F300020

General Info

Members Datasets Scaffolds Average Seq Length
195 115 195 151

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12155093|Ga0105245_121550931
Length 169
Sequence MGGRDAKLAALMKPVTVSVEVPSARHDVYAFLDVLANHEPFTDHLMTDWEYSGPAAGVGAKARAKVRAPGSNEIIEIEVVETDPPRRIVEEDVGARGRRRTRGTYTLEQLPDGGTRISFELAWLEAPRLERVGAPLTRAFMRRANGKAMRRLARLLATRKDDRPSHPHL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
3 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
59 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
67 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 9.74
Rhizosphere 78.46
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10012669 3300003203 Bacteria 3646
2 Ga0070688_100420229 3300005365 Bacteria 993
3 Ga0070701_10572021 3300005438 Bacteria 744
4 Ga0070694_100377830 3300005444 Bacteria 1104
5 Ga0070678_101083688 3300005456 Bacteria 739
6 Ga0070707_101172816 3300005468 Bacteria 734
7 Ga0070679_101145284 3300005530 Bacteria 723
8 Ga0070704_100339338 3300005549 Bacteria 1265
9 Ga0068863_100055792 3300005841 Bacteria 3741
10 Ga0081455_10000790 3300005937 Bacteria 40666
11 Ga0081455_10018241 3300005937 Bacteria 6695
12 Ga0081455_10100283 3300005937 Bacteria 2327
13 Ga0081455_10104461 3300005937 Bacteria 2266
14 Ga0081538_10034100 3300005981 Bacteria 3372
15 Ga0081538_10063667 3300005981 Bacteria 2092
16 Ga0081539_10003764 3300005985 Bacteria 17977
17 Ga0075365_10010572 3300006038 Bacteria 5383
18 Ga0075365_10018552 3300006038 Bacteria 4279
19 Ga0075365_10046071 3300006038 Bacteria 2863
20 Ga0075365_10247863 3300006038 Unclassified 1251
21 Ga0075364_10006267 3300006051 Bacteria 6979
22 Ga0075364_10018695 3300006051 Bacteria 4343
23 Ga0075364_10142133 3300006051 Bacteria 1615
24 Ga0075364_10520450 3300006051 Unclassified 813
25 Ga0070712_100264125 3300006175 Bacteria 1380
26 Ga0075428_100092430 3300006844 Bacteria 3299
27 Ga0075431_100015747 3300006847 Bacteria 7667
28 Ga0075431_100036395 3300006847 Bacteria 5070
29 Ga0075433_10221508 3300006852 Bacteria 1680
30 Ga0075434_100099193 3300006871 Unclassified 2918
31 Ga0075434_100158340 3300006871 Bacteria 2284
32 Ga0075429_100218702 3300006880 Bacteria 1669
33 Ga0075429_100284744 3300006880 Bacteria 1447
34 Ga0075429_100467204 3300006880 Bacteria 1105
35 Ga0068865_100841529 3300006881 Bacteria 794
36 Ga0111539_10023888 3300009094 Bacteria 7510
37 Ga0111539_10048677 3300009094 Bacteria 5060
38 Ga0111539_10147349 3300009094 Bacteria 2756
39 Ga0105245_11257005 3300009098 Unclassified 789
40 Ga0105245_12155093 3300009098 Bacteria 611
41 Ga0114129_10099444 3300009147 Bacteria 4026
42 Ga0114129_10175899 3300009147 Bacteria 2915
43 Ga0114129_10829227 3300009147 Bacteria 1177
44 Ga0105246_10127988 3300011119 Bacteria 1892
45 Ga0157374_10688084 3300013296 Bacteria 1035
46 Ga0157378_11992299 3300013297 Bacteria 630
47 Ga0157372_10463754 3300013307 Bacteria 1476
48 Ga0206353_10957889 3300020082 Bacteria 894
49 Ga0207687_10192544 3300025927 Unclassified 1588
