F298805

General Info

Members Datasets Scaffolds Average Seq Length
194 141 388 436

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1042537|Ga0265319_10425372
Length 463
Sequence VTGSREELYALCKVRYARSMPSIEIRTEVPGPRSRAWIERKERAVANAKALWVPVFVESAEGALITDVDGNTFVDFAGGIGCLAVGHSNAAVTAAVQGQVARFLHTDFTVMPYDSYVELAERLCARLPISGPTKAAFFNSGAEAVENAVKIAKAATGRPAVIAYEGAFHGRTLMAMSLTSKQHPYKAGFGPFAPEVYRVAYPYEYRWPAGDACEGALDDLRRAFTTRIAPEDVAAIVIEPVQGEGGFVPAPAAYLKGLREICDEHGIVLIADEVQTGFGRTGTLFAIEQSGIEPDLVCVAKSIAAGLPLSGVLGRAEIMDAPGDSTIGGTYVGNPVACVAALAVLDEIDRLELCARAREIGESLTRRMRDLQRRVPQLGDVRGLGSMVGLEFVRDARTREPAPEIATRVAEHALQHGLVLLKAGLFGNVIRNLAPLVITDGELAEALDVLEAAIEHAVAAVAA

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
96 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
97 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 2671180694 Paenibacillus sp. A3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 3.61
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.79
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1042537 3300028563 Bacteria 1528
2 JGI25406J46586_10002115 3300003203 Bacteria 9373
3 JGI26129J50193_1001179 3300003349 Bacteria 1749
4 JGI25407J50210_10000247 3300003373 Bacteria 9515
5 JGI25407J50210_10013407 3300003373 Bacteria 2106
6 Ga0065707_10103347 3300005295 Bacteria 2754
7 Ga0070658_10049736 3300005327 Bacteria 3397
8 Ga0070658_10242429 3300005327 Bacteria 1528
9 Ga0070683_100002248 3300005329 Bacteria 15316
10 Ga0070680_100030635 3300005336 Bacteria 4322
11 Ga0070682_100016544 3300005337 Bacteria 4290
12 Ga0070660_100003210 3300005339 Bacteria 11232
13 Ga0070660_100048704 3300005339 Bacteria 3255
14 Ga0070661_100014561 3300005344 Bacteria 5543
15 Ga0070661_100025864 3300005344 Bacteria 4218
16 Ga0070659_100006652 3300005366 Bacteria 8354
17 Ga0070667_100055702 3300005367 Bacteria 3339
18 Ga0070714_100166764 3300005435 Bacteria 1996
19 Ga0070705_100007619 3300005440 Bacteria 5336
20 Ga0070678_100001519 3300005456 Bacteria 12388
21 Ga0070681_10021352 3300005458 Bacteria 6491
22 Ga0070681_10026712 3300005458 Bacteria 5804
23 Ga0070681_10027294 3300005458 Bacteria 5740
24 Ga0070681_10043874 3300005458 Bacteria 4476
25 Ga0070698_100071846 3300005471 Bacteria 3469
26 Ga0070698_100086584 3300005471 Bacteria 3119
27 Ga0070698_100149475 3300005471 Bacteria 2284
28 Ga0070679_100002180 3300005530 Bacteria 17674
29 Ga0070679_100021997 3300005530 Bacteria 6229
30 Ga0070679_100051945 3300005530 Bacteria 4083
31 Ga0070679_100052442 3300005530 Bacteria 4062
32 Ga0070684_100012096 3300005535 Bacteria 6901
33 Ga0070684_100088917 3300005535 Bacteria 2744
34 Ga0070684_100276251 3300005535 Bacteria 1539
35 Ga0070686_100002473 3300005544 Bacteria 10175
36 Ga0070696_100028809 3300005546 Bacteria 3790
37 Ga0070693_100141539 3300005547 Bacteria 1515
38 Ga0070704_100013579 3300005549 Bacteria 5059
39 Ga0068855_100008345 3300005563 Bacteria 12524
40 Ga0068855_100054362 3300005563 Bacteria 4706
41 Ga0068855_100069648 3300005563 Bacteria 4093
42 Ga0068855_100070407 3300005563 Bacteria 4069
43 Ga0068857_100060932 3300005577 Bacteria 3352
44 Ga0068856_100131268 3300005614 Bacteria 2509
45 Ga0068859_100150733 3300005617 Bacteria 2401
46 Ga0068858_100047621 3300005842 Bacteria 3973
47 Ga0081455_10001959 3300005937 Bacteria 24720
48 Ga0081538_10000257 3300005981 Bacteria 60184
