F299357
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 194 | 142 | 179 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300059511|Ga0587091_001115|Ga0587091_001115_1026_1679 |
| Length | 217 |
| Sequence | MAATQFNESLTAPDNSCSRKCPEALNSKKMSRIGKKPVALPSGVSITVDEHNVVTVKGPKGELTQKVDSDIKVGIEDNELKVERPTEQKRHKALHGLYRSLINNMVIGVSTGYKTSMEIVGVGYKASNQGNVLDLSLGFSHNVYFVVPSELKVTTAMEKGKNPLVTLEGIDKQLIGLVASKIKGLRKVEPYKGKVSVLLVKLFVARLVKLQVRRNNH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 4 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 5 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 6 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 7 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 8 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 9 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 10 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 11 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 12 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 13 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 14 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 15 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 16 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 70 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 72 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 73 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 74 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 78 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 86 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 87 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 88 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 89 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 90 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 91 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 92 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 95 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 96 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 104 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 123 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 124 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 125 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 126 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 127 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 128 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 129 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 130 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 131 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 132 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 133 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 134 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 135 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.62 |
| Metatranscriptomes | 21.65 |
| Isolates | 7.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.7 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 85.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_690796 | 2162886007 | Bacteria | 1546 |
| 2 | Ga0055536_1001261 | 3300003781 | Bacteria | 15585 |
| 3 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 4 | Ga0065714_10004649 | 3300005288 | Bacteria | 5772 |
| 5 | Ga0065714_10097955 | 3300005288 | Bacteria | 1715 |
| 6 | Ga0065714_10099149 | 3300005288 | Bacteria | 1684 |
| 7 | Ga0065714_10223165 | 3300005288 | Bacteria | 832 |
| 8 | Ga0065704_10003329 | 3300005289 | Bacteria | 4146 |
| 9 | Ga0065715_10088958 | 3300005293 | Bacteria | 20336 |
| 10 | Ga0068869_100737273 | 3300005334 | Bacteria | 843 |