50 Ga0207687_11295366 3300025927 Bacteria 626
51 Ga0207686_10000032 3300025934 Bacteria 150341
52 Ga0207651_10364566 3300025960 Unclassified 1221
53 Ga0207641_10012998 3300026088 Bacteria 6829
54 Ga0207683_11285592 3300026121 Bacteria 677
55 Ga0207428_10089717 3300027907 Bacteria 2389
56 Ga0207428_10099528 3300027907 Bacteria 2248
57 Ga0307406_10888314 3300031901 Bacteria 758
58 Ga0307409_100149630 3300031995 Bacteria 2025
59 Ga0373947_0220866 3300035725 Unclassified 1246
60 Ga0395899_0465320 3300037312 Bacteria 826
61 Ga0395900_0128577 3300037418 Bacteria 2597
62 Ga0395900_0182371 3300037418 Bacteria 2133
63 Ga0395900_0617587 3300037418 Bacteria 1023
64 Ga0395900_0774241 3300037418 Bacteria 889
65 Ga0395900_1105732 3300037418 Bacteria 710
66 Ga0395898_0091685 3300037466 Bacteria 2923
67 Ga0395898_0105154 3300037466 Bacteria 2707
68 Ga0395898_0173078 3300037466 Bacteria 2064
69 Ga0395898_0885203 3300037466 Bacteria 831
70 Ga0395905_0209055 3300037471 Bacteria 1829
71 Ga0395905_0470188 3300037471 Bacteria 1156
72 Ga0395901_0038144 3300038443 Bacteria 4970
73 Ga0395901_0065277 3300038443 Bacteria 3790
74 Ga0395901_0085185 3300038443 Bacteria 3304
75 Ga0395901_0234127 3300038443 Bacteria 1917
76 Ga0395901_0373620 3300038443 Bacteria 1468
77 Ga0395901_0462794 3300038443 Bacteria 1296
78 Ga0395901_0751738 3300038443 Bacteria 968
79 Ga0395901_1509661 3300038443 Bacteria 628
80 Ga0436365_1765446 3300039437 Unclassified 741
81 Ga0451845_0023306 3300041501 Bacteria 734
82 Ga0466966_0009929 3300044684 Bacteria 6313
83 Ga0466961_0030392 3300044693 Bacteria 3471
84 Ga0466963_0010242 3300044694 Bacteria 5672
85 Ga0466963_0037742 3300044694 Bacteria 3157
86 Ga0466963_0083777 3300044694 Bacteria 2163
87 Ga0466963_0434861 3300044694 Bacteria 925
88 Ga0466971_0025095 3300044719 Bacteria 2662
89 Ga0466970_0267637 3300044765 Bacteria 959
90 Ga0466957_0465075 3300044842 Unclassified 873
91 Ga0466957_0507375 3300044842 Bacteria 837
92 Ga0466960_0032410 3300044901 Bacteria 2419
93 Ga0466960_0169444 3300044901 Bacteria 1178
94 Ga0466960_0348573 3300044901 Bacteria 844
95 Ga0466960_0632819 3300044901 Unclassified 637
96 Ga0466959_0125202 3300045049 Bacteria 1824
97 Ga0466959_0165147 3300045049 Bacteria 1555
98 Ga0466959_0307043 3300045049 Bacteria 1086
99 Ga0466959_0616916 3300045049 Bacteria 729
100 Ga0466958_0385989 3300045836 Bacteria 903
101 Ga0466967_0002725 3300045976 Bacteria 11166
102 Ga0466967_0123111 3300045976 Bacteria 2399
103 Ga0466967_0283950 3300045976 Bacteria 1589
104 Ga0466967_0542131 3300045976 Bacteria 1145
105 Ga0466967_0585381 3300045976 Bacteria 1100
106 Ga0466967_1786830 3300045976 Bacteria 612
107 Ga0495603_0025212 3300046455 Bacteria 3596
108 Ga0495585_0398645 3300046492 Bacteria 663
109 Ga0495640_0844367 3300046533 Bacteria 544
110 Ga0495587_0002470 3300046536 Bacteria 12342
111 Ga0495634_0000024 3300046642 Bacteria 116230
112 Ga0495593_0133734 3300047673 Bacteria 1258
