F299207

General Info

Members Datasets Scaffolds Average Seq Length
194 148 388 253

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0010369|Ga0496119_0010369_4088_4933
Length 281
Sequence MLSQTPLVSGVCDDVSARGNLTMGGLAAVLYGASAYLLFLGTFLYAVGFVGNLPLPKTIDSGEAGQLVPTLIIDTLLLGVFAIQHSVMARPAFKRWWTRFVPHSIERATYVLLASLALVLLFWQWRPLQDTVWSMTSPIGVAVMHAVFWLGWVLVLISTFLINHFELFGLRQVYARLRRRTLPPPVFRLPFLYKRVRHPIYLGFLLAFWATPSMTVGHLLFAIGTTGYILIGITLEERDLIALFGDQYRRYREQVSMLIPLPRRRFDNGSQQMPPVRPERW

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
145 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
146 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
147 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
148 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.59
Nodule 1.55
Rhizoplane 2.06
Rhizosphere 74.23
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0010369 3300048922 Bacteria 7849
2 rootH2_10086154 3300003320 Bacteria 1741
3 Ga0070680_100214375 3300005336 Bacteria 1625
4 Ga0070680_100284134 3300005336 Bacteria 1402
5 Ga0068868_100767089 3300005338 Bacteria 868
6 Ga0070691_10274393 3300005341 Bacteria 912
7 Ga0070673_100426201 3300005364 Bacteria 1190
8 Ga0070667_100025325 3300005367 Bacteria 4931
9 Ga0070694_100095429 3300005444 Bacteria 2094
10 Ga0070708_100673030 3300005445 Bacteria 975
11 Ga0070681_10016394 3300005458 Bacteria 7396
12 Ga0070706_100105920 3300005467 Unclassified 2616
13 Ga0070707_100085321 3300005468 Bacteria 3052
14 Ga0070707_100797751 3300005468 Bacteria 908
15 Ga0070698_100014474 3300005471 Bacteria 8330
16 Ga0070699_100183798 3300005518 Bacteria 1856
17 Ga0070697_100031679 3300005536 Unclassified 4254
18 Ga0070695_100019967 3300005545 Bacteria 4086
19 Ga0070665_100038847 3300005548 Bacteria 4785
20 Ga0068855_100164354 3300005563 Bacteria 2517
21 Ga0068857_100920942 3300005577 Bacteria 839
22 Ga0068859_100676189 3300005617 Bacteria 1124
23 Ga0068861_100057738 3300005719 Bacteria 2965
24 Ga0081540_1000050 3300005983 Bacteria 126528
25 Ga0081540_1000099 3300005983 Bacteria 91686
26 Ga0081539_10004846 3300005985 Bacteria 14401
27 Ga0075365_10001610 3300006038 Bacteria 10397
28 Ga0075365_10004909 3300006038 Bacteria 7151
29 Ga0075368_10017858 3300006042 Bacteria 2659
30 Ga0075368_10026543 3300006042 Bacteria 2228
31 Ga0075363_100004212 3300006048 Bacteria 6247
32 Ga0075364_10058542 3300006051 Bacteria 2525
33 Ga0075364_10061906 3300006051 Bacteria 2455
34 Ga0075364_10191815 3300006051 Bacteria 1384
35 Ga0075364_10264881 3300006051 Bacteria 1168
36 Ga0075362_10051704 3300006177 Bacteria 1840
37 Ga0075367_10012684 3300006178 Bacteria 4506
38 Ga0075367_10031815 3300006178 Bacteria 3031
39 Ga0075367_10152206 3300006178 Bacteria 1436
40 Ga0075366_10008703 3300006195 Bacteria 5651
41 Ga0075366_10010615 3300006195 Bacteria 5173
42 Ga0097621_100235840 3300006237 Bacteria 1598
43 Ga0068871_100075654 3300006358 Bacteria 2780
44 Ga0075428_100000873 3300006844 Bacteria 31705
45 Ga0075428_100455527 3300006844 Bacteria 1370
46 Ga0075430_100295404 3300006846 Bacteria 1340
47 Ga0075431_100010249 3300006847 Bacteria 9421
48 Ga0075433_10270736 3300006852 Bacteria 1505
49 Ga0075433_10503398 3300006852 Bacteria 1066