| 11 | Ga0070671_101375891 | 3300005355 | Bacteria | 623 |
| 12 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 13 | Ga0068853_100207318 | 3300005539 | Bacteria | 1786 |
| 14 | Ga0068855_100205730 | 3300005563 | Bacteria | 2214 |
| 15 | Ga0068855_100428662 | 3300005563 | Bacteria | 1446 |
| 16 | Ga0068857_100024669 | 3300005577 | Bacteria | 5295 |
| 17 | Ga0068856_100083761 | 3300005614 | Bacteria | 3167 |
| 18 | Ga0068852_100500894 | 3300005616 | Bacteria | 1209 |
| 19 | Ga0068859_100499174 | 3300005617 | Bacteria | 1312 |
| 20 | Ga0068859_101977073 | 3300005617 | Bacteria | 644 |
| 21 | Ga0068864_100465304 | 3300005618 | Bacteria | 1211 |
| 22 | Ga0068861_100704327 | 3300005719 | Bacteria | 939 |
| 23 | Ga0068863_100034661 | 3300005841 | Bacteria | 4807 |
| 24 | Ga0068863_100377992 | 3300005841 | Bacteria | 1383 |
| 25 | Ga0068860_101878887 | 3300005843 | Bacteria | 620 |
| 26 | Ga0070716_100046778 | 3300006173 | Bacteria | 2437 |
| 27 | Ga0075369_10493259 | 3300006186 | Bacteria | 582 |
| 28 | Ga0075366_10000288 | 3300006195 | Bacteria | 22515 |
| 29 | Ga0097620_100499105 | 3300006931 | Bacteria | 1312 |
| 30 | Ga0097620_101977086 | 3300006931 | Bacteria | 644 |
| 31 | Ga0105237_10663612 | 3300009545 | Bacteria | 1049 |
| 32 | Ga0157373_10021916 | 3300013100 | Bacteria | 4636 |
| 33 | Ga0157373_10040447 | 3300013100 | Bacteria | 3336 |
| 34 | Ga0157373_10390720 | 3300013100 | Bacteria | 996 |
| 35 | Ga0157373_10937938 | 3300013100 | Bacteria | 643 |
| 36 | Ga0157373_11056626 | 3300013100 | Bacteria | 608 |
| 37 | Ga0157371_10024491 | 3300013102 | Bacteria | 4407 |
| 38 | Ga0157371_10055390 | 3300013102 | Bacteria | 2814 |
| 39 | Ga0157371_10099472 | 3300013102 | Bacteria | 2062 |
| 40 | Ga0157371_10330961 | 3300013102 | Bacteria | 1107 |
| 41 | Ga0157371_10371885 | 3300013102 | Bacteria | 1043 |
| 42 | Ga0157370_10040395 | 3300013104 | Bacteria | 4504 |
| 43 | Ga0157370_10042771 | 3300013104 | Bacteria | 4363 |
| 44 | Ga0157370_10168614 | 3300013104 | Bacteria | 2035 |
| 45 | Ga0157370_10255200 | 3300013104 | Bacteria | 1621 |
| 46 | Ga0157370_10275256 | 3300013104 | Bacteria | 1555 |
| 47 | Ga0157378_10948252 | 3300013297 | Bacteria | 893 |
| 48 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 49 | Ga0157372_10240258 | 3300013307 | Bacteria | 2102 |
| 50 | Ga0157375_10066260 | 3300013308 | Bacteria | 3604 |
| 51 | Ga0157375_10087765 | 3300013308 | Bacteria | 3163 |
| 52 | Ga0157380_10951818 | 3300014326 | Bacteria | 889 |
| 53 | Ga0182008_10000034 | 3300014497 | Bacteria | 138235 |
| 54 | Ga0157376_10339648 | 3300014969 | Bacteria | 1434 |
| 55 | Ga0182006_1022798 | 3300015261 | Bacteria | 2598 |
| 56 | Ga0182007_10175227 | 3300015262 | Bacteria | 739 |
| 57 | Ga0163161_10087878 | 3300017792 | Bacteria | 2297 |
| 58 | Ga0163161_10146988 | 3300017792 | Bacteria | 1789 |
| 59 | Ga0163161_10910882 | 3300017792 | Bacteria | 745 |
| 60 | Ga0197907_10876650 | 3300020069 | Bacteria | 1091 |
| 61 | Ga0206356_11577046 | 3300020070 | Bacteria | 1752 |
| 62 | Ga0206354_10567599 | 3300020081 | Bacteria | 634 |
| 63 | Ga0209676_1000332 | 3300025292 | Bacteria | 90798 |
| 64 | Ga0207426_1052403 | 3300025302 | Bacteria | 1208 |
| 65 | Ga0207685_10285847 | 3300025905 | Bacteria | 811 |
| 66 | Ga0207690_10000936 | 3300025932 | Bacteria | 18684 |
| 67 | Ga0207669_10581603 | 3300025937 | Bacteria | 908 |
| 68 | Ga0207665_10031879 | 3300025939 | Bacteria | 3489 |
| 69 | Ga0207689_10576992 | 3300025942 | Bacteria | 945 |
| 70 | Ga0207640_11160337 | 3300025981 | Bacteria | 685 |
| 71 | Ga0207640_11164186 | 3300025981 | Bacteria | 684 |