49 Ga0081538_10000330 3300005981 Bacteria 54129
50 Ga0081538_10014697 3300005981 Bacteria 6111
51 Ga0081539_10000244 3300005985 Bacteria 127514
52 Ga0097621_100014256 3300006237 Bacteria 5944
53 Ga0068871_100005779 3300006358 Bacteria 8691
54 Ga0075428_100008349 3300006844 Bacteria 11483
55 Ga0075433_10186988 3300006852 Bacteria 1843
56 Ga0075434_100005006 3300006871 Bacteria 12027
57 Ga0068865_100040079 3300006881 Bacteria 3181
58 Ga0097620_100150735 3300006931 Bacteria 2401
59 Ga0075435_100012867 3300007076 Bacteria 6206
60 Ga0105240_10131641 3300009093 Bacteria 3000
61 Ga0111539_10386829 3300009094 Bacteria 1629
62 Ga0105247_10021025 3300009101 Bacteria 3926
63 Ga0105242_10002197 3300009176 Bacteria 15395
64 Ga0105248_10009334 3300009177 Bacteria 10803
65 Ga0105237_10043096 3300009545 Bacteria 4548
66 Ga0105237_10115550 3300009545 Bacteria 2677
67 Ga0105238_10019651 3300009551 Bacteria 6879
68 Ga0105239_10249555 3300010375 Bacteria 1993
69 Ga0157370_10106793 3300013104 Bacteria 2620
70 Ga0157369_10048580 3300013105 Bacteria 4604
71 Ga0157372_10036661 3300013307 Bacteria 5406
72 Ga0157372_10067683 3300013307 Bacteria 4014
73 Ga0157372_10167679 3300013307 Bacteria 2540
74 Ga0157375_10389203 3300013308 Bacteria 1561
75 Ga0157379_10017832 3300014968 Bacteria 6255
76 Ga0157376_10022042 3300014969 Bacteria 4957
77 Ga0197907_10063038 3300020069 Bacteria 2794
78 Ga0206356_11296528 3300020070 Bacteria 1605
79 Ga0206356_11359897 3300020070 Bacteria 2076
80 Ga0206354_10858020 3300020081 Bacteria 3827
81 Ga0206354_11369986 3300020081 Bacteria 2948
82 Ga0206354_11694128 3300020081 Bacteria 2049
83 Ga0206353_10942720 3300020082 Bacteria 4951
84 Ga0213875_10025057 3300021388 Bacteria 2843
85 Ga0213875_10035406 3300021388 Bacteria 2356
86 Ga0207680_10036740 3300025903 Bacteria 2822
87 Ga0207705_10170777 3300025909 Bacteria 1637
88 Ga0207707_10003081 3300025912 Bacteria 14792
89 Ga0207707_10052183 3300025912 Bacteria 3562
90 Ga0207707_10080686 3300025912 Bacteria 2841
91 Ga0207707_10174077 3300025912 Bacteria 1880
92 Ga0207695_10071471 3300025913 Bacteria 3544
93 Ga0207671_10067364 3300025914 Bacteria 2666
94 Ga0207660_10048605 3300025917 Bacteria 3003
95 Ga0207660_10116446 3300025917 Bacteria 2018
96 Ga0207662_10098073 3300025918 Bacteria 1813
97 Ga0207657_10001668 3300025919 Bacteria 23957
98 Ga0207657_10002384 3300025919 Bacteria 20331
99 Ga0207657_10088728 3300025919 Bacteria 2584
100 Ga0207657_10168474 3300025919 Bacteria 1776
101 Ga0207649_10019625 3300025920 Bacteria 3866
102 Ga0207652_10016723 3300025921 Bacteria 5993
103 Ga0207652_10023834 3300025921 Bacteria 5074
104 Ga0207652_10165207 3300025921 Bacteria 1985
105 Ga0207646_10021124 3300025922 Bacteria 6021
106 Ga0207646_10125718 3300025922 Bacteria 2306
107 Ga0207686_10010682 3300025934 Bacteria 5000
108 Ga0207704_10012976 3300025938 Bacteria 4154
109 Ga0207665_10126737 3300025939 Bacteria 1809
110 Ga0207711_10011686 3300025941 Bacteria 7295
111 Ga0207667_10182702 3300025949 Bacteria 2153
112 Ga0207658_10030205 3300025986 Bacteria 3835
113 Ga0207703_10137760 3300026035 Bacteria 2115
114 Ga0207678_10082074 3300026067 Bacteria 2759
115 Ga0207641_10257402 3300026088 Bacteria 1633
116 Ga0207648_10034492 3300026089 Bacteria 4460
117 Ga0207674_10039822 3300026116 Bacteria 4870
