F299357

General Info

Members Datasets Scaffolds Average Seq Length
194 142 179 185

Family's Representative Sequence

Representative Sequence 3300059511|Ga0587091_001115|Ga0587091_001115_1026_1679
Length 217
Sequence MAATQFNESLTAPDNSCSRKCPEALNSKKMSRIGKKPVALPSGVSITVDEHNVVTVKGPKGELTQKVDSDIKVGIEDNELKVERPTEQKRHKALHGLYRSLINNMVIGVSTGYKTSMEIVGVGYKASNQGNVLDLSLGFSHNVYFVVPSELKVTTAMEKGKNPLVTLEGIDKQLIGLVASKIKGLRKVEPYKGKVSVLLVKLFVARLVKLQVRRNNH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
8 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
9 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
10 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
11 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
12 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
13 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
16 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
72 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
73 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
74 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
89 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
90 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
124 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
125 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
126 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
127 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.62
Metatranscriptomes 21.65
Isolates 7.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 2.06
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_690796 2162886007 Bacteria 1546
2 Ga0055536_1001261 3300003781 Bacteria 15585
3 Ga0065165_1000131 3300005262 Bacteria 128880
4 Ga0065714_10004649 3300005288 Bacteria 5772
5 Ga0065714_10097955 3300005288 Bacteria 1715
6 Ga0065714_10099149 3300005288 Bacteria 1684
7 Ga0065714_10223165 3300005288 Bacteria 832
8 Ga0065704_10003329 3300005289 Bacteria 4146
9 Ga0065715_10088958 3300005293 Bacteria 20336
10 Ga0068869_100737273 3300005334 Bacteria 843
11 Ga0070671_101375891 3300005355 Bacteria 623
12 Ga0070659_100000375 3300005366 Bacteria 33764
13 Ga0068853_100207318 3300005539 Bacteria 1786
14 Ga0068855_100205730 3300005563 Bacteria 2214
15 Ga0068855_100428662 3300005563 Bacteria 1446
16 Ga0068857_100024669 3300005577 Bacteria 5295
17 Ga0068856_100083761 3300005614 Bacteria 3167
18 Ga0068852_100500894 3300005616 Bacteria 1209
19 Ga0068859_100499174 3300005617 Bacteria 1312
20 Ga0068859_101977073 3300005617 Bacteria 644
21 Ga0068864_100465304 3300005618 Bacteria 1211
22 Ga0068861_100704327 3300005719 Bacteria 939
23 Ga0068863_100034661 3300005841 Bacteria 4807
24 Ga0068863_100377992 3300005841 Bacteria 1383
25 Ga0068860_101878887 3300005843 Bacteria 620
26 Ga0070716_100046778 3300006173 Bacteria 2437
27 Ga0075369_10493259 3300006186 Bacteria 582
28 Ga0075366_10000288 3300006195 Bacteria 22515
29 Ga0097620_100499105 3300006931 Bacteria 1312
30 Ga0097620_101977086 3300006931 Bacteria 644
31 Ga0105237_10663612 3300009545 Bacteria 1049
32 Ga0157373_10021916 3300013100 Bacteria 4636
33 Ga0157373_10040447 3300013100 Bacteria 3336
34 Ga0157373_10390720 3300013100 Bacteria 996
35 Ga0157373_10937938 3300013100 Bacteria 643
36 Ga0157373_11056626 3300013100 Bacteria 608
37 Ga0157371_10024491 3300013102 Bacteria 4407