| 72 | Ga0207639_10592586 | 3300026041 | Bacteria | 1021 |
| 73 | Ga0207702_10047607 | 3300026078 | Bacteria | 3614 |
| 74 | Ga0207641_10030795 | 3300026088 | Bacteria | 4446 |
| 75 | Ga0207641_10484214 | 3300026088 | Bacteria | 1199 |
| 76 | Ga0207674_10033610 | 3300026116 | Bacteria | 5367 |
| 77 | Ga0207674_10388171 | 3300026116 | Bacteria | 1350 |
| 78 | Ga0207675_100232754 | 3300026118 | Bacteria | 1778 |
| 79 | Ga0207698_10851633 | 3300026142 | Bacteria | 917 |
| 80 | Ga0307515_10007084 | 3300028794 | Bacteria | 22272 |
| 81 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 82 | Ga0265338_10581833 | 3300028800 | Bacteria | 781 |
| 83 | Ga0316177_1119414 | 3300030731 | Bacteria | 5396 |
| 84 | Ga0316176_1220529 | 3300030732 | Bacteria | 11720 |
| 85 | Ga0316183_1033300 | 3300030742 | Bacteria | 31987 |
| 86 | Ga0316182_1207072 | 3300030745 | Bacteria | 1050 |
| 87 | Ga0307408_100003785 | 3300031548 | Bacteria | 10304 |
| 88 | Ga0307408_100044892 | 3300031548 | Bacteria | 3153 |
| 89 | Ga0307405_10845122 | 3300031731 | Bacteria | 770 |
| 90 | Ga0316577_10023552 | 3300031733 | Bacteria | 3419 |
| 91 | Ga0307412_10006208 | 3300031911 | Bacteria | 6740 |
| 92 | Ga0307412_10010373 | 3300031911 | Bacteria | 5363 |
| 93 | Ga0307412_10733814 | 3300031911 | Bacteria | 851 |
| 94 | Ga0307412_11043116 | 3300031911 | Bacteria | 725 |
| 95 | Ga0307414_10009044 | 3300032004 | Bacteria | 5699 |
| 96 | Ga0307414_10011719 | 3300032004 | Bacteria | 5154 |
| 97 | Ga0307414_10025882 | 3300032004 | Bacteria | 3766 |
| 98 | Ga0307414_10041366 | 3300032004 | Bacteria | 3121 |
| 99 | Ga0307414_10223769 | 3300032004 | Bacteria | 1546 |
| 100 | Ga0307414_10329297 | 3300032004 | Bacteria | 1303 |
| 101 | Ga0307414_10802449 | 3300032004 | Bacteria | 858 |
| 102 | Ga0316592_1003883 | 3300033524 | Bacteria | 2741 |
| 103 | Ga0316588_1000386 | 3300033528 | Bacteria | 5801 |
| 104 | Ga0316596_1004862 | 3300033541 | Bacteria | 3037 |
| 105 | Ga0316596_1032371 | 3300033541 | Bacteria | 1360 |
| 106 | Ga0316584_0001842 | 3300036712 | Bacteria | 13121 |
| 107 | Ga0395901_0018865 | 3300038443 | Bacteria | 7051 |
| 108 | Ga0400483_177371 | 3300039062 | Bacteria | 1637 |
| 109 | Ga0451793_1672030 | 3300041452 | Bacteria | 1323 |
| 110 | Ga0451800_1623467 | 3300041459 | Bacteria | 737 |
| 111 | Ga0451806_151016 | 3300041462 | Bacteria | 1951 |
| 112 | Ga0451841_0492225 | 3300041498 | Bacteria | 708 |
| 113 | Ga0451851_0440064 | 3300041507 | Bacteria | 1235 |
| 114 | Ga0451843_0869665 | 3300041509 | Bacteria | 801 |
| 115 | Ga0439454_004272 | 3300042011 | Bacteria | 1637 |
| 116 | Ga0451577_0066355 | 3300042876 | Bacteria | 3219 |
| 117 | Ga0451577_0185904 | 3300042876 | Unclassified | 1874 |
| 118 | Ga0451577_0197576 | 3300042876 | Bacteria | 1815 |
| 119 | Ga0451577_0514043 | 3300042876 | Bacteria | 1087 |
| 120 | Ga0453683_0053140 | 3300044673 | Bacteria | 2535 |
| 121 | Ga0453684_0000334 | 3300044712 | Bacteria | 196444 |
| 122 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 123 | Ga0495650_0028243 | 3300046471 | Bacteria | 2580 |
| 124 | Ga0495607_0127771 | 3300046501 | Bacteria | 1327 |
| 125 | Ga0495610_0008200 | 3300046512 | Bacteria | 6805 |
| 126 | Ga0495630_1049591 | 3300046517 | Bacteria | 619 |
| 127 | Ga0495652_0058644 | 3300046529 | Bacteria | 3259 |
| 128 | Ga0495609_0037227 | 3300046538 | Bacteria | 2195 |
| 129 | Ga0495635_0300107 | 3300046663 | Bacteria | 1077 |
| 130 | Ga0496115_0024014 | 3300048918 | Bacteria | 4736 |
| 131 | Ga0501306_026778 | 3300049127 | Bacteria | 837 |
| 132 | Ga0501308_005715 | 3300049128 | Bacteria | 1250 |