50 Ga0075434_100010631 3300006871 Bacteria 8636
51 Ga0075429_100048777 3300006880 Bacteria 3682
52 Ga0075436_100001923 3300006914 Bacteria 14264
53 Ga0097620_100676183 3300006931 Bacteria 1124
54 Ga0075435_100001860 3300007076 Bacteria 13707
55 Ga0099794_10004350 3300007265 Bacteria 5548
56 Ga0105240_10003004 3300009093 Bacteria 26546
57 Ga0105240_10007400 3300009093 Bacteria 15963
58 Ga0111539_10000418 3300009094 Bacteria 53186
59 Ga0111539_10034844 3300009094 Bacteria 6099
60 Ga0114129_10000336 3300009147 Bacteria 55036
61 Ga0105237_10859411 3300009545 Bacteria 914
62 Ga0105238_10225005 3300009551 Bacteria 1853
63 Ga0105249_10658094 3300009553 Bacteria 1105
64 Ga0099796_10001448 3300010159 Bacteria 4784
65 Ga0105239_10182644 3300010375 Bacteria 2347
66 Ga0157370_10266477 3300013104 Bacteria 1583
67 Ga0157372_10233140 3300013307 Bacteria 2134
68 Ga0163163_10217199 3300014325 Bacteria 1961
69 Ga0163163_10805205 3300014325 Bacteria 1003
70 Ga0163161_10169573 3300017792 Bacteria 1668
71 Ga0207684_10054660 3300025910 Bacteria 3388
72 Ga0207684_10091104 3300025910 Unclassified 2598
73 Ga0207684_10094152 3300025910 Unclassified 2555
74 Ga0207684_10205994 3300025910 Bacteria 1697
75 Ga0207707_10223872 3300025912 Bacteria 1637
76 Ga0207695_10006643 3300025913 Bacteria 14926
77 Ga0207695_10014418 3300025913 Bacteria 9364
78 Ga0207695_10084890 3300025913 Bacteria 3196
79 Ga0207660_10249681 3300025917 Bacteria 1400
80 Ga0207646_10002208 3300025922 Bacteria 23185
81 Ga0207646_10470151 3300025922 Bacteria 1134
82 Ga0207665_10081328 3300025939 Unclassified 2230
83 Ga0207668_10486610 3300025972 Bacteria 1059
84 Ga0207668_10693239 3300025972 Bacteria 895
85 Ga0209179_1002310 3300027512 Bacteria 2553
86 Ga0209588_1032629 3300027671 Bacteria 1668
87 Ga0209813_10012792 3300027866 Bacteria 2227
88 Ga0207428_10010226 3300027907 Bacteria 8387
89 Ga0268266_10467638 3300028379 Bacteria 1200
90 Ga0265336_10000008 3300028666 Bacteria 336082
91 Ga0265324_10000579 3300029957 Bacteria 24973
92 Ga0373956_0066582 3300035119 Bacteria 1639
93 Ga0373955_0001995 3300035172 Bacteria 8810
94 Ga0373924_0008424 3300035410 Bacteria 3747
95 Ga0373933_0001665 3300035724 Bacteria 12922
96 Ga0373937_0014729 3300036401 Bacteria 6903
97 Ga0373925_0080607 3300037068 Bacteria 2474
98 Ga0395900_0198002 3300037418 Bacteria 2034
99 Ga0395898_0020093 3300037466 Bacteria 6786
100 Ga0395898_0035445 3300037466 Bacteria 4961
101 Ga0395901_0098159 3300038443 Bacteria 3071
102 Ga0439452_049229 3300042010 Bacteria 970
103 Ga0466960_0191706 3300044901 Bacteria 1113
104 Ga0466967_0073043 3300045976 Bacteria 3076
105 Ga0466967_0294715 3300045976 Bacteria 1559
106 Ga0466967_0618432 3300045976 Bacteria 1070
107 Ga0495651_0015626 3300046462 Bacteria 5876
108 Ga0495664_0010744 3300046477 Bacteria 5147
109 Ga0495584_0043411 3300046491 Bacteria 2269
110 Ga0495608_0013957 3300046511 Bacteria 5574
111 Ga0495618_0255157 3300046514 Bacteria 1099
112 Ga0495640_0040859 3300046533 Bacteria 3245
113 Ga0495587_0008235 3300046536 Bacteria 6713
114 Ga0495645_0003207 3300046543 Bacteria 11091
115 Ga0495667_0169906 3300046559 Bacteria 1401
116 Ga0495657_0018234 3300046675 Bacteria 5085
117 Ga0495646_0007539 3300046680 Bacteria 6914