38 Ga0157371_10055390 3300013102 Bacteria 2814
39 Ga0157371_10099472 3300013102 Bacteria 2062
40 Ga0157371_10330961 3300013102 Bacteria 1107
41 Ga0157371_10371885 3300013102 Bacteria 1043
42 Ga0157370_10040395 3300013104 Bacteria 4504
43 Ga0157370_10042771 3300013104 Bacteria 4363
44 Ga0157370_10168614 3300013104 Bacteria 2035
45 Ga0157370_10255200 3300013104 Bacteria 1621
46 Ga0157370_10275256 3300013104 Bacteria 1555
47 Ga0157378_10948252 3300013297 Bacteria 893
48 Ga0157372_10000332 3300013307 Bacteria 51907
49 Ga0157372_10240258 3300013307 Bacteria 2102
50 Ga0157375_10066260 3300013308 Bacteria 3604
51 Ga0157375_10087765 3300013308 Bacteria 3163
52 Ga0157380_10951818 3300014326 Bacteria 889
53 Ga0182008_10000034 3300014497 Bacteria 138235
54 Ga0157376_10339648 3300014969 Bacteria 1434
55 Ga0182006_1022798 3300015261 Bacteria 2598
56 Ga0182007_10175227 3300015262 Bacteria 739
57 Ga0163161_10087878 3300017792 Bacteria 2297
58 Ga0163161_10146988 3300017792 Bacteria 1789
59 Ga0163161_10910882 3300017792 Bacteria 745
60 Ga0197907_10876650 3300020069 Bacteria 1091
61 Ga0206356_11577046 3300020070 Bacteria 1752
62 Ga0206354_10567599 3300020081 Bacteria 634
63 Ga0209676_1000332 3300025292 Bacteria 90798
64 Ga0207426_1052403 3300025302 Bacteria 1208
65 Ga0207685_10285847 3300025905 Bacteria 811
66 Ga0207690_10000936 3300025932 Bacteria 18684
67 Ga0207669_10581603 3300025937 Bacteria 908
68 Ga0207665_10031879 3300025939 Bacteria 3489
69 Ga0207689_10576992 3300025942 Bacteria 945
70 Ga0207640_11160337 3300025981 Bacteria 685
71 Ga0207640_11164186 3300025981 Bacteria 684
72 Ga0207639_10592586 3300026041 Bacteria 1021
73 Ga0207702_10047607 3300026078 Bacteria 3614
74 Ga0207641_10030795 3300026088 Bacteria 4446
75 Ga0207641_10484214 3300026088 Bacteria 1199
76 Ga0207674_10033610 3300026116 Bacteria 5367
77 Ga0207674_10388171 3300026116 Bacteria 1350
78 Ga0207675_100232754 3300026118 Bacteria 1778
79 Ga0207698_10851633 3300026142 Bacteria 917
80 Ga0307515_10007084 3300028794 Bacteria 22272
81 Ga0265338_10001162 3300028800 Bacteria 43495
82 Ga0265338_10581833 3300028800 Bacteria 781
83 Ga0316177_1119414 3300030731 Bacteria 5396
84 Ga0316176_1220529 3300030732 Bacteria 11720
85 Ga0316183_1033300 3300030742 Bacteria 31987
86 Ga0316182_1207072 3300030745 Bacteria 1050
87 Ga0307408_100003785 3300031548 Bacteria 10304
88 Ga0307408_100044892 3300031548 Bacteria 3153
89 Ga0307405_10845122 3300031731 Bacteria 770
90 Ga0316577_10023552 3300031733 Bacteria 3419
91 Ga0307412_10006208 3300031911 Bacteria 6740
92 Ga0307412_10010373 3300031911 Bacteria 5363
93 Ga0307412_10733814 3300031911 Bacteria 851
94 Ga0307412_11043116 3300031911 Bacteria 725
95 Ga0307414_10009044 3300032004 Bacteria 5699
96 Ga0307414_10011719 3300032004 Bacteria 5154
97 Ga0307414_10025882 3300032004 Bacteria 3766
98 Ga0307414_10041366 3300032004 Bacteria 3121
99 Ga0307414_10223769 3300032004 Bacteria 1546
100 Ga0307414_10329297 3300032004 Bacteria 1303
101 Ga0307414_10802449 3300032004 Bacteria 858
102 Ga0316592_1003883 3300033524 Bacteria 2741
103 Ga0316588_1000386 3300033528 Bacteria 5801
104 Ga0316596_1004862 3300033541 Bacteria 3037
105 Ga0316596_1032371 3300033541 Bacteria 1360
106 Ga0316584_0001842 3300036712 Bacteria 13121