| 133 | Ga0501310_009680 | 3300049130 | Bacteria | 1066 |
| 134 | Ga0501345_00909 | 3300049134 | Bacteria | 1074 |
| 135 | Ga0501305_004819 | 3300049161 | Bacteria | 1607 |
| 136 | Ga0501305_015714 | 3300049161 | Bacteria | 1072 |
| 137 | Ga0501307_005832 | 3300049162 | Bacteria | 1311 |
| 138 | Ga0501307_026931 | 3300049162 | Bacteria | 779 |
| 139 | Ga0501312_014651 | 3300049528 | Bacteria | 1104 |
| 140 | Ga0501314_006210 | 3300049530 | Bacteria | 1036 |
| 141 | Ga0501315_000393 | 3300049531 | Bacteria | 2960 |
| 142 | Ga0501315_001224 | 3300049531 | Bacteria | 2127 |
| 143 | Ga0501317_004963 | 3300049533 | Bacteria | 1407 |
| 144 | Ga0501317_024809 | 3300049533 | Bacteria | 836 |
| 145 | Ga0501319_000090 | 3300049535 | Bacteria | 3160 |
| 146 | Ga0501320_001086 | 3300049536 | Bacteria | 1872 |
| 147 | Ga0501323_007312 | 3300049539 | Bacteria | 1258 |
| 148 | Ga0501323_016323 | 3300049539 | Bacteria | 945 |
| 149 | Ga0501323_044217 | 3300049539 | Bacteria | 661 |
| 150 | Ga0501325_002414 | 3300049541 | Bacteria | 1274 |
| 151 | Ga0501334_00766 | 3300049550 | Bacteria | 1605 |
| 152 | Ga0501334_01438 | 3300049550 | Bacteria | 1316 |
| 153 | Ga0501335_001804 | 3300049551 | Bacteria | 1684 |
| 154 | Ga0501335_004393 | 3300049551 | Bacteria | 1230 |
| 155 | Ga0501335_016498 | 3300049551 | Bacteria | 761 |
| 156 | Ga0501340_001505 | 3300049556 | Bacteria | 1266 |
| 157 | Ga0501227_080465 | 3300049665 | Bacteria | 853 |
| 158 | Ga0501235_062536 | 3300049669 | Bacteria | 873 |
| 159 | Ga0501238_004631 | 3300049671 | Bacteria | 1725 |
| 160 | Ga0501242_020243 | 3300049674 | Bacteria | 854 |
| 161 | Ga0501250_014095 | 3300049680 | Bacteria | 967 |
| 162 | Ga0501259_003028 | 3300049688 | Bacteria | 2692 |
| 163 | Ga0501266_002687 | 3300049763 | Bacteria | 2227 |
| 164 | nmdc:mga0k408_4220_c1 | 3300050493 | Bacteria | 7623 |
| 165 | Ga0500651_0000078 | 3300053093 | Bacteria | 62741 |
| 166 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 167 | Ga0500655_033812 | 3300053133 | Bacteria | 990 |
| 168 | Ga0500559_0160768 | 3300053136 | Bacteria | 1055 |
| 169 | Ga0500568_0000439 | 3300053139 | Bacteria | 31243 |
| 170 | Ga0500622_0000385 | 3300053156 | Bacteria | 42685 |
| 171 | Ga0587084_008418 | 3300059477 | Bacteria | 1307 |
| 172 | Ga0587077_022809 | 3300059493 | Bacteria | 1125 |
| 173 | Ga0587090_001193 | 3300059510 | Bacteria | 2565 |
| 174 | Ga0587090_016170 | 3300059510 | Bacteria | 1112 |
| 175 | Ga0587091_001115 | 3300059511 | Bacteria | 2767 |
| 176 | Ga0587125_000944 | 3300059607 | Bacteria | 1945 |
| 177 | Ga0587109_001196 | 3300059624 | Bacteria | 2917 |
| 178 | Ga0587062_000379 | 3300059639 | Bacteria | 3008 |
| 179 | Ga0587111_0005191 | 3300060346 | Bacteria | 1989 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059511 | Ga0587091_001115 | Ga0587091_001115_1026_1679 | 179 |
| 2 | iso_pu_bacteria | 2842903701 | 2842908293 | 180 |
| 3 | iso_pu_bacteria | 2890737413 | 2890740660 | 180 |
| 4 | iso_pu_bacteria | 2896317667 | 2896320835 | 180 |
| 5 | iso_pu_bacteria | 2896344016 | 2896346872 | 180 |
| 6 | iso_pu_bacteria | 2898713307 | 2898716211 | 180 |
| 7 | iso_pu_bacteria | 3003233435 | 3003236856 | 180 |
| 8 | iso_pu_bacteria | 2522125168 | 2522549427 | 181 |
| 9 | iso_pu_bacteria | 2738541284 | 2738762109 | 181 |
| 10 | iso_pu_bacteria | 2738541302 | 2738854404 | 181 |
| 11 | iso_pu_bacteria | 2738543023 | 2739301911 | 181 |
| 12 | iso_pu_bacteria | 2852627209 | 2852629116 | 181 |
| 13 | iso_pu_bacteria | 2857627736 | 2857631654 | 181 |
| 14 | iso_pu_bacteria | 2911138879 | 2911143817 | 181 |
| 15 | iso_pu_bacteria | 2919186247 | 2919189074 | 181 |