113 Ga0496101_1123073 3300048904 Bacteria 617
114 Ga0496102_0000632 3300048905 Bacteria 35806
115 Ga0496102_1120515 3300048905 Unclassified 707
116 Ga0496103_0000043 3300048906 Bacteria 167983
117 Ga0496103_0269231 3300048906 Bacteria 1096
118 Ga0496104_0033884 3300048907 Bacteria 4760
119 Ga0496104_0898916 3300048907 Bacteria 791
120 Ga0496106_0091023 3300048909 Bacteria 2355
121 Ga0496107_0190903 3300048910 Bacteria 1522
122 Ga0496108_0340341 3300048911 Bacteria 1309
123 Ga0496108_1224450 3300048911 Bacteria 634
124 Ga0496109_0062549 3300048912 Bacteria 3404
125 Ga0496109_0306207 3300048912 Bacteria 1499
126 Ga0496110_0350392 3300048913 Bacteria 1345
127 Ga0496111_0689762 3300048914 Unclassified 743
128 Ga0496112_0077270 3300048915 Bacteria 3292
129 Ga0496112_0227604 3300048915 Bacteria 1820
130 Ga0496114_0136012 3300048917 Bacteria 2125
131 Ga0496115_0000020 3300048918 Bacteria 171995
132 Ga0496124_0029134 3300048927 Bacteria 4925
133 Ga0501031_0022551 3300049568 Bacteria 4102
134 Ga0501032_0130606 3300049569 Bacteria 1657
135 Ga0501033_0004271 3300049570 Bacteria 11484
136 Ga0501034_0106303 3300049571 Bacteria 2799
137 Ga0501034_1036797 3300049571 Bacteria 703
138 Ga0501037_0047368 3300049573 Bacteria 3150
139 Ga0501038_0011492 3300049574 Bacteria 8076
140 Ga0501039_0124789 3300049575 Bacteria 2019
141 Ga0501040_0426839 3300049576 Unclassified 953
142 Ga0501041_1021407 3300049577 Bacteria 532
143 Ga0501042_0052931 3300049578 Bacteria 2896
144 Ga0501043_0095794 3300049579 Bacteria 2332
145 Ga0501046_0025279 3300049580 Bacteria 4861
146 Ga0501047_0233679 3300049581 Bacteria 1691
147 Ga0501047_0295015 3300049581 Bacteria 1464
148 Ga0501047_0963168 3300049581 Bacteria 666
149 Ga0501048_0241663 3300049582 Bacteria 1281
150 Ga0501048_0986591 3300049582 Unclassified 606
151 Ga0501067_0155661 3300049583 Bacteria 1273
152 Ga0501067_0468873 3300049583 Unclassified 704
153 Ga0501068_0088184 3300049584 Bacteria 1911
154 Ga0501069_0127581 3300049585 Bacteria 1455
155 Ga0501069_0154628 3300049585 Bacteria 1319
156 Ga0501070_0031044 3300049586 Bacteria 4475
157 Ga0501071_0696275 3300049587 Bacteria 782
158 Ga0501072_0429751 3300049588 Bacteria 1047
159 Ga0501073_0005011 3300049589 Bacteria 9935
160 Ga0501079_0418337 3300049741 Bacteria 1052
161 Ga0501080_0165126 3300049742 Bacteria 2043
162 Ga0501081_0718761 3300049743 Bacteria 750
163 Ga0501083_0033681 3300049744 Bacteria 3506
164 Ga0501035_0021404 3300049822 Bacteria 5945
165 Ga0501044_0008069 3300049823 Bacteria 11564
166 Ga0501044_0015022 3300049823 Bacteria 8347
167 Ga0501045_0186738 3300049824 Bacteria 1545
168 nmdc:mga03n38_81463_c1 3300050490 Bacteria 1522
169 nmdc:mga00v17_159472_c1 3300050491 Bacteria 1451
170 nmdc:mga00v17_232867_c1 3300050491 Bacteria 1194
171 nmdc:mga00v17_28787_c1 3300050491 Bacteria 1044
172 nmdc:mga0yw44_102056_c1 3300050492 Bacteria 1828
173 nmdc:mga0yw44_1276_c1 3300050492 Bacteria 9926
174 nmdc:mga0yw44_130919_c1 3300050492 Unclassified 1624