107 Ga0395901_0018865 3300038443 Bacteria 7051
108 Ga0400483_177371 3300039062 Bacteria 1637
109 Ga0451793_1672030 3300041452 Bacteria 1323
110 Ga0451800_1623467 3300041459 Bacteria 737
111 Ga0451806_151016 3300041462 Bacteria 1951
112 Ga0451841_0492225 3300041498 Bacteria 708
113 Ga0451851_0440064 3300041507 Bacteria 1235
114 Ga0451843_0869665 3300041509 Bacteria 801
115 Ga0439454_004272 3300042011 Bacteria 1637
116 Ga0451577_0066355 3300042876 Bacteria 3219
117 Ga0451577_0185904 3300042876 Unclassified 1874
118 Ga0451577_0197576 3300042876 Bacteria 1815
119 Ga0451577_0514043 3300042876 Bacteria 1087
120 Ga0453683_0053140 3300044673 Bacteria 2535
121 Ga0453684_0000334 3300044712 Bacteria 196444
122 Ga0453684_0001193 3300044712 Bacteria 80343
123 Ga0495650_0028243 3300046471 Bacteria 2580
124 Ga0495607_0127771 3300046501 Bacteria 1327
125 Ga0495610_0008200 3300046512 Bacteria 6805
126 Ga0495630_1049591 3300046517 Bacteria 619
127 Ga0495652_0058644 3300046529 Bacteria 3259
128 Ga0495609_0037227 3300046538 Bacteria 2195
129 Ga0495635_0300107 3300046663 Bacteria 1077
130 Ga0496115_0024014 3300048918 Bacteria 4736
131 Ga0501306_026778 3300049127 Bacteria 837
132 Ga0501308_005715 3300049128 Bacteria 1250
133 Ga0501310_009680 3300049130 Bacteria 1066
134 Ga0501345_00909 3300049134 Bacteria 1074
135 Ga0501305_004819 3300049161 Bacteria 1607
136 Ga0501305_015714 3300049161 Bacteria 1072
137 Ga0501307_005832 3300049162 Bacteria 1311
138 Ga0501307_026931 3300049162 Bacteria 779
139 Ga0501312_014651 3300049528 Bacteria 1104
140 Ga0501314_006210 3300049530 Bacteria 1036
141 Ga0501315_000393 3300049531 Bacteria 2960
142 Ga0501315_001224 3300049531 Bacteria 2127
143 Ga0501317_004963 3300049533 Bacteria 1407
144 Ga0501317_024809 3300049533 Bacteria 836
145 Ga0501319_000090 3300049535 Bacteria 3160
146 Ga0501320_001086 3300049536 Bacteria 1872
147 Ga0501323_007312 3300049539 Bacteria 1258
148 Ga0501323_016323 3300049539 Bacteria 945
149 Ga0501323_044217 3300049539 Bacteria 661
150 Ga0501325_002414 3300049541 Bacteria 1274
151 Ga0501334_00766 3300049550 Bacteria 1605
152 Ga0501334_01438 3300049550 Bacteria 1316
153 Ga0501335_001804 3300049551 Bacteria 1684
154 Ga0501335_004393 3300049551 Bacteria 1230
155 Ga0501335_016498 3300049551 Bacteria 761
156 Ga0501340_001505 3300049556 Bacteria 1266
157 Ga0501227_080465 3300049665 Bacteria 853
158 Ga0501235_062536 3300049669 Bacteria 873
159 Ga0501238_004631 3300049671 Bacteria 1725
160 Ga0501242_020243 3300049674 Bacteria 854
161 Ga0501250_014095 3300049680 Bacteria 967
162 Ga0501259_003028 3300049688 Bacteria 2692
163 Ga0501266_002687 3300049763 Bacteria 2227
164 nmdc:mga0k408_4220_c1 3300050493 Bacteria 7623
165 Ga0500651_0000078 3300053093 Bacteria 62741
166 Ga0500618_000005 3300053125 Bacteria 253092
167 Ga0500655_033812 3300053133 Bacteria 990
168 Ga0500559_0160768 3300053136 Bacteria 1055
169 Ga0500568_0000439 3300053139 Bacteria 31243
170 Ga0500622_0000385 3300053156 Bacteria 42685
171 Ga0587084_008418 3300059477 Bacteria 1307
172 Ga0587077_022809 3300059493 Bacteria 1125
173 Ga0587090_001193 3300059510 Bacteria 2565
174 Ga0587090_016170 3300059510 Bacteria 1112
175 Ga0587091_001115 3300059511 Bacteria 2767
176 Ga0587125_000944 3300059607 Bacteria 1945
177 Ga0587109_001196 3300059624 Bacteria 2917