| 16 | iso_pu_bacteria | 2939664404 | 2939666771 | 181 |
| 17 | 3300005617 | Ga0068859_101977073 | Ga0068859_1019770731 | 182 |
| 18 | 3300006931 | Ga0097620_101977086 | Ga0097620_1019770861 | 182 |
| 19 | 3300005288 | Ga0065714_10097955 | Ga0065714_100979552 | 184 |
| 20 | 3300005293 | Ga0065715_10088958 | Ga0065715_1008895817 | 184 |
| 21 | 3300005334 | Ga0068869_100737273 | Ga0068869_1007372731 | 184 |
| 22 | 3300005355 | Ga0070671_101375891 | Ga0070671_1013758911 | 184 |
| 23 | 3300005539 | Ga0068853_100207318 | Ga0068853_1002073183 | 184 |
| 24 | 3300005563 | Ga0068855_100205730 | Ga0068855_1002057303 | 184 |
| 25 | 3300005563 | Ga0068855_100428662 | Ga0068855_1004286621 | 184 |
| 26 | 3300005577 | Ga0068857_100024669 | Ga0068857_10002466910 | 184 |
| 27 | 3300005614 | Ga0068856_100083761 | Ga0068856_1000837616 | 184 |
| 28 | 3300005617 | Ga0068859_100499174 | Ga0068859_1004991743 | 184 |
| 29 | 3300005618 | Ga0068864_100465304 | Ga0068864_1004653042 | 184 |
| 30 | 3300005719 | Ga0068861_100704327 | Ga0068861_1007043272 | 184 |
| 31 | 3300005841 | Ga0068863_100034661 | Ga0068863_1000346616 | 184 |
| 32 | 3300005841 | Ga0068863_100377992 | Ga0068863_1003779923 | 184 |
| 33 | 3300006173 | Ga0070716_100046778 | Ga0070716_1000467785 | 184 |
| 34 | 3300006931 | Ga0097620_100499105 | Ga0097620_1004991053 | 184 |
| 35 | 3300009545 | Ga0105237_10663612 | Ga0105237_106636123 | 184 |
| 36 | 3300013102 | Ga0157371_10330961 | Ga0157371_103309612 | 184 |
| 37 | 3300013102 | Ga0157371_10371885 | Ga0157371_103718851 | 184 |
| 38 | 3300013307 | Ga0157372_10000332 | Ga0157372_1000033220 | 184 |
| 39 | 3300013307 | Ga0157372_10240258 | Ga0157372_102402584 | 184 |
| 40 | 3300014326 | Ga0157380_10951818 | Ga0157380_109518182 | 184 |
| 41 | 3300014969 | Ga0157376_10339648 | Ga0157376_103396482 | 184 |
| 42 | 3300017792 | Ga0163161_10146988 | Ga0163161_101469881 | 184 |
| 43 | 3300020070 | Ga0206356_11577046 | Ga0206356_115770462 | 184 |
| 44 | 3300025905 | Ga0207685_10285847 | Ga0207685_102858472 | 184 |
| 45 | 3300025937 | Ga0207669_10581603 | Ga0207669_105816031 | 184 |
| 46 | 3300025939 | Ga0207665_10031879 | Ga0207665_100318796 | 184 |
| 47 | 3300025942 | Ga0207689_10576992 | Ga0207689_105769922 | 184 |
| 48 | 3300025981 | Ga0207640_11160337 | Ga0207640_111603371 | 184 |
| 49 | 3300025981 | Ga0207640_11164186 | Ga0207640_111641861 | 184 |
| 50 | 3300026041 | Ga0207639_10592586 | Ga0207639_105925862 | 184 |
| 51 | 3300026078 | Ga0207702_10047607 | Ga0207702_100476072 | 184 |
| 52 | 3300026088 | Ga0207641_10030795 | Ga0207641_100307957 | 184 |
| 53 | 3300026088 | Ga0207641_10484214 | Ga0207641_104842142 | 184 |
| 54 | 3300026116 | Ga0207674_10033610 | Ga0207674_100336104 | 184 |
| 55 | 3300026116 | Ga0207674_10388171 | Ga0207674_103881713 | 184 |
| 56 | 3300026118 | Ga0207675_100232754 | Ga0207675_1002327542 | 184 |
| 57 | 3300026142 | Ga0207698_10851633 | Ga0207698_108516331 | 184 |
| 58 | 3300028800 | Ga0265338_10001162 | Ga0265338_1000116233 | 184 |
| 59 | 3300028800 | Ga0265338_10581833 | Ga0265338_105818332 | 184 |
| 60 | 3300030731 | Ga0316177_1119414 | Ga0316177_111941410 | 184 |
| 61 | 3300030732 | Ga0316176_1220529 | Ga0316176_12205297 | 184 |
| 62 | 3300030742 | Ga0316183_1033300 | Ga0316183_103330010 | 184 |
| 63 | 3300030745 | Ga0316182_1207072 | Ga0316182_12070722 | 184 |
| 64 | 3300031911 | Ga0307412_11043116 | Ga0307412_110431161 | 184 |
| 65 | 3300032004 | Ga0307414_10329297 | Ga0307414_103292972 | 184 |
| 66 | 3300033524 | Ga0316592_1003883 | Ga0316592_10038833 | 184 |
| 67 | 3300033541 | Ga0316596_1004862 | Ga0316596_10048626 | 184 |