118 Ga0207674_10135013 3300026116 Bacteria 2429
119 Ga0207683_10001018 3300026121 Bacteria 25542
120 Ga0209983_1005645 3300027665 Bacteria 2580
121 Ga0209998_10000071 3300027717 Bacteria 40845
122 Ga0209974_10001682 3300027876 Bacteria 8009
123 Ga0268266_10035735 3300028379 Bacteria 4226
124 Ga0265319_1008197 3300028563 Bacteria 4606
125 Ga0265322_10006155 3300028654 Bacteria 3533
126 Ga0265338_10001613 3300028800 Bacteria 36084
127 Ga0265338_10062935 3300028800 Bacteria 3239
128 Ga0265320_10020063 3300031240 Bacteria 3634
129 Ga0307416_100204669 3300032002 Bacteria 1876
130 Ga0395898_0049285 3300037466 Bacteria 4127
131 Ga0395898_0201105 3300037466 Bacteria 1902
132 Ga0395905_0308810 3300037471 Bacteria 1470
133 Ga0436364_0584884 3300037853 Bacteria 7336
134 Ga0436364_1149324 3300037853 Bacteria 4247
135 Ga0436364_1218381 3300037853 Bacteria 10796
136 Ga0436363_1433871 3300039450 Bacteria 1762
137 Ga0436363_1585825 3300039450 Bacteria 3808
138 Ga0439441_005864 3300042001 Bacteria 1926
139 Ga0450920_003097 3300042122 Bacteria 2871
140 Ga0450906_009917 3300042145 Bacteria 1808
141 Ga0450907_002845 3300042146 Bacteria 3194
142 Ga0466972_0004804 3300044658 Bacteria 6773
143 Ga0466963_0008848 3300044694 Bacteria 6041
144 Ga0466959_0040075 3300045049 Bacteria 3461
145 Ga0466958_0024563 3300045836 Bacteria 3547
146 Ga0495603_0028316 3300046455 Bacteria 3379
147 Ga0495653_0033510 3300046463 Bacteria 4069
148 Ga0495605_0033626 3300046474 Bacteria 2601
149 Ga0495596_0041016 3300046500 Bacteria 1826
150 Ga0495608_0037109 3300046511 Bacteria 3278
151 Ga0495608_0205473 3300046511 Bacteria 1239
152 Ga0495630_0180985 3300046517 Bacteria 1607
153 Ga0495652_0103218 3300046529 Bacteria 2308
154 Ga0495667_0010337 3300046559 Bacteria 6313
155 Ga0495661_0143752 3300046665 Bacteria 1295
156 Ga0495599_0035018 3300046678 Bacteria 3152
157 Ga0495646_0025637 3300046680 Bacteria 3708
158 Ga0495589_0087935 3300046794 Bacteria 1509
159 Ga0495600_0061325 3300046809 Bacteria 2456
160 Ga0495604_0012391 3300047317 Bacteria 6779
161 Ga0495680_0016442 3300047322 Bacteria 6353
162 Ga0495684_0013380 3300047471 Bacteria 6315
163 Ga0496101_0003883 3300048904 Bacteria 9340
164 Ga0496101_0026433 3300048904 Bacteria 4036
165 Ga0496102_0007980 3300048905 Bacteria 9045
166 Ga0496104_0012932 3300048907 Bacteria 7514
167 Ga0496105_0005794 3300048908 Bacteria 9421
168 Ga0496105_0049198 3300048908 Bacteria 3480
169 Ga0496106_0006809 3300048909 Bacteria 8459
170 Ga0496107_0003650 3300048910 Bacteria 10347
171 Ga0496108_0000072 3300048911 Bacteria 112559
172 Ga0496109_0073623 3300048912 Bacteria 3139
173 Ga0496109_0118638 3300048912 Bacteria 2463
174 Ga0496110_0006175 3300048913 Bacteria 9454
175 Ga0496112_0010928 3300048915 Bacteria 8266
176 Ga0496112_0019900 3300048915 Bacteria 6351
177 Ga0496112_0046285 3300048915 Bacteria 4266
178 Ga0496112_0047154 3300048915 Bacteria 4227
179 Ga0496112_0143163 3300048915 Bacteria 2360
180 Ga0496114_0006128 3300048917 Bacteria 9461
181 Ga0496115_0075252 3300048918 Bacteria 2742
182 Ga0496126_0070408 3300048929 Bacteria 3116
183 Ga0501031_0002646 3300049568 Bacteria 11395
184 Ga0501033_0027027 3300049570 Bacteria 4317
185 Ga0501067_0001313 3300049583 Bacteria 13478
186 Ga0501068_0009481 3300049584 Bacteria 5450
187 Ga0501068_0144432 3300049584 Bacteria 1493