178 Ga0587062_000379 3300059639 Bacteria 3008
179 Ga0587111_0005191 3300060346 Bacteria 1989

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059511 Ga0587091_001115 Ga0587091_001115_1026_1679 179
2 iso_pu_bacteria 2842903701 2842908293 180
3 iso_pu_bacteria 2890737413 2890740660 180
4 iso_pu_bacteria 2896317667 2896320835 180
5 iso_pu_bacteria 2896344016 2896346872 180
6 iso_pu_bacteria 2898713307 2898716211 180
7 iso_pu_bacteria 3003233435 3003236856 180
8 iso_pu_bacteria 2522125168 2522549427 181
9 iso_pu_bacteria 2738541284 2738762109 181
10 iso_pu_bacteria 2738541302 2738854404 181
11 iso_pu_bacteria 2738543023 2739301911 181
12 iso_pu_bacteria 2852627209 2852629116 181
13 iso_pu_bacteria 2857627736 2857631654 181
14 iso_pu_bacteria 2911138879 2911143817 181
15 iso_pu_bacteria 2919186247 2919189074 181
16 iso_pu_bacteria 2939664404 2939666771 181
17 3300005617 Ga0068859_101977073 Ga0068859_1019770731 182
18 3300006931 Ga0097620_101977086 Ga0097620_1019770861 182
19 3300005288 Ga0065714_10097955 Ga0065714_100979552 184
20 3300005293 Ga0065715_10088958 Ga0065715_1008895817 184
21 3300005334 Ga0068869_100737273 Ga0068869_1007372731 184
22 3300005355 Ga0070671_101375891 Ga0070671_1013758911 184
23 3300005539 Ga0068853_100207318 Ga0068853_1002073183 184
24 3300005563 Ga0068855_100205730 Ga0068855_1002057303 184
25 3300005563 Ga0068855_100428662 Ga0068855_1004286621 184
26 3300005577 Ga0068857_100024669 Ga0068857_10002466910 184
27 3300005614 Ga0068856_100083761 Ga0068856_1000837616 184
28 3300005617 Ga0068859_100499174 Ga0068859_1004991743 184
29 3300005618 Ga0068864_100465304 Ga0068864_1004653042 184
30 3300005719 Ga0068861_100704327 Ga0068861_1007043272 184
31 3300005841 Ga0068863_100034661 Ga0068863_1000346616 184
32 3300005841 Ga0068863_100377992 Ga0068863_1003779923 184
33 3300006173 Ga0070716_100046778 Ga0070716_1000467785 184
34 3300006931 Ga0097620_100499105 Ga0097620_1004991053 184
35 3300009545 Ga0105237_10663612 Ga0105237_106636123 184
36 3300013102 Ga0157371_10330961 Ga0157371_103309612 184
37 3300013102 Ga0157371_10371885 Ga0157371_103718851 184
38 3300013307 Ga0157372_10000332 Ga0157372_1000033220 184
39 3300013307 Ga0157372_10240258 Ga0157372_102402584 184
40 3300014326 Ga0157380_10951818 Ga0157380_109518182 184
41 3300014969 Ga0157376_10339648 Ga0157376_103396482 184
42 3300017792 Ga0163161_10146988 Ga0163161_101469881 184
43 3300020070 Ga0206356_11577046 Ga0206356_115770462 184
44 3300025905 Ga0207685_10285847 Ga0207685_102858472 184
45 3300025937 Ga0207669_10581603 Ga0207669_105816031 184
46 3300025939 Ga0207665_10031879 Ga0207665_100318796 184
47 3300025942 Ga0207689_10576992 Ga0207689_105769922 184
48 3300025981 Ga0207640_11160337 Ga0207640_111603371 184
49 3300025981 Ga0207640_11164186 Ga0207640_111641861 184
50 3300026041 Ga0207639_10592586 Ga0207639_105925862 184
51 3300026078 Ga0207702_10047607 Ga0207702_100476072 184
52 3300026088 Ga0207641_10030795 Ga0207641_100307957 184
53 3300026088 Ga0207641_10484214 Ga0207641_104842142 184
54 3300026116 Ga0207674_10033610 Ga0207674_100336104 184
55 3300026116 Ga0207674_10388171 Ga0207674_103881713 184
56 3300026118 Ga0207675_100232754 Ga0207675_1002327542 184
57 3300026142 Ga0207698_10851633 Ga0207698_108516331 184