118 Ga0495675_0028494 3300047444 Bacteria 3559
119 Ga0495602_0000523 3300048088 Bacteria 35816
120 Ga0495602_0035207 3300048088 Bacteria 4671
121 Ga0496100_0168542 3300048903 Bacteria 1575
122 Ga0496102_0150490 3300048905 Bacteria 2187
123 Ga0496110_0573121 3300048913 Bacteria 1025
124 Ga0496114_0082498 3300048917 Bacteria 2718
125 Ga0496120_0073811 3300048923 Bacteria 1865
126 Ga0501033_0107852 3300049570 Bacteria 2029
127 Ga0501034_0358713 3300049571 Bacteria 1385
128 Ga0501041_0122442 3300049577 Bacteria 1617
129 Ga0501043_0475614 3300049579 Bacteria 936
130 Ga0501046_0332133 3300049580 Bacteria 1106
131 Ga0501047_0030455 3300049581 Bacteria 5202
132 Ga0501048_0393458 3300049582 Bacteria 990
133 Ga0501067_0058980 3300049583 Bacteria 2125
134 Ga0501068_0095132 3300049584 Bacteria 1842
135 Ga0501070_0106062 3300049586 Bacteria 2322
136 Ga0501071_0647446 3300049587 Bacteria 813
137 Ga0501072_0041202 3300049588 Bacteria 3627
138 Ga0501074_0313572 3300049590 Bacteria 1114
139 Ga0501075_0584133 3300049591 Bacteria 852
140 Ga0501077_0027845 3300049593 Bacteria 3589
141 Ga0501080_0059890 3300049742 Bacteria 3543
142 Ga0501081_0005403 3300049743 Bacteria 8246
143 Ga0501035_0029128 3300049822 Bacteria 5036
144 Ga0501044_0011668 3300049823 Bacteria 9523
145 Ga0501044_0472834 3300049823 Bacteria 1157
146 Ga0501045_0029552 3300049824 Bacteria 3963
147 nmdc:mga03683_4573_c1 3300050489 Bacteria 4605
148 nmdc:mga03683_5419_c1 3300050489 Bacteria 2835
149 nmdc:mga00v17_150896_c1 3300050491 Bacteria 1493
150 nmdc:mga00v17_51370_c1 3300050491 Bacteria 2507
151 nmdc:mga0yw44_1018_c1 3300050492 Bacteria 10729
152 nmdc:mga0yw44_131616_c1 3300050492 Bacteria 1155
153 nmdc:mga0yw44_156567_c1 3300050492 Bacteria 1489
154 nmdc:mga0k408_167913_c1 3300050493 Bacteria 1308
155 nmdc:mga0k408_215537_c1 3300050493 Bacteria 1146
156 nmdc:mga0k408_39587_c1 3300050493 Bacteria 2710
157 nmdc:mga06z11_116252_c1 3300050494 Bacteria 1487
158 nmdc:mga06z11_120114_c1 3300050494 Bacteria 1465
159 nmdc:mga06z11_184193_c1 3300050494 Bacteria 1206
160 nmdc:mga06z11_238971_c1 3300050494 Bacteria 1066
161 nmdc:mga06z11_9566_c1 3300050494 Bacteria 3737
162 nmdc:mga04h51_86073_c1 3300050495 Bacteria 1124
163 nmdc:mga07m45_35574_c1 3300050496 Bacteria 2770
164 nmdc:mga07m45_46606_c1 3300050496 Bacteria 2436
165 nmdc:mga07m45_70087_c1 3300050496 Bacteria 1994
166 nmdc:mga05p37_22_c2 3300050507 Bacteria 58856
167 nmdc:mga09592_1693_c1 3300050508 Bacteria 17790
168 nmdc:mga0qj67_284506_c1 3300050509 Bacteria 1340
169 nmdc:mga06r32_1343_c1 3300050510 Bacteria 22205
170 nmdc:mga06r32_165099_c1 3300050510 Bacteria 2197
171 nmdc:mga08y16_177_c1 3300050511 Bacteria 56157
172 nmdc:mga0n895_31310_c1 3300050512 Bacteria 5092
173 nmdc:mga0rr50_7923_c1 3300050513 Bacteria 6590
174 nmdc:mga08x19_1532_c1 3300050514 Bacteria 14335
175 nmdc:mga0a205_369451_c1 3300050515 Bacteria 1300
176 nmdc:mga0a205_61510_c1 3300050515 Bacteria 1577
177 Ga0495601_0002285 3300053077 Bacteria 10818
178 Ga0495601_0024489 3300053077 Bacteria 3717
179 Ga0495612_0000744 3300053078 Bacteria 13255
180 Ga0495595_0002410 3300053084 Bacteria 7299
181 Ga0495595_0018774 3300053084 Bacteria 2992
182 Ga0495619_0009386 3300053085 Bacteria 6172