175 nmdc:mga0yw44_144530_c1 3300050492 Bacteria 1548
176 nmdc:mga0yw44_333374_c1 3300050492 Unclassified 1020
177 nmdc:mga0yw44_443143_c1 3300050492 Unclassified 880
178 nmdc:mga0yw44_447089_c1 3300050492 Bacteria 876
179 nmdc:mga09592_507862_c1 3300050508 Bacteria 1037
180 nmdc:mga09592_703239_c1 3300050508 Bacteria 860
181 nmdc:mga06r32_1079945_c1 3300050510 Bacteria 752
182 nmdc:mga06r32_201559_c1 3300050510 Bacteria 1978
183 nmdc:mga08y16_59973_c1 3300050511 Bacteria 3974
184 nmdc:mga08y16_61766_c1 3300050511 Bacteria 3912
185 nmdc:mga08y16_987666_c1 3300050511 Bacteria 823
186 nmdc:mga0n895_40922_c1 3300050512 Bacteria 4503
187 nmdc:mga0n895_97735_c1 3300050512 Bacteria 2942
188 nmdc:mga0rr50_38120_c1 3300050513 Bacteria 3475
189 nmdc:mga0a205_57503_c1 3300050515 Bacteria 3755
190 nmdc:mga0a205_86464_c1 3300050515 Bacteria 1764
191 Ga0500566_0005968 3300053094 Bacteria 7242
192 Ga0501084_0186312 3300054114 Bacteria 1752
193 Ga0501084_0199341 3300054114 Bacteria 1689
194 Ga0501084_0277545 3300054114 Bacteria 1415
195 Ga0466962_0017997 3300061719 Bacteria 3399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0617587 Ga0395900_0617587_10_420 125
2 3300005981 Ga0081538_10034100 Ga0081538_100341003 127
3 3300049577 Ga0501041_1021407 Ga0501041_1021407_57_512 135
4 3300049743 Ga0501081_0718761 Ga0501081_0718761_46_501 135
5 3300037418 Ga0395900_0128577 Ga0395900_0128577_2012_2458 136
6 3300037466 Ga0395898_0091685 Ga0395898_0091685_789_1235 136
7 3300038443 Ga0395901_0038144 Ga0395901_0038144_1690_2136 136
8 3300006175 Ga0070712_100264125 Ga0070712_1002641252 137
9 3300044765 Ga0466970_0267637 Ga0466970_0267637_13_459 138
10 3300044901 Ga0466960_0032410 Ga0466960_0032410_707_1153 138
11 3300045049 Ga0466959_0125202 Ga0466959_0125202_209_655 138
12 3300044842 Ga0466957_0507375 Ga0466957_0507375_75_542 139
13 3300044694 Ga0466963_0010242 Ga0466963_0010242_5081_5545 142
14 3300044694 Ga0466963_0434861 Ga0466963_0434861_246_737 144
15 3300046533 Ga0495640_0844367 Ga0495640_0844367_12_449 145
16 3300006880 Ga0075429_100218702 Ga0075429_1002187022 146
17 3300006881 Ga0068865_100841529 Ga0068865_1008415292 146
18 3300009094 Ga0111539_10023888 Ga0111539_100238888 146
19 3300009094 Ga0111539_10147349 Ga0111539_101473492 146
20 3300011119 Ga0105246_10127988 Ga0105246_101279882 146
21 3300013297 Ga0157378_11992299 Ga0157378_119922991 146
22 3300027907 Ga0207428_10089717 Ga0207428_100897172 146
23 3300031995 Ga0307409_100149630 Ga0307409_1001496301 146
24 3300049570 Ga0501033_0004271 Ga0501033_0004271_9567_10010 146
25 3300049581 Ga0501047_0233679 Ga0501047_0233679_1041_1484 146
26 3300049585 Ga0501069_0154628 Ga0501069_0154628_353_796 146
27 3300049823 Ga0501044_0008069 Ga0501044_0008069_333_776 146
28 3300050508 nmdc:mga09592_507862_c1 nmdc:mga09592_507862_c1_338_787 146
29 3300050510 nmdc:mga06r32_1079945_c1 nmdc:mga06r32_1079945_c1_140_589 146
