1603
86 Ga0105242_11757757 3300009176 Bacteria 658
87 Ga0105249_10000029 3300009553 Bacteria 227479
88 Ga0105239_10240594 3300010375 Unclassified 2031
89 Ga0157369_10002163 3300013105 Bacteria 23691
90 Ga0157374_10011335 3300013296 Bacteria 7714
91 Ga0157374_10073610 3300013296 Bacteria 3224
92 Ga0157378_10012507 3300013297 Bacteria 7428
93 Ga0157378_10111661 3300013297 Bacteria 2506
94 Ga0157378_10170129 3300013297 Unclassified 2043
95 Ga0157378_10286307 3300013297 Bacteria 1590
96 Ga0157378_11168553 3300013297 Bacteria 808
97 Ga0163162_10000009 3300013306 Bacteria 316099
98 Ga0163162_11153331 3300013306 Bacteria 879
99 Ga0163162_11270305 3300013306 Bacteria 836
100 Ga0157372_10273297 3300013307 Bacteria 1964
101 Ga0163163_10138624 3300014325 Bacteria 2474
102 Ga0163163_10191788 3300014325 Bacteria 2092
103 Ga0157380_10007710 3300014326 Bacteria 7659
104 Ga0157376_10059059 3300014969 Bacteria 3215
105 Ga0163161_10036297 3300017792 Bacteria 3530
106 Ga0163161_10052471 3300017792 Bacteria 2956
107 Ga0207653_10000353 3300025885 Bacteria 22731
108 Ga0207685_10000023 3300025905 Bacteria 115280
109 Ga0207684_10007720 3300025910 Bacteria 9638
110 Ga0207684_10062153 3300025910 Bacteria 3171
111 Ga0207684_10094666 3300025910 Bacteria 2548
112 Ga0207684_10349484 3300025910 Bacteria 1273
113 Ga0207684_10430723 3300025910 Bacteria 1133
114 Ga0207684_10614432 3300025910 Bacteria 928
115 Ga0207662_10143391 3300025918 Bacteria 1514
116 Ga0207662_10679093 3300025918 Unclassified 721
117 Ga0207657_10083318 3300025919 Bacteria 2683
118 Ga0207646_10008640 3300025922 Bacteria 10182
119 Ga0207646_11113430 3300025922 Bacteria 695
120 Ga0207646_11125930 3300025922 Bacteria 690
121 Ga0207646_11176088 3300025922 Bacteria 673
122 Ga0207687_10603290 3300025927 Bacteria 925
123 Ga0207686_10000078 3300025934 Bacteria 86179
124 Ga0207686_10000452 3300025934 Bacteria 27262
125 Ga0207686_10672625 3300025934 Bacteria 821
126 Ga0207709_10000175 3300025935 Bacteria 86180
127 Ga0207709_10207022 3300025935 Bacteria 1405
128 Ga0207665_10275965 3300025939 Bacteria 1249
129 Ga0207665_11004968 3300025939 Bacteria 663
130 Ga0207689_10006582 3300025942 Bacteria 10243
131 Ga0207689_10008787 3300025942 Bacteria 8782
132 Ga0207679_10196183 3300025945 Bacteria 1683
133 Ga0207667_10022486 3300025949 Bacteria 6963
134 Ga0207712_10000097 3300025961 Bacteria 101338
135 Ga0207668_10212096 3300025972 Bacteria 1549
136 Ga0207703_10323085 3300026035 Bacteria 1414
137 Ga0207639_10035130 3300026041 Bacteria 3708
138 Ga0207708_10065911 3300026075 Bacteria 2769
139 Ga0207708_10159005 3300026075 Bacteria 1783
140 Ga0207702_10208574 3300026078 Bacteria 1815
141 Ga0207641_10755705 3300026088 Bacteria 960
142 Ga0207698_10943552 3300026142 Bacteria 872
143 Ga0207428_10007506 3300027907 Bacteria 9937
144 Ga0265330_10247629 3300031235 Bacteria 751
145 Ga0265325_10057236 3300031241 Bacteria 1988
146 Ga0265340_10000170 3300031247 Bacteria 32547
147 Ga0265340_10047817 3300031247 Bacteria 2081
148 Ga0265340_10073973 3300031247 Bacteria 1612
149 Ga0265340_10189550 3300031247 Bacteria 927
150 Ga0265339_10008743 3300031249 Bacteria 6418
151 Ga0265331_10018750 3300031250 Bacteria 3580
152 Ga0265331_10105733 3300031250 Bacteria 1293
153 Ga0265331_10129330 3300031250 Bacteria 1153
154 Ga0265316_10130913 3300031344 Bacteria 1889
155 Ga0265316_10139579 3300031344 Bacteria 1821
156 Ga0307513_10017079 3300031456 Bacteria 8719
157 Ga0265313_10012635 3300031595 Bacteria 5134
158 Ga0265313_10024664 3300031595 Bacteria 3207
159 Ga0265313_10056696 3300031595 Bacteria 1852
160 Ga0265342_10022779 3300031712 Bacteria 3977
161 Ga0265342_10023449 3300031712 Bacteria 3906
162 Ga0265342_10039585 3300031712 Bacteria 2863
163 Ga0436364_1473768 3300037853 Unclassified 1364