183 Ga0495619_0059731 3300053085 Bacteria 2533
184 Ga0500641_0005021 3300053096 Bacteria 4692
185 Ga0500616_0155485 3300053153 Bacteria 1054
186 Ga0500636_0106767 3300053177 Bacteria 1586
187 Ga0501082_0610843 3300060353 Bacteria 954
188 Ga0501082_0684809 3300060353 Bacteria 897
189 Ga0530510_0040390 3300061734 Bacteria 3367
190 2524435525 2524023205 Bacteria 8918781
191 2545676303 2545555834 Bacteria 8130841
192 2643756011 2643221547 Bacteria 4740017
193 2745079781 2744054633 Bacteria 8678936
194 2876762308 2876761206 Bacteria 10111113
195 Ga0496119_0010369
196 rootH2_10086154
197 Ga0070680_100214375
198 Ga0070680_100284134
199 Ga0068868_100767089
200 Ga0070691_10274393
201 Ga0070673_100426201
202 Ga0070667_100025325
203 Ga0070694_100095429
204 Ga0070708_100673030
205 Ga0070681_10016394
206 Ga0070706_100105920
207 Ga0070707_100085321
208 Ga0070707_100797751
209 Ga0070698_100014474
210 Ga0070699_100183798
211 Ga0070697_100031679
212 Ga0070695_100019967
213 Ga0070665_100038847
214 Ga0068855_100164354
215 Ga0068857_100920942
216 Ga0068859_100676189
217 Ga0068861_100057738
218 Ga0081540_1000050
219 Ga0081540_1000099
220 Ga0081539_10004846
221 Ga0075365_10001610
222 Ga0075365_10004909
223 Ga0075368_10017858
224 Ga0075368_10026543
225 Ga0075363_100004212
226 Ga0075364_10058542
227 Ga0075364_10061906
228 Ga0075364_10191815
229 Ga0075364_10264881
230 Ga0075362_10051704
231 Ga0075367_10012684
232 Ga0075367_10031815
233 Ga0075367_10152206
234 Ga0075366_10008703
235 Ga0075366_10010615
236 Ga0097621_100235840
237 Ga0068871_100075654
238 Ga0075428_100000873
239 Ga0075428_100455527
240 Ga0075430_100295404
241 Ga0075431_100010249
242 Ga0075433_10270736
243 Ga0075433_10503398
244 Ga0075434_100010631
245 Ga0075429_100048777
246 Ga0075436_100001923
247 Ga0097620_100676183
248 Ga0075435_100001860
249 Ga0099794_10004350
250 Ga0105240_10003004
251 Ga0105240_10007400
252 Ga0111539_10000418
253 Ga0111539_10034844
254 Ga0114129_10000336
255 Ga0105237_10859411
256 Ga0105238_10225005
257 Ga0105249_10658094
258 Ga0099796_10001448
259 Ga0105239_10182644
260 Ga0157370_10266477
261 Ga0157372_10233140
262 Ga0163163_10217199
263 Ga0163163_10805205
264 Ga0163161_10169573
265 Ga0207684_10054660
266 Ga0207684_10091104
267 Ga0207684_10094152
268 Ga0207684_10205994
269 Ga0207707_10223872
270 Ga0207695_10006643
271 Ga0207695_10014418
272 Ga0207695_10084890
273 Ga0207660_10249681
274 Ga0207646_10002208
275 Ga0207646_10470151
276 Ga0207665_10081328
277 Ga0207668_10486610
278 Ga0207668_10693239
279 Ga0209179_1002310
280 Ga0209588_1032629
281 Ga0209813_10012792
282 Ga0207428_10010226
283 Ga0268266_10467638
284 Ga0265336_10000008
285 Ga0265324_10000579
286 Ga0373956_0066582
287 Ga0373955_0001995
288 Ga0373924_0008424
289 Ga0373933_0001665
290 Ga0373937_0014729
291 Ga0373925_0080607
292 Ga0395900_0198002
293 Ga0395898_0020093
294 Ga0395898_0035445
295 Ga0395901_0098159
296 Ga0439452_049229
297 Ga0466960_0191706
298 Ga0466967_0073043
299 Ga0466967_0294715
300 Ga0466967_0618432
301 Ga0495651_0015626
302 Ga0495664_0010744
303 Ga0495584_0043411
304 Ga0495608_0013957
305 Ga0495618_0255157
306 Ga0495640_0040859
307 Ga0495587_0008235
308 Ga0495645_0003207
309 Ga0495667_0169906