30 3300050511 nmdc:mga08y16_59973_c1 nmdc:mga08y16_59973_c1_591_1031 146
31 3300050511 nmdc:mga08y16_987666_c1 nmdc:mga08y16_987666_c1_140_589 146
32 3300006852 Ga0075433_10221508 Ga0075433_102215082 147
33 3300037418 Ga0395900_0774241 Ga0395900_0774241_299_754 147
34 3300037466 Ga0395898_0105154 Ga0395898_0105154_474_920 147
35 3300037466 Ga0395898_0173078 Ga0395898_0173078_730_1176 147
36 3300037471 Ga0395905_0209055 Ga0395905_0209055_374_820 147
37 3300038443 Ga0395901_0085185 Ga0395901_0085185_1332_1778 147
38 3300038443 Ga0395901_0751738 Ga0395901_0751738_486_932 147
39 3300039437 Ga0436365_1765446 Ga0436365_1765446_240_683 147
40 3300044901 Ga0466960_0169444 Ga0466960_0169444_329_775 147
41 3300047673 Ga0495593_0133734 Ga0495593_0133734_76_519 147
42 3300049568 Ga0501031_0022551 Ga0501031_0022551_2324_2770 147
43 3300049569 Ga0501032_0130606 Ga0501032_0130606_52_498 147
44 3300049571 Ga0501034_0106303 Ga0501034_0106303_570_1016 147
45 3300049571 Ga0501034_1036797 Ga0501034_1036797_94_540 147
46 3300049573 Ga0501037_0047368 Ga0501037_0047368_1936_2382 147
47 3300049574 Ga0501038_0011492 Ga0501038_0011492_5306_5752 147
48 3300049575 Ga0501039_0124789 Ga0501039_0124789_1292_1738 147
49 3300049578 Ga0501042_0052931 Ga0501042_0052931_2215_2661 147
50 3300049579 Ga0501043_0095794 Ga0501043_0095794_406_852 147
51 3300049580 Ga0501046_0025279 Ga0501046_0025279_2664_3110 147
52 3300049581 Ga0501047_0295015 Ga0501047_0295015_570_1016 147
53 3300049581 Ga0501047_0963168 Ga0501047_0963168_72_518 147
54 3300049582 Ga0501048_0241663 Ga0501048_0241663_142_588 147
55 3300049583 Ga0501067_0155661 Ga0501067_0155661_131_577 147
56 3300049584 Ga0501068_0088184 Ga0501068_0088184_769_1215 147
57 3300049585 Ga0501069_0127581 Ga0501069_0127581_735_1181 147
58 3300049586 Ga0501070_0031044 Ga0501070_0031044_3301_3747 147
59 3300049587 Ga0501071_0696275 Ga0501071_0696275_150_596 147
60 3300049588 Ga0501072_0429751 Ga0501072_0429751_148_594 147
61 3300049589 Ga0501073_0005011 Ga0501073_0005011_4277_4723 147
62 3300049741 Ga0501079_0418337 Ga0501079_0418337_463_909 147
63 3300049742 Ga0501080_0165126 Ga0501080_0165126_417_863 147
64 3300049744 Ga0501083_0033681 Ga0501083_0033681_202_648 147
65 3300049822 Ga0501035_0021404 Ga0501035_0021404_2133_2579 147
66 3300049823 Ga0501044_0015022 Ga0501044_0015022_5577_6023 147
67 3300049824 Ga0501045_0186738 Ga0501045_0186738_468_914 147
68 3300050515 nmdc:mga0a205_57503_c1 nmdc:mga0a205_57503_c1_1124_1567 147
69 3300053094 Ga0500566_0005968 Ga0500566_0005968_3718_4164 147
70 3300054114 Ga0501084_0277545 Ga0501084_0277545_513_959 147
71 3300003203 JGI25406J46586_10012669 JGI25406J46586_100126692 148
72 3300005365 Ga0070688_100420229 Ga0070688_1004202292 148
73 3300005438 Ga0070701_10572021 Ga0070701_105720212 148
74 3300005444 Ga0070694_100377830 Ga0070694_1003778302 148
75 3300005456 Ga0070678_101083688 Ga0070678_1010836881 148
76 3300005468 Ga0070707_101172816 Ga0070707_1011728161 148