58 3300028800 Ga0265338_10001162 Ga0265338_1000116233 184
59 3300028800 Ga0265338_10581833 Ga0265338_105818332 184
60 3300030731 Ga0316177_1119414 Ga0316177_111941410 184
61 3300030732 Ga0316176_1220529 Ga0316176_12205297 184
62 3300030742 Ga0316183_1033300 Ga0316183_103330010 184
63 3300030745 Ga0316182_1207072 Ga0316182_12070722 184
64 3300031911 Ga0307412_11043116 Ga0307412_110431161 184
65 3300032004 Ga0307414_10329297 Ga0307414_103292972 184
66 3300033524 Ga0316592_1003883 Ga0316592_10038833 184
67 3300033541 Ga0316596_1004862 Ga0316596_10048626 184
68 3300038443 Ga0395901_0018865 Ga0395901_0018865_5051_5605 184
69 3300039062 Ga0400483_177371 Ga0400483_177371_722_1276 184
70 3300042011 Ga0439454_004272 Ga0439454_004272_1071_1625 184
71 3300044673 Ga0453683_0053140 Ga0453683_0053140_1445_1999 184
72 3300046517 Ga0495630_1049591 Ga0495630_1049591_15_572 184
73 3300049128 Ga0501308_005715 Ga0501308_005715_292_846 184
74 3300049134 Ga0501345_00909 Ga0501345_00909_472_1026 184
75 3300049161 Ga0501305_004819 Ga0501305_004819_993_1547 184
76 3300049162 Ga0501307_005832 Ga0501307_005832_697_1251 184
77 3300049531 Ga0501315_001224 Ga0501315_001224_639_1193 184
78 3300049533 Ga0501317_004963 Ga0501317_004963_793_1347 184
79 3300049536 Ga0501320_001086 Ga0501320_001086_290_844 184
80 3300049539 Ga0501323_007312 Ga0501323_007312_595_1149 184
81 3300049539 Ga0501323_044217 Ga0501323_044217_16_570 184
82 3300049541 Ga0501325_002414 Ga0501325_002414_179_733 184
83 3300049550 Ga0501334_00766 Ga0501334_00766_1005_1559 184
84 3300049550 Ga0501334_01438 Ga0501334_01438_175_729 184
85 3300049551 Ga0501335_001804 Ga0501335_001804_387_941 184
86 3300049551 Ga0501335_004393 Ga0501335_004393_609_1163 184
87 3300049551 Ga0501335_016498 Ga0501335_016498_15_569 184
88 3300049556 Ga0501340_001505 Ga0501340_001505_17_571 184
89 3300049669 Ga0501235_062536 Ga0501235_062536_53_607 184
90 3300049674 Ga0501242_020243 Ga0501242_020243_78_632 184
91 3300049680 Ga0501250_014095 Ga0501250_014095_160_714 184
92 3300049688 Ga0501259_003028 Ga0501259_003028_563_1117 184
93 3300049763 Ga0501266_002687 Ga0501266_002687_1077_1631 184
94 3300053133 Ga0500655_033812 Ga0500655_033812_282_839 184
95 3300053136 Ga0500559_0160768 Ga0500559_0160768_455_1009 184
96 3300053139 Ga0500568_0000439 Ga0500568_0000439_14008_14562 184
97 3300059607 Ga0587125_000944 Ga0587125_000944_986_1540 184
98 3300060346 Ga0587111_0005191 Ga0587111_0005191_1022_1576 184
99 2162886007 SwRhRL2b_contig_690796 SwRhRL2b_0544.00003990 185
100 3300003781 Ga0055536_1001261 Ga0055536_10012613 185
101 3300005262 Ga0065165_1000131 Ga0065165_100013155 185
102 3300005288 Ga0065714_10004649 Ga0065714_1000464910 185
103 3300005288 Ga0065714_10099149 Ga0065714_100991494 185
104 3300005288 Ga0065714_10223165 Ga0065714_102231651 185
105 3300005289 Ga0065704_10003329 Ga0065704_100033291 185
106 3300005366 Ga0070659_100000375 Ga0070659_10000037523 185
107 3300005616 Ga0068852_100500894 Ga0068852_1005008942 185
108 3300005843 Ga0068860_101878887 Ga0068860_1018788871 185
109 3300006186 Ga0075369_10493259 Ga0075369_104932591 185
110 3300006195 Ga0075366_10000288 Ga0075366_1000028824 185
111 3300013100 Ga0157373_10021916 Ga0157373_100219161 185
112 3300013100 Ga0157373_10040447 Ga0157373_100404479 185