188 Ga0501069_0007192 3300049585 Bacteria 5836
189 nmdc:mga0n895_11420_c1 3300050512 Bacteria 7923
190 nmdc:mga0a205_22599_c2 3300050515 Bacteria 4504
191 Ga0495601_0042705 3300053077 Bacteria 2845
192 Ga0495619_0003446 3300053085 Bacteria 10204
193 Ga0495619_0091793 3300053085 Bacteria 2056
194 2673820704 2671180694 Bacteria 7506943
195 Ga0265319_1042537
196 JGI25406J46586_10002115
197 JGI26129J50193_1001179
198 JGI25407J50210_10000247
199 JGI25407J50210_10013407
200 Ga0065707_10103347
201 Ga0070658_10049736
202 Ga0070658_10242429
203 Ga0070683_100002248
204 Ga0070680_100030635
205 Ga0070682_100016544
206 Ga0070660_100003210
207 Ga0070660_100048704
208 Ga0070661_100014561
209 Ga0070661_100025864
210 Ga0070659_100006652
211 Ga0070667_100055702
212 Ga0070714_100166764
213 Ga0070705_100007619
214 Ga0070678_100001519
215 Ga0070681_10021352
216 Ga0070681_10026712
217 Ga0070681_10027294
218 Ga0070681_10043874
219 Ga0070698_100071846
220 Ga0070698_100086584
221 Ga0070698_100149475
222 Ga0070679_100002180
223 Ga0070679_100021997
224 Ga0070679_100051945
225 Ga0070679_100052442
226 Ga0070684_100012096
227 Ga0070684_100088917
228 Ga0070684_100276251
229 Ga0070686_100002473
230 Ga0070696_100028809
231 Ga0070693_100141539
232 Ga0070704_100013579
233 Ga0068855_100008345
234 Ga0068855_100054362
235 Ga0068855_100069648
236 Ga0068855_100070407
237 Ga0068857_100060932
238 Ga0068856_100131268
239 Ga0068859_100150733
240 Ga0068858_100047621
241 Ga0081455_10001959
242 Ga0081538_10000257
243 Ga0081538_10000330
244 Ga0081538_10014697
245 Ga0081539_10000244
246 Ga0097621_100014256
247 Ga0068871_100005779
248 Ga0075428_100008349
249 Ga0075433_10186988
250 Ga0075434_100005006
251 Ga0068865_100040079
252 Ga0097620_100150735
253 Ga0075435_100012867
254 Ga0105240_10131641
255 Ga0111539_10386829
256 Ga0105247_10021025
257 Ga0105242_10002197
258 Ga0105248_10009334
259 Ga0105237_10043096
260 Ga0105237_10115550
261 Ga0105238_10019651
262 Ga0105239_10249555
263 Ga0157370_10106793
264 Ga0157369_10048580
265 Ga0157372_10036661
266 Ga0157372_10067683
267 Ga0157372_10167679
268 Ga0157375_10389203
269 Ga0157379_10017832
270 Ga0157376_10022042
271 Ga0197907_10063038
272 Ga0206356_11296528
273 Ga0206356_11359897
274 Ga0206354_10858020
275 Ga0206354_11369986
276 Ga0206354_11694128
277 Ga0206353_10942720
278 Ga0213875_10025057
279 Ga0213875_10035406
280 Ga0207680_10036740
281 Ga0207705_10170777
282 Ga0207707_10003081
283 Ga0207707_10052183
284 Ga0207707_10080686
285 Ga0207707_10174077
286 Ga0207695_10071471
287 Ga0207671_10067364
288 Ga0207660_10048605
289 Ga0207660_10116446
290 Ga0207662_10098073
291 Ga0207657_10001668
292 Ga0207657_10002384
293 Ga0207657_10088728
294 Ga0207657_10168474
295 Ga0207649_10019625
296 Ga0207652_10016723
297 Ga0207652_10023834
298 Ga0207652_10165207
299 Ga0207646_10021124
300 Ga0207646_10125718
301 Ga0207686_10010682
302 Ga0207704_10012976
303 Ga0207665_10126737
304 Ga0207711_10011686
305 Ga0207667_10182702
306 Ga0207658_10030205
307 Ga0207703_10137760
308 Ga0207678_10082074
309 Ga0207641_10257402
310 Ga0207648_10034492
311 Ga0207674_10039822
312 Ga0207674_10135013
313 Ga0207683_10001018
314 Ga0209983_1005645
315 Ga0209998_10000071
316 Ga0209974_10001682
317 Ga0268266_10035735
318 Ga0265319_1008197
319 Ga0265322_10006155
320 Ga0265338_10001613