| 68 | 3300038443 | Ga0395901_0018865 | Ga0395901_0018865_5051_5605 | 184 |
| 69 | 3300039062 | Ga0400483_177371 | Ga0400483_177371_722_1276 | 184 |
| 70 | 3300042011 | Ga0439454_004272 | Ga0439454_004272_1071_1625 | 184 |
| 71 | 3300044673 | Ga0453683_0053140 | Ga0453683_0053140_1445_1999 | 184 |
| 72 | 3300046517 | Ga0495630_1049591 | Ga0495630_1049591_15_572 | 184 |
| 73 | 3300049128 | Ga0501308_005715 | Ga0501308_005715_292_846 | 184 |
| 74 | 3300049134 | Ga0501345_00909 | Ga0501345_00909_472_1026 | 184 |
| 75 | 3300049161 | Ga0501305_004819 | Ga0501305_004819_993_1547 | 184 |
| 76 | 3300049162 | Ga0501307_005832 | Ga0501307_005832_697_1251 | 184 |
| 77 | 3300049531 | Ga0501315_001224 | Ga0501315_001224_639_1193 | 184 |
| 78 | 3300049533 | Ga0501317_004963 | Ga0501317_004963_793_1347 | 184 |
| 79 | 3300049536 | Ga0501320_001086 | Ga0501320_001086_290_844 | 184 |
| 80 | 3300049539 | Ga0501323_007312 | Ga0501323_007312_595_1149 | 184 |
| 81 | 3300049539 | Ga0501323_044217 | Ga0501323_044217_16_570 | 184 |
| 82 | 3300049541 | Ga0501325_002414 | Ga0501325_002414_179_733 | 184 |
| 83 | 3300049550 | Ga0501334_00766 | Ga0501334_00766_1005_1559 | 184 |
| 84 | 3300049550 | Ga0501334_01438 | Ga0501334_01438_175_729 | 184 |
| 85 | 3300049551 | Ga0501335_001804 | Ga0501335_001804_387_941 | 184 |
| 86 | 3300049551 | Ga0501335_004393 | Ga0501335_004393_609_1163 | 184 |
| 87 | 3300049551 | Ga0501335_016498 | Ga0501335_016498_15_569 | 184 |
| 88 | 3300049556 | Ga0501340_001505 | Ga0501340_001505_17_571 | 184 |
| 89 | 3300049669 | Ga0501235_062536 | Ga0501235_062536_53_607 | 184 |
| 90 | 3300049674 | Ga0501242_020243 | Ga0501242_020243_78_632 | 184 |
| 91 | 3300049680 | Ga0501250_014095 | Ga0501250_014095_160_714 | 184 |
| 92 | 3300049688 | Ga0501259_003028 | Ga0501259_003028_563_1117 | 184 |
| 93 | 3300049763 | Ga0501266_002687 | Ga0501266_002687_1077_1631 | 184 |
| 94 | 3300053133 | Ga0500655_033812 | Ga0500655_033812_282_839 | 184 |
| 95 | 3300053136 | Ga0500559_0160768 | Ga0500559_0160768_455_1009 | 184 |
| 96 | 3300053139 | Ga0500568_0000439 | Ga0500568_0000439_14008_14562 | 184 |
| 97 | 3300059607 | Ga0587125_000944 | Ga0587125_000944_986_1540 | 184 |
| 98 | 3300060346 | Ga0587111_0005191 | Ga0587111_0005191_1022_1576 | 184 |
| 99 | 2162886007 | SwRhRL2b_contig_690796 | SwRhRL2b_0544.00003990 | 185 |
| 100 | 3300003781 | Ga0055536_1001261 | Ga0055536_10012613 | 185 |
| 101 | 3300005262 | Ga0065165_1000131 | Ga0065165_100013155 | 185 |
| 102 | 3300005288 | Ga0065714_10004649 | Ga0065714_1000464910 | 185 |
| 103 | 3300005288 | Ga0065714_10099149 | Ga0065714_100991494 | 185 |
| 104 | 3300005288 | Ga0065714_10223165 | Ga0065714_102231651 | 185 |
| 105 | 3300005289 | Ga0065704_10003329 | Ga0065704_100033291 | 185 |
| 106 | 3300005366 | Ga0070659_100000375 | Ga0070659_10000037523 | 185 |
| 107 | 3300005616 | Ga0068852_100500894 | Ga0068852_1005008942 | 185 |
| 108 | 3300005843 | Ga0068860_101878887 | Ga0068860_1018788871 | 185 |
| 109 | 3300006186 | Ga0075369_10493259 | Ga0075369_104932591 | 185 |
| 110 | 3300006195 | Ga0075366_10000288 | Ga0075366_1000028824 | 185 |
| 111 | 3300013100 | Ga0157373_10021916 | Ga0157373_100219161 | 185 |
| 112 | 3300013100 | Ga0157373_10040447 | Ga0157373_100404479 | 185 |
| 113 | 3300013100 | Ga0157373_10390720 | Ga0157373_103907201 | 185 |
| 114 | 3300013100 | Ga0157373_10937938 | Ga0157373_109379381 | 185 |
| 115 | 3300013100 | Ga0157373_11056626 | Ga0157373_110566261 | 185 |
| 116 | 3300013102 | Ga0157371_10024491 | Ga0157371_100244915 | 185 |
| 117 | 3300013102 | Ga0157371_10055390 | Ga0157371_100553907 | 185 |