164 Ga0395901_0520043 3300038443 Bacteria 1209
165 Ga0436365_0104661 3300039437 Bacteria 4086
166 Ga0439442_034454 3300042002 Bacteria 1059
167 Ga0451576_0952769 3300045051 Bacteria 900
168 Ga0495634_0345457 3300046642 Bacteria 892
169 Ga0495636_0134649 3300047318 Bacteria 1101
170 Ga0496105_0497173 3300048908 Bacteria 958
171 Ga0496114_0957486 3300048917 Bacteria 738
172 Ga0501034_0162896 3300049571 Bacteria 2200
173 Ga0501038_0348344 3300049574 Bacteria 1154
174 Ga0501046_0029197 3300049580 Bacteria 4485
175 Ga0501048_0241575 3300049582 Bacteria 1282
176 Ga0501067_0001221 3300049583 Bacteria 13960
177 Ga0501070_0065143 3300049586 Bacteria 3017
178 Ga0501073_0012045 3300049589 Bacteria 6314
179 Ga0501073_0052098 3300049589 Bacteria 2866
180 Ga0501077_0221031 3300049593 Bacteria 1204
181 Ga0501080_0285268 3300049742 Bacteria 1500
182 Ga0501083_0299195 3300049744 Bacteria 1046
183 Ga0501035_0861693 3300049822 Bacteria 720
184 nmdc:mga09592_149905_c1 3300050508 Bacteria 2012
185 nmdc:mga08y16_57941_c1 3300050511 Bacteria 4048
186 nmdc:mga0rr50_530165_c1 3300050513 Bacteria 1002
187 nmdc:mga0rr50_853_c1 3300050513 Bacteria 16406
188 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
189 nmdc:mga0a205_237853_c1 3300050515 Bacteria 1702
190 Ga0501084_0142775 3300054114 Bacteria 2016
191 Ga0501084_0626315 3300054114 Bacteria 908
192 Ga0501082_0011772 3300060353 Bacteria 7521
193 Ga0501082_0161288 3300060353 Bacteria 1948
194 Ga0501082_0179612 3300060353 Bacteria 1840
195 Ga0501082_0830396 3300060353 Bacteria 808
196 Ga0157378_10615297
197 LJQas_1000230
198 Ga0065704_10030244
199 Ga0065704_10154616
200 Ga0065704_10304641
201 Ga0065715_10108474
202 Ga0065707_10005299
203 Ga0065707_10115742
204 Ga0065707_10118431
205 Ga0065707_10333751
206 Ga0070660_100075863
207 Ga0070687_100296744
208 Ga0070668_100008878
209 Ga0070675_100807149
210 Ga0070673_100433759
211 Ga0070703_10000884
212 Ga0070709_10348077
213 Ga0070701_10159055
214 Ga0070705_101205541
215 Ga0070700_100075422
216 Ga0070700_100377043
217 Ga0070694_100015032
218 Ga0070694_100025287
219 Ga0070708_100021337
220 Ga0070708_100122512
221 Ga0070708_100841506
222 Ga0068867_100411711
223 Ga0068867_101003676
224 Ga0070706_100015059
225 Ga0070706_100068537
226 Ga0070706_100306294
227 Ga0070706_100340945
228 Ga0070706_100753851
229 Ga0070706_100988746
230 Ga0070707_100033288
231 Ga0070707_100180624
232 Ga0070698_100009562
233 Ga0070698_100009848
234 Ga0070698_100106136
235 Ga0070698_100165205
236 Ga0070698_100849582
237 Ga0070699_100011575
238 Ga0070699_100045314
239 Ga0070699_100357184
240 Ga0070699_100406148
241 Ga0070699_100574434
242 Ga0070699_100984944
243 Ga0070697_100005070
244 Ga0070697_100009957
245 Ga0070697_100090567
246 Ga0070697_100355396
247 Ga0068853_100047039
248 Ga0070686_100009051
249 Ga0070686_100097688
250 Ga0070695_100053738
251 Ga0070696_100395164
252 Ga0070696_100414186
253 Ga0070704_100029992
254 Ga0068855_100034574
255 Ga0068856_100073320
256 Ga0070702_100435613
257 Ga0070702_100669471
258 Ga0068859_100005477
259 Ga0068859_100522729
260 Ga0068859_101398673
261 Ga0068863_100412229
262 Ga0068860_100105585
263 Ga0070716_100208668
264 Ga0075428_101021777
265 Ga0075430_100201236
266 Ga0075429_100123966
267 Ga0075436_100000005
268 Ga0075436_100329997
269 Ga0097620_100005477
270 Ga0097620_100522733
271 Ga0097620_101398784
272 Ga0075435_100000631
273 Ga0075435_100257195
274 Ga0111539_10021426
275 Ga0105245_11439855
276 Ga0105243_10000638
277 Ga0105243_10399583
278 Ga0105243_10436999
279 Ga0105242_10001647
280 Ga0105242_10247977
281 Ga0105242_11757757
282 Ga0105249_10000029
283 Ga0105239_10240594
284 Ga0157369_10002163
285 Ga0157374_10011335
286 Ga0157374_10073610
287 Ga0157378_10012507
288 Ga0157378_10111661
289 Ga0157378_10170129
290 Ga0157378_10286307