77 3300005530 Ga0070679_101145284 Ga0070679_1011452841 148
78 3300005549 Ga0070704_100339338 Ga0070704_1003393382 148
79 3300005841 Ga0068863_100055792 Ga0068863_1000557924 148
80 3300005937 Ga0081455_10000790 Ga0081455_1000079029 148
81 3300005937 Ga0081455_10018241 Ga0081455_100182416 148
82 3300005937 Ga0081455_10100283 Ga0081455_101002833 148
83 3300005937 Ga0081455_10104461 Ga0081455_101044612 148
84 3300005981 Ga0081538_10063667 Ga0081538_100636673 148
85 3300005985 Ga0081539_10003764 Ga0081539_1000376414 148
86 3300006038 Ga0075365_10010572 Ga0075365_100105726 148
87 3300006038 Ga0075365_10018552 Ga0075365_100185524 148
88 3300006038 Ga0075365_10046071 Ga0075365_100460712 148
89 3300006038 Ga0075365_10247863 Ga0075365_102478631 148
90 3300006051 Ga0075364_10006267 Ga0075364_100062675 148
91 3300006051 Ga0075364_10018695 Ga0075364_100186954 148
92 3300006051 Ga0075364_10142133 Ga0075364_101421333 148
93 3300006051 Ga0075364_10520450 Ga0075364_105204501 148
94 3300006844 Ga0075428_100092430 Ga0075428_1000924302 148
95 3300006847 Ga0075431_100015747 Ga0075431_1000157472 148
96 3300006847 Ga0075431_100036395 Ga0075431_1000363953 148
97 3300006871 Ga0075434_100099193 Ga0075434_1000991933 148
98 3300006871 Ga0075434_100158340 Ga0075434_1001583402 148
99 3300006880 Ga0075429_100284744 Ga0075429_1002847442 148
100 3300006880 Ga0075429_100467204 Ga0075429_1004672041 148
101 3300009094 Ga0111539_10048677 Ga0111539_100486773 148
102 3300009098 Ga0105245_11257005 Ga0105245_112570052 148
103 3300009098 Ga0105245_12155093 Ga0105245_121550931 148
104 3300009147 Ga0114129_10099444 Ga0114129_100994444 148
105 3300009147 Ga0114129_10175899 Ga0114129_101758991 148
106 3300009147 Ga0114129_10829227 Ga0114129_108292272 148
107 3300013296 Ga0157374_10688084 Ga0157374_106880842 148
108 3300013307 Ga0157372_10463754 Ga0157372_104637543 148
109 3300020082 Ga0206353_10957889 Ga0206353_109578891 148
110 3300025927 Ga0207687_10192544 Ga0207687_101925442 148
111 3300025927 Ga0207687_11295366 Ga0207687_112953661 148
112 3300025934 Ga0207686_10000032 Ga0207686_1000003255 148
113 3300025960 Ga0207651_10364566 Ga0207651_103645662 148
114 3300026088 Ga0207641_10012998 Ga0207641_100129982 148
115 3300026121 Ga0207683_11285592 Ga0207683_112855921 148
116 3300027907 Ga0207428_10099528 Ga0207428_100995282 148
117 3300031901 Ga0307406_10888314 Ga0307406_108883142 148
118 3300035725 Ga0373947_0220866 Ga0373947_0220866_169_651 148
119 3300037312 Ga0395899_0465320 Ga0395899_0465320_165_647 148
120 3300037418 Ga0395900_0182371 Ga0395900_0182371_1095_1544 148
121 3300037418 Ga0395900_1105732 Ga0395900_1105732_189_656 148
122 3300037466 Ga0395898_0885203 Ga0395898_0885203_142_591 148
123 3300037471 Ga0395905_0470188 Ga0395905_0470188_608_1090 148
124 3300038443 Ga0395901_0065277 Ga0395901_0065277_2823_3281 148
125 3300038443 Ga0395901_0234127 Ga0395901_0234127_68_517 148
126 3300038443 Ga0395901_0373620 Ga0395901_0373620_658_1125 148