113 3300013100 Ga0157373_10390720 Ga0157373_103907201 185
114 3300013100 Ga0157373_10937938 Ga0157373_109379381 185
115 3300013100 Ga0157373_11056626 Ga0157373_110566261 185
116 3300013102 Ga0157371_10024491 Ga0157371_100244915 185
117 3300013102 Ga0157371_10055390 Ga0157371_100553907 185
118 3300013102 Ga0157371_10099472 Ga0157371_100994722 185
119 3300013104 Ga0157370_10040395 Ga0157370_100403957 185
120 3300013104 Ga0157370_10042771 Ga0157370_100427715 185
121 3300013104 Ga0157370_10168614 Ga0157370_101686144 185
122 3300013104 Ga0157370_10255200 Ga0157370_102552002 185
123 3300013104 Ga0157370_10275256 Ga0157370_102752562 185
124 3300013297 Ga0157378_10948252 Ga0157378_109482521 185
125 3300013308 Ga0157375_10066260 Ga0157375_100662602 185
126 3300013308 Ga0157375_10087765 Ga0157375_100877653 185
127 3300014497 Ga0182008_10000034 Ga0182008_100000347 185
128 3300015261 Ga0182006_1022798 Ga0182006_10227982 185
129 3300015262 Ga0182007_10175227 Ga0182007_101752272 185
130 3300017792 Ga0163161_10087878 Ga0163161_100878784 185
131 3300017792 Ga0163161_10910882 Ga0163161_109108821 185
132 3300020069 Ga0197907_10876650 Ga0197907_108766502 185
133 3300020081 Ga0206354_10567599 Ga0206354_105675991 185
134 3300025292 Ga0209676_1000332 Ga0209676_100033249 185
135 3300025302 Ga0207426_1052403 Ga0207426_10524032 185
136 3300025932 Ga0207690_10000936 Ga0207690_1000093623 185
137 3300028794 Ga0307515_10007084 Ga0307515_1000708421 185
138 3300031548 Ga0307408_100003785 Ga0307408_1000037856 185
139 3300031548 Ga0307408_100044892 Ga0307408_1000448926 185
140 3300031731 Ga0307405_10845122 Ga0307405_108451221 185
141 3300031733 Ga0316577_10023552 Ga0316577_100235524 185
142 3300031911 Ga0307412_10006208 Ga0307412_100062083 185
143 3300031911 Ga0307412_10010373 Ga0307412_100103732 185
144 3300031911 Ga0307412_10733814 Ga0307412_107338142 185
145 3300032004 Ga0307414_10009044 Ga0307414_100090443 185
146 3300032004 Ga0307414_10011719 Ga0307414_100117192 185
147 3300032004 Ga0307414_10025882 Ga0307414_100258823 185
148 3300032004 Ga0307414_10041366 Ga0307414_100413661 185
149 3300032004 Ga0307414_10223769 Ga0307414_102237692 185
150 3300032004 Ga0307414_10802449 Ga0307414_108024492 185
151 3300033528 Ga0316588_1000386 Ga0316588_10003861 185
152 3300033541 Ga0316596_1032371 Ga0316596_10323712 185
153 3300036712 Ga0316584_0001842 Ga0316584_0001842_8400_8957 185
154 3300041452 Ga0451793_1672030 Ga0451793_1672030_561_1118 185
155 3300041459 Ga0451800_1623467 Ga0451800_1623467_107_664 185
156 3300041462 Ga0451806_151016 Ga0451806_151016_892_1449 185
157 3300041498 Ga0451841_0492225 Ga0451841_0492225_10_567 185
158 3300041507 Ga0451851_0440064 Ga0451851_0440064_299_856 185
159 3300041509 Ga0451843_0869665 Ga0451843_0869665_165_722 185
160 3300042876 Ga0451577_0066355 Ga0451577_0066355_2566_3123 185
161 3300042876 Ga0451577_0185904 Ga0451577_0185904_1247_1804 185
162 3300042876 Ga0451577_0197576 Ga0451577_0197576_177_734 185
163 3300042876 Ga0451577_0514043 Ga0451577_0514043_78_635 185
164 3300044712 Ga0453684_0000334 Ga0453684_0000334_157188_157745 185
165 3300044712 Ga0453684_0001193 Ga0453684_0001193_66647_67204 185
166 3300046471 Ga0495650_0028243 Ga0495650_0028243_1939_2496 185
167 3300046501 Ga0495607_0127771 Ga0495607_0127771_699_1256 185