321 Ga0265338_10062935
322 Ga0265320_10020063
323 Ga0307416_100204669
324 Ga0395898_0049285
325 Ga0395898_0201105
326 Ga0395905_0308810
327 Ga0436364_0584884
328 Ga0436364_1149324
329 Ga0436364_1218381
330 Ga0436363_1433871
331 Ga0436363_1585825
332 Ga0439441_005864
333 Ga0450920_003097
334 Ga0450906_009917
335 Ga0450907_002845
336 Ga0466972_0004804
337 Ga0466963_0008848
338 Ga0466959_0040075
339 Ga0466958_0024563
340 Ga0495603_0028316
341 Ga0495653_0033510
342 Ga0495605_0033626
343 Ga0495596_0041016
344 Ga0495608_0037109
345 Ga0495608_0205473
346 Ga0495630_0180985
347 Ga0495652_0103218
348 Ga0495667_0010337
349 Ga0495661_0143752
350 Ga0495599_0035018
351 Ga0495646_0025637
352 Ga0495589_0087935
353 Ga0495600_0061325
354 Ga0495604_0012391
355 Ga0495680_0016442
356 Ga0495684_0013380
357 Ga0496101_0003883
358 Ga0496101_0026433
359 Ga0496102_0007980
360 Ga0496104_0012932
361 Ga0496105_0005794
362 Ga0496105_0049198
363 Ga0496106_0006809
364 Ga0496107_0003650
365 Ga0496108_0000072
366 Ga0496109_0073623
367 Ga0496109_0118638
368 Ga0496110_0006175
369 Ga0496112_0010928
370 Ga0496112_0019900
371 Ga0496112_0046285
372 Ga0496112_0047154
373 Ga0496112_0143163
374 Ga0496114_0006128
375 Ga0496115_0075252
376 Ga0496126_0070408
377 Ga0501031_0002646
378 Ga0501033_0027027
379 Ga0501067_0001313
380 Ga0501068_0009481
381 Ga0501068_0144432
382 Ga0501069_0007192
383 nmdc:mga0n895_11420_c1
384 nmdc:mga0a205_22599_c2
385 Ga0495601_0042705
386 Ga0495619_0003446
387 Ga0495619_0091793
388 2673820704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

45

454

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1szk-assembly1.cif.gz_A the structure of gamma-aminobutyrate aminotransferase mutant: e211s 0.9822 29 449
1sff-assembly1.cif.gz_D structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate 0.9822 29 449
1szu-assembly1.cif.gz_D the structure of gamma-aminobutyrate aminotransferase mutant: v241a 0.9822 29 449
1szs-assembly1.cif.gz_D the structure of gamma-aminobutyrate aminotransferase mutant: i50q 0.9815 29 449
7jh3-assembly2.cif.gz_B crystal structure of 4-aminobutyrate aminotransferase puue from escherichia coli in complex with plp 0.9794 29 446
ID Description Score Start End Superfamily
1sf2C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9817 84 342 3.40.640.10
1sf2C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9743 84 342 3.40.640.10
af_P9WQ79_346_447_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.97 346 446 3.90.1150.10
af_P9WQ79_74_338_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9652 84 336 3.40.640.10
af_P22256_328_418_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9648 354 442 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A538EU27-F1-model_v4 4-aminobutyrate--2-oxoglutarate transaminase (EC 2.6.1.19) 0.9913 15 451 GO:0009448
GO:0030170
GO:0034386
GO:0042802
AF-A0A538EU27-F1-model_v4 4-aminobutyrate--2-oxoglutarate transaminase (EC 2.6.1.19) 0.9868 15 451 GO:0009448
GO:0030170
GO:0034386
GO:0042802
AF-A0A2N3PUZ7-F1-model_v4 4-aminobutyrate--2-oxoglutarate transaminase 0.9853 29 450 GO:0009448
GO:0030170
GO:0034386
GO:0042802
AF-A0A436M7R4-F1-model_v4 deleted 0.9847 29 312
AF-A0A348G0A9-F1-model_v4 Aspartate aminotransferase family protein 0.9846 29 449 GO:0009448
GO:0030170
GO:0034386
GO:0042802

Map