127 3300038443 Ga0395901_0462794 Ga0395901_0462794_628_1101 148
128 3300038443 Ga0395901_1509661 Ga0395901_1509661_91_558 148
129 3300041501 Ga0451845_0023306 Ga0451845_0023306_105_557 148
130 3300044684 Ga0466966_0009929 Ga0466966_0009929_4601_5062 148
131 3300044693 Ga0466961_0030392 Ga0466961_0030392_1710_2177 148
132 3300044694 Ga0466963_0037742 Ga0466963_0037742_1856_2323 148
133 3300044694 Ga0466963_0083777 Ga0466963_0083777_978_1463 148
134 3300044719 Ga0466971_0025095 Ga0466971_0025095_840_1307 148
135 3300044842 Ga0466957_0465075 Ga0466957_0465075_11_478 148
136 3300044901 Ga0466960_0348573 Ga0466960_0348573_140_625 148
137 3300044901 Ga0466960_0632819 Ga0466960_0632819_146_601 148
138 3300045049 Ga0466959_0165147 Ga0466959_0165147_472_939 148
139 3300045049 Ga0466959_0307043 Ga0466959_0307043_147_608 148
140 3300045049 Ga0466959_0616916 Ga0466959_0616916_41_508 148
141 3300045836 Ga0466958_0385989 Ga0466958_0385989_419_880 148
142 3300045976 Ga0466967_0002725 Ga0466967_0002725_3047_3532 148
143 3300045976 Ga0466967_0123111 Ga0466967_0123111_993_1469 148
144 3300045976 Ga0466967_0283950 Ga0466967_0283950_93_539 148
145 3300045976 Ga0466967_0542131 Ga0466967_0542131_50_535 148
146 3300045976 Ga0466967_0585381 Ga0466967_0585381_628_1080 148
147 3300045976 Ga0466967_1786830 Ga0466967_1786830_30_494 148
148 3300046455 Ga0495603_0025212 Ga0495603_0025212_2359_2814 148
149 3300046492 Ga0495585_0398645 Ga0495585_0398645_83_532 148
150 3300046536 Ga0495587_0002470 Ga0495587_0002470_6251_6697 148
151 3300046642 Ga0495634_0000024 Ga0495634_0000024_64937_65383 148
152 3300048904 Ga0496101_1123073 Ga0496101_1123073_17_463 148
153 3300048905 Ga0496102_0000632 Ga0496102_0000632_31010_31456 148
154 3300048905 Ga0496102_1120515 Ga0496102_1120515_159_614 148
155 3300048906 Ga0496103_0000043 Ga0496103_0000043_142841_143287 148
156 3300048906 Ga0496103_0269231 Ga0496103_0269231_181_627 148
157 3300048907 Ga0496104_0033884 Ga0496104_0033884_463_918 148
158 3300048907 Ga0496104_0898916 Ga0496104_0898916_123_578 148
159 3300048909 Ga0496106_0091023 Ga0496106_0091023_502_948 148
160 3300048910 Ga0496107_0190903 Ga0496107_0190903_50_505 148
161 3300048911 Ga0496108_0340341 Ga0496108_0340341_90_545 148
162 3300048911 Ga0496108_1224450 Ga0496108_1224450_115_579 148
163 3300048912 Ga0496109_0062549 Ga0496109_0062549_2565_3020 148
164 3300048912 Ga0496109_0306207 Ga0496109_0306207_985_1440 148
165 3300048913 Ga0496110_0350392 Ga0496110_0350392_841_1296 148
166 3300048914 Ga0496111_0689762 Ga0496111_0689762_50_505 148
167 3300048915 Ga0496112_0077270 Ga0496112_0077270_392_865 148
168 3300048915 Ga0496112_0227604 Ga0496112_0227604_401_859 148
169 3300048917 Ga0496114_0136012 Ga0496114_0136012_1169_1615 148
170 3300048918 Ga0496115_0000020 Ga0496115_0000020_89700_90146 148
171 3300048927 Ga0496124_0029134 Ga0496124_0029134_3790_4254 148
172 3300049576 Ga0501040_0426839 Ga0501040_0426839_269_733 148