168 3300046512 Ga0495610_0008200 Ga0495610_0008200_1763_2320 185
169 3300046529 Ga0495652_0058644 Ga0495652_0058644_496_1053 185
170 3300046538 Ga0495609_0037227 Ga0495609_0037227_571_1128 185
171 3300046663 Ga0495635_0300107 Ga0495635_0300107_429_986 185
172 3300048918 Ga0496115_0024014 Ga0496115_0024014_3746_4303 185
173 3300049127 Ga0501306_026778 Ga0501306_026778_261_818 185
174 3300049130 Ga0501310_009680 Ga0501310_009680_20_577 185
175 3300049161 Ga0501305_015714 Ga0501305_015714_27_584 185
176 3300049162 Ga0501307_026931 Ga0501307_026931_26_583 185
177 3300049528 Ga0501312_014651 Ga0501312_014651_535_1092 185
178 3300049530 Ga0501314_006210 Ga0501314_006210_26_583 185
179 3300049531 Ga0501315_000393 Ga0501315_000393_2374_2931 185
180 3300049533 Ga0501317_024809 Ga0501317_024809_263_820 185
181 3300049535 Ga0501319_000090 Ga0501319_000090_1358_1915 185
182 3300049539 Ga0501323_016323 Ga0501323_016323_125_682 185
183 3300049665 Ga0501227_080465 Ga0501227_080465_67_624 185
184 3300049671 Ga0501238_004631 Ga0501238_004631_100_657 185
185 3300050493 nmdc:mga0k408_4220_c1 nmdc:mga0k408_4220_c1_1152_1709 185
186 3300053093 Ga0500651_0000078 Ga0500651_0000078_21064_21621 185
187 3300053125 Ga0500618_000005 Ga0500618_000005_252060_252617 185
188 3300053156 Ga0500622_0000385 Ga0500622_0000385_33077_33634 185
189 3300059477 Ga0587084_008418 Ga0587084_008418_569_1216 185
190 3300059493 Ga0587077_022809 Ga0587077_022809_46_603 185
191 3300059510 Ga0587090_001193 Ga0587090_001193_1416_2063 185
192 3300059510 Ga0587090_016170 Ga0587090_016170_25_582 185
193 3300059624 Ga0587109_001196 Ga0587109_001196_1160_1807 185
194 3300059639 Ga0587062_000379 Ga0587062_000379_1116_1763 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

120

195

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

40

112

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.9406 2 179
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.9355 2 179
7p7u-assembly1.cif.gz_K e. faecalis 70s ribosome with p-trna, state iv 0.92 2 180
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9191 9 177
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.9162 8 180
ID Description Score Start End Superfamily
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9822 1 83 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9705 1 83 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.965 2 80 3.90.930.12
4io9E01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.931 6 83 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9229 3 83 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2M6YAH1-F1-model_v4 50S ribosomal protein L6 0.9898 1 84 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A383ENH4-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9877 1 99 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A0F9DYD6-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9868 1 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A381XPD8-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9866 1 99 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A355S367-F1-model_v4 50S ribosomal protein L6 0.9848 1 80 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.33 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map