291 Ga0157378_11168553
292 Ga0163162_10000009
293 Ga0163162_11153331
294 Ga0163162_11270305
295 Ga0157372_10273297
296 Ga0163163_10138624
297 Ga0163163_10191788
298 Ga0157380_10007710
299 Ga0157376_10059059
300 Ga0163161_10036297
301 Ga0163161_10052471
302 Ga0207653_10000353
303 Ga0207685_10000023
304 Ga0207684_10007720
305 Ga0207684_10062153
306 Ga0207684_10094666
307 Ga0207684_10349484
308 Ga0207684_10430723
309 Ga0207684_10614432
310 Ga0207662_10143391
311 Ga0207662_10679093
312 Ga0207657_10083318
313 Ga0207646_10008640
314 Ga0207646_11113430
315 Ga0207646_11125930
316 Ga0207646_11176088
317 Ga0207687_10603290
318 Ga0207686_10000078
319 Ga0207686_10000452
320 Ga0207686_10672625
321 Ga0207709_10000175
322 Ga0207709_10207022
323 Ga0207665_10275965
324 Ga0207665_11004968
325 Ga0207689_10006582
326 Ga0207689_10008787
327 Ga0207679_10196183
328 Ga0207667_10022486
329 Ga0207712_10000097
330 Ga0207668_10212096
331 Ga0207703_10323085
332 Ga0207639_10035130
333 Ga0207708_10065911
334 Ga0207708_10159005
335 Ga0207702_10208574
336 Ga0207641_10755705
337 Ga0207698_10943552
338 Ga0207428_10007506
339 Ga0265330_10247629
340 Ga0265325_10057236
341 Ga0265340_10000170
342 Ga0265340_10047817
343 Ga0265340_10073973
344 Ga0265340_10189550
345 Ga0265339_10008743
346 Ga0265331_10018750
347 Ga0265331_10105733
348 Ga0265331_10129330
349 Ga0265316_10130913
350 Ga0265316_10139579
351 Ga0307513_10017079
352 Ga0265313_10012635
353 Ga0265313_10024664
354 Ga0265313_10056696
355 Ga0265342_10022779
356 Ga0265342_10023449
357 Ga0265342_10039585
358 Ga0436364_1473768
359 Ga0395901_0520043
360 Ga0436365_0104661
361 Ga0439442_034454
362 Ga0451576_0952769
363 Ga0495634_0345457
364 Ga0495636_0134649
365 Ga0496105_0497173
366 Ga0496114_0957486
367 Ga0501034_0162896
368 Ga0501038_0348344
369 Ga0501046_0029197
370 Ga0501048_0241575
371 Ga0501067_0001221
372 Ga0501070_0065143
373 Ga0501073_0012045
374 Ga0501073_0052098
375 Ga0501077_0221031
376 Ga0501080_0285268
377 Ga0501083_0299195
378 Ga0501035_0861693
379 nmdc:mga09592_149905_c1
380 nmdc:mga08y16_57941_c1
381 nmdc:mga0rr50_530165_c1
382 nmdc:mga0rr50_853_c1
383 nmdc:mga08x19_5_c1
384 nmdc:mga0a205_237853_c1
385 Ga0501084_0142775
386 Ga0501084_0626315
387 Ga0501082_0011772
388 Ga0501082_0161288
389 Ga0501082_0179612
390 Ga0501082_0830396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

93

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9653 50 175
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9597 59 173
6sym-assembly2.cif.gz_B crystal structure of escherichia coli msrb (reduced form) 0.9565 50 173
7cto-assembly6.cif.gz_F staphylococcus aureus msrb 0.9548 59 173
6q9v-assembly1.cif.gz_A msrb3 0.9541 45 175
ID Description Score Start End Superfamily
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9785 50 175 2.170.150.20
af_Q78J03_33_175_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9741 50 175 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9697 47 174 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9564 45 175 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.948 47 174 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A7W1QQH3-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9906 42 174 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A317E0X5-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9887 45 175 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A843L356-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9886 47 174 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-U5QK83-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9884 46 174 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A1Z3HJL2-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9884 47 175 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743

Map