173 3300049582 Ga0501048_0986591 Ga0501048_0986591_54_518 148
174 3300049583 Ga0501067_0468873 Ga0501067_0468873_157_603 148
175 3300050490 nmdc:mga03n38_81463_c1 nmdc:mga03n38_81463_c1_419_880 148
176 3300050491 nmdc:mga00v17_159472_c1 nmdc:mga00v17_159472_c1_891_1352 148
177 3300050491 nmdc:mga00v17_232867_c1 nmdc:mga00v17_232867_c1_313_774 148
178 3300050491 nmdc:mga00v17_28787_c1 nmdc:mga00v17_28787_c1_474_938 148
179 3300050492 nmdc:mga0yw44_102056_c1 nmdc:mga0yw44_102056_c1_1285_1740 148
180 3300050492 nmdc:mga0yw44_1276_c1 nmdc:mga0yw44_1276_c1_111_575 148
181 3300050492 nmdc:mga0yw44_130919_c1 nmdc:mga0yw44_130919_c1_937_1398 148
182 3300050492 nmdc:mga0yw44_144530_c1 nmdc:mga0yw44_144530_c1_144_605 148
183 3300050492 nmdc:mga0yw44_333374_c1 nmdc:mga0yw44_333374_c1_52_513 148
184 3300050492 nmdc:mga0yw44_443143_c1 nmdc:mga0yw44_443143_c1_411_869 148
185 3300050492 nmdc:mga0yw44_447089_c1 nmdc:mga0yw44_447089_c1_75_536 148
186 3300050508 nmdc:mga09592_703239_c1 nmdc:mga09592_703239_c1_331_795 148
187 3300050510 nmdc:mga06r32_201559_c1 nmdc:mga06r32_201559_c1_1090_1554 148
188 3300050511 nmdc:mga08y16_61766_c1 nmdc:mga08y16_61766_c1_1961_2425 148
189 3300050512 nmdc:mga0n895_40922_c1 nmdc:mga0n895_40922_c1_3790_4254 148
190 3300050512 nmdc:mga0n895_97735_c1 nmdc:mga0n895_97735_c1_885_1331 148
191 3300050513 nmdc:mga0rr50_38120_c1 nmdc:mga0rr50_38120_c1_37_483 148
192 3300050515 nmdc:mga0a205_86464_c1 nmdc:mga0a205_86464_c1_629_1093 148
193 3300054114 Ga0501084_0186312 Ga0501084_0186312_791_1255 148
194 3300054114 Ga0501084_0199341 Ga0501084_0199341_89_571 148
195 3300061719 Ga0466962_0017997 Ga0466962_0017997_938_1405 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

12

159

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.8852 1 145
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.8683 1 145
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8149 2 147
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7952 2 147
5wox-assembly1.cif.gz_A nmr solution structure of kany protein (ms6282) using two 4d-spectra 0.791 2 146
ID Description Score Start End Superfamily
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8709 1 143 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8543 1 143 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8338 2 143 3.30.530.20
af_Q94K52_78_219_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8262 4 148 3.30.530.20
af_Q4E2Q9_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8255 2 112 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A6I5CEY4-F1-model_v4 SRPBCC family protein 0.9961 1 99
AF-A0A660L5A4-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9945 1 147
AF-A0A7K3DXC0-F1-model_v4 SRPBCC family protein 0.9919 1 147
AF-A0A1C6QN98-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9914 2 147
AF-A0A1J4Q388-F1-model_v4 SRPBCC family protein 0.9885 1 147

Feature Viewer

pLDDT pTM Quality
94.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map