| 118 | 3300013102 | Ga0157371_10099472 | Ga0157371_100994722 | 185 |
| 119 | 3300013104 | Ga0157370_10040395 | Ga0157370_100403957 | 185 |
| 120 | 3300013104 | Ga0157370_10042771 | Ga0157370_100427715 | 185 |
| 121 | 3300013104 | Ga0157370_10168614 | Ga0157370_101686144 | 185 |
| 122 | 3300013104 | Ga0157370_10255200 | Ga0157370_102552002 | 185 |
| 123 | 3300013104 | Ga0157370_10275256 | Ga0157370_102752562 | 185 |
| 124 | 3300013297 | Ga0157378_10948252 | Ga0157378_109482521 | 185 |
| 125 | 3300013308 | Ga0157375_10066260 | Ga0157375_100662602 | 185 |
| 126 | 3300013308 | Ga0157375_10087765 | Ga0157375_100877653 | 185 |
| 127 | 3300014497 | Ga0182008_10000034 | Ga0182008_100000347 | 185 |
| 128 | 3300015261 | Ga0182006_1022798 | Ga0182006_10227982 | 185 |
| 129 | 3300015262 | Ga0182007_10175227 | Ga0182007_101752272 | 185 |
| 130 | 3300017792 | Ga0163161_10087878 | Ga0163161_100878784 | 185 |
| 131 | 3300017792 | Ga0163161_10910882 | Ga0163161_109108821 | 185 |
| 132 | 3300020069 | Ga0197907_10876650 | Ga0197907_108766502 | 185 |
| 133 | 3300020081 | Ga0206354_10567599 | Ga0206354_105675991 | 185 |
| 134 | 3300025292 | Ga0209676_1000332 | Ga0209676_100033249 | 185 |
| 135 | 3300025302 | Ga0207426_1052403 | Ga0207426_10524032 | 185 |
| 136 | 3300025932 | Ga0207690_10000936 | Ga0207690_1000093623 | 185 |
| 137 | 3300028794 | Ga0307515_10007084 | Ga0307515_1000708421 | 185 |
| 138 | 3300031548 | Ga0307408_100003785 | Ga0307408_1000037856 | 185 |
| 139 | 3300031548 | Ga0307408_100044892 | Ga0307408_1000448926 | 185 |
| 140 | 3300031731 | Ga0307405_10845122 | Ga0307405_108451221 | 185 |
| 141 | 3300031733 | Ga0316577_10023552 | Ga0316577_100235524 | 185 |
| 142 | 3300031911 | Ga0307412_10006208 | Ga0307412_100062083 | 185 |
| 143 | 3300031911 | Ga0307412_10010373 | Ga0307412_100103732 | 185 |
| 144 | 3300031911 | Ga0307412_10733814 | Ga0307412_107338142 | 185 |
| 145 | 3300032004 | Ga0307414_10009044 | Ga0307414_100090443 | 185 |
| 146 | 3300032004 | Ga0307414_10011719 | Ga0307414_100117192 | 185 |
| 147 | 3300032004 | Ga0307414_10025882 | Ga0307414_100258823 | 185 |
| 148 | 3300032004 | Ga0307414_10041366 | Ga0307414_100413661 | 185 |
| 149 | 3300032004 | Ga0307414_10223769 | Ga0307414_102237692 | 185 |
| 150 | 3300032004 | Ga0307414_10802449 | Ga0307414_108024492 | 185 |
| 151 | 3300033528 | Ga0316588_1000386 | Ga0316588_10003861 | 185 |
| 152 | 3300033541 | Ga0316596_1032371 | Ga0316596_10323712 | 185 |
| 153 | 3300036712 | Ga0316584_0001842 | Ga0316584_0001842_8400_8957 | 185 |
| 154 | 3300041452 | Ga0451793_1672030 | Ga0451793_1672030_561_1118 | 185 |
| 155 | 3300041459 | Ga0451800_1623467 | Ga0451800_1623467_107_664 | 185 |
| 156 | 3300041462 | Ga0451806_151016 | Ga0451806_151016_892_1449 | 185 |
| 157 | 3300041498 | Ga0451841_0492225 | Ga0451841_0492225_10_567 | 185 |
| 158 | 3300041507 | Ga0451851_0440064 | Ga0451851_0440064_299_856 | 185 |
| 159 | 3300041509 | Ga0451843_0869665 | Ga0451843_0869665_165_722 | 185 |
| 160 | 3300042876 | Ga0451577_0066355 | Ga0451577_0066355_2566_3123 | 185 |
| 161 | 3300042876 | Ga0451577_0185904 | Ga0451577_0185904_1247_1804 | 185 |
| 162 | 3300042876 | Ga0451577_0197576 | Ga0451577_0197576_177_734 | 185 |
| 163 | 3300042876 | Ga0451577_0514043 | Ga0451577_0514043_78_635 | 185 |
| 164 | 3300044712 | Ga0453684_0000334 | Ga0453684_0000334_157188_157745 | 185 |
| 165 | 3300044712 | Ga0453684_0001193 | Ga0453684_0001193_66647_67204 | 185 |
| 166 | 3300046471 | Ga0495650_0028243 | Ga0495650_0028243_1939_2496 | 185 |
| 167 | 3300046501 | Ga0495607_0127771 | Ga0495607_0127771_699_1256 | 185 |