310 Ga0495657_0018234
311 Ga0495646_0007539
312 Ga0495675_0028494
313 Ga0495602_0000523
314 Ga0495602_0035207
315 Ga0496100_0168542
316 Ga0496102_0150490
317 Ga0496110_0573121
318 Ga0496114_0082498
319 Ga0496120_0073811
320 Ga0501033_0107852
321 Ga0501034_0358713
322 Ga0501041_0122442
323 Ga0501043_0475614
324 Ga0501046_0332133
325 Ga0501047_0030455
326 Ga0501048_0393458
327 Ga0501067_0058980
328 Ga0501068_0095132
329 Ga0501070_0106062
330 Ga0501071_0647446
331 Ga0501072_0041202
332 Ga0501074_0313572
333 Ga0501075_0584133
334 Ga0501077_0027845
335 Ga0501080_0059890
336 Ga0501081_0005403
337 Ga0501035_0029128
338 Ga0501044_0011668
339 Ga0501044_0472834
340 Ga0501045_0029552
341 nmdc:mga03683_4573_c1
342 nmdc:mga03683_5419_c1
343 nmdc:mga00v17_150896_c1
344 nmdc:mga00v17_51370_c1
345 nmdc:mga0yw44_1018_c1
346 nmdc:mga0yw44_131616_c1
347 nmdc:mga0yw44_156567_c1
348 nmdc:mga0k408_167913_c1
349 nmdc:mga0k408_215537_c1
350 nmdc:mga0k408_39587_c1
351 nmdc:mga06z11_116252_c1
352 nmdc:mga06z11_120114_c1
353 nmdc:mga06z11_184193_c1
354 nmdc:mga06z11_238971_c1
355 nmdc:mga06z11_9566_c1
356 nmdc:mga04h51_86073_c1
357 nmdc:mga07m45_35574_c1
358 nmdc:mga07m45_46606_c1
359 nmdc:mga07m45_70087_c1
360 nmdc:mga05p37_22_c2
361 nmdc:mga09592_1693_c1
362 nmdc:mga0qj67_284506_c1
363 nmdc:mga06r32_1343_c1
364 nmdc:mga06r32_165099_c1
365 nmdc:mga08y16_177_c1
366 nmdc:mga0n895_31310_c1
367 nmdc:mga0rr50_7923_c1
368 nmdc:mga08x19_1532_c1
369 nmdc:mga0a205_369451_c1
370 nmdc:mga0a205_61510_c1
371 Ga0495601_0002285
372 Ga0495601_0024489
373 Ga0495612_0000744
374 Ga0495595_0002410
375 Ga0495595_0018774
376 Ga0495619_0009386
377 Ga0495619_0059731
378 Ga0500641_0005021
379 Ga0500616_0155485
380 Ga0500636_0106767
381 Ga0501082_0610843
382 Ga0501082_0684809
383 Ga0530510_0040390
384 2524435525
385 2545676303
386 2643756011
387 2745079781
388 2876762308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

74

255

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.4195 30 257
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.4051 22 226
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.394 22 226
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.3938 30 257
5jra-assembly1.cif.gz_A-2 nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans 0.3849 57 173
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9899 64 254 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9747 64 254 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8523 65 225 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8366 65 224 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8107 65 225 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A537T7R4-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9949 16 254 GO:0008168
GO:0016020
GO:0032259
AF-K8P644-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9934 16 257 GO:0008168
GO:0016020
GO:0032259
AF-A0A7C4VBS6-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9909 19 254 GO:0008168
GO:0016020
GO:0032259
AF-A0A127F145-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9895 16 254 GO:0008168
GO:0016020
GO:0032259
AF-A0A4Q0S0R8-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9895 16 254 GO:0008168
GO:0016020
GO:0032259

Map