| 168 | 3300046512 | Ga0495610_0008200 | Ga0495610_0008200_1763_2320 | 185 |
| 169 | 3300046529 | Ga0495652_0058644 | Ga0495652_0058644_496_1053 | 185 |
| 170 | 3300046538 | Ga0495609_0037227 | Ga0495609_0037227_571_1128 | 185 |
| 171 | 3300046663 | Ga0495635_0300107 | Ga0495635_0300107_429_986 | 185 |
| 172 | 3300048918 | Ga0496115_0024014 | Ga0496115_0024014_3746_4303 | 185 |
| 173 | 3300049127 | Ga0501306_026778 | Ga0501306_026778_261_818 | 185 |
| 174 | 3300049130 | Ga0501310_009680 | Ga0501310_009680_20_577 | 185 |
| 175 | 3300049161 | Ga0501305_015714 | Ga0501305_015714_27_584 | 185 |
| 176 | 3300049162 | Ga0501307_026931 | Ga0501307_026931_26_583 | 185 |
| 177 | 3300049528 | Ga0501312_014651 | Ga0501312_014651_535_1092 | 185 |
| 178 | 3300049530 | Ga0501314_006210 | Ga0501314_006210_26_583 | 185 |
| 179 | 3300049531 | Ga0501315_000393 | Ga0501315_000393_2374_2931 | 185 |
| 180 | 3300049533 | Ga0501317_024809 | Ga0501317_024809_263_820 | 185 |
| 181 | 3300049535 | Ga0501319_000090 | Ga0501319_000090_1358_1915 | 185 |
| 182 | 3300049539 | Ga0501323_016323 | Ga0501323_016323_125_682 | 185 |
| 183 | 3300049665 | Ga0501227_080465 | Ga0501227_080465_67_624 | 185 |
| 184 | 3300049671 | Ga0501238_004631 | Ga0501238_004631_100_657 | 185 |
| 185 | 3300050493 | nmdc:mga0k408_4220_c1 | nmdc:mga0k408_4220_c1_1152_1709 | 185 |
| 186 | 3300053093 | Ga0500651_0000078 | Ga0500651_0000078_21064_21621 | 185 |
| 187 | 3300053125 | Ga0500618_000005 | Ga0500618_000005_252060_252617 | 185 |
| 188 | 3300053156 | Ga0500622_0000385 | Ga0500622_0000385_33077_33634 | 185 |
| 189 | 3300059477 | Ga0587084_008418 | Ga0587084_008418_569_1216 | 185 |
| 190 | 3300059493 | Ga0587077_022809 | Ga0587077_022809_46_603 | 185 |
| 191 | 3300059510 | Ga0587090_001193 | Ga0587090_001193_1416_2063 | 185 |
| 192 | 3300059510 | Ga0587090_016170 | Ga0587090_016170_25_582 | 185 |
| 193 | 3300059624 | Ga0587109_001196 | Ga0587109_001196_1160_1807 | 185 |
| 194 | 3300059639 | Ga0587062_000379 | Ga0587062_000379_1116_1763 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jil-assembly1.cif.gz_F | 70s ribosome flavobacterium johnsoniae | 0.9406 | 2 | 179 |
| 7jil-assembly1.cif.gz_F | 70s ribosome flavobacterium johnsoniae | 0.9355 | 2 | 179 |
| 7p7u-assembly1.cif.gz_K | e. faecalis 70s ribosome with p-trna, state iv | 0.92 | 2 | 180 |
| 7nhn-assembly1.cif.gz_K | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9191 | 9 | 177 |
| 5dm7-assembly1.cif.gz_E | crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a | 0.9162 | 8 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9822 | 1 | 83 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9705 | 1 | 83 | 3.90.930.12 |
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.965 | 2 | 80 | 3.90.930.12 |
| 4io9E01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.931 | 6 | 83 | 3.90.930.12 |
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9229 | 3 | 83 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M6YAH1-F1-model_v4 | 50S ribosomal protein L6 | 0.9898 | 1 | 84 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A383ENH4-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9877 | 1 | 99 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A0F9DYD6-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9868 | 1 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A381XPD8-F1-model_v4 | Large ribosomal subunit protein uL6 alpha-beta domain-containing protein | 0.9866 | 1 | 99 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A355S367-F1-model_v4 | 50S ribosomal protein L6 | 0.9848 | 1 | 80 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar