F298677

General Info

Members Datasets Scaffolds Average Seq Length
194 140 388 243

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10483970|Ga0157375_104839701
Length 272
Sequence MHSSILVIILLTFHKEALRRYEPMAHEKTNAAFRQTNLPNESDGYLSKREELRLAEIELMRQRERVAELRRGLPEGAAIQDYVFQEGPSNLDAGTPIRTVRLNELLSTPDRSLVVYHFMFGKKNTTPCPMCTLFIDGWNGVAHHLAQNVDLAIAAAADPKALRLHARARGWHRLRLLSCGDNTFKYDLGSEDREGNQDSTVSVFTRDHDGTLRHFYTAHPSLSSDIKERGLDKXXXXDLLCPVYHVLDLTPQGRGDWYADLSYSTNVSVPRR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.03
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 16.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10483970 3300013308 Bacteria 1402
2 JGI25405J52794_10014043 3300003911 Archaea 1560
3 Ga0065715_10213562 3300005293 Bacteria 1303
4 Ga0065707_10084444 3300005295 Bacteria 7200
5 Ga0068869_100007983 3300005334 Bacteria 6801
6 Ga0070666_10024659 3300005335 Bacteria 3920
7 Ga0070689_100094628 3300005340 Bacteria 2359
8 Ga0070669_100000945 3300005353 Bacteria 21204
9 Ga0070675_100249541 3300005354 Bacteria 1553
10 Ga0070671_100043819 3300005355 Bacteria 3718
11 Ga0070667_100081342 3300005367 Bacteria 2772
12 Ga0070709_10300103 3300005434 Bacteria 1173
13 Ga0070713_100061536 3300005436 Bacteria 3141
14 Ga0070700_100675530 3300005441 Unclassified 818
15 Ga0070694_100188329 3300005444 Unclassified 1531
16 Ga0070708_100094383 3300005445 Unclassified 2729
17 Ga0070708_100840982 3300005445 Unclassified 862
18 Ga0070662_100419835 3300005457 Unclassified 1106
19 Ga0070681_10353802 3300005458 Unclassified 1379
20 Ga0070707_100051574 3300005468 Bacteria 3944
21 Ga0070707_100584822 3300005468 Bacteria 1079
22 Ga0070698_100446845 3300005471 Bacteria 1228
23 Ga0070684_100561889 3300005535 Bacteria 1059
24 Ga0070684_100582290 3300005535 Bacteria 1040
25 Ga0070697_100000003 3300005536 Bacteria 322584
26 Ga0068853_100238587 3300005539 Bacteria 1666
27 Ga0070686_100148117 3300005544 Bacteria 1641
28 Ga0070664_100063067 3300005564 Bacteria 3160
29 Ga0068857_100347034 3300005577 Bacteria 1374
30 Ga0070702_100251555 3300005615 Unclassified 1198
31 Ga0068859_100028183 3300005617 Bacteria 5631
32 Ga0068859_100435143 3300005617 Bacteria 1408
33 Ga0068859_100441463 3300005617 Unclassified 1398
34 Ga0068859_100691942 3300005617 Bacteria 1110
35 Ga0068864_100040001 3300005618 Bacteria 4010
36 Ga0068864_100046961 3300005618 Bacteria 3707
37 Ga0068861_100740228 3300005719 Bacteria 917
38 Ga0068863_100044992 3300005841 Bacteria 4189
39 Ga0081455_10090503 3300005937 Unclassified 2481
40 Ga0081539_10000108 3300005985 Bacteria 195322
41 Ga0097621_100010558 3300006237 Bacteria 6765
42 Ga0097621_100096068 3300006237 Bacteria 2486
43 Ga0068871_100087071 3300006358 Bacteria 2596
44 Ga0068871_100135887 3300006358 Bacteria 2088
45 Ga0068871_100316922 3300006358 Bacteria 1372
46 Ga0075428_100047350 3300006844 Bacteria 4723
47 Ga0075428_100168365 3300006844 Unclassified 2376
48 Ga0075433_10016529 3300006852 Bacteria 6086
49 Ga0075434_100128440 3300006871 Bacteria 2552
50 Ga0075434_100237894 3300006871 Bacteria 1841
51 Ga0075429_100361419 3300006880 Bacteria 1271
52 Ga0097620_100028183 3300006931 Bacteria 5631
53 Ga0097620_100435052 3300006931 Bacteria 1408
54 Ga0097620_100691921 3300006931 Bacteria 1110
55 Ga0105240_10206169 3300009093 Bacteria 2301
56 Ga0111539_10003082 3300009094 Bacteria 22091
57 Ga0111539_10037199 3300009094 Bacteria 5879
58 Ga0114129_10000161 3300009147 Bacteria 71860
59 Ga0114129_10013577 3300009147 Bacteria 11605
60 Ga0114129_10024881 3300009147 Bacteria 8488
61 Ga0114129_10038818 3300009147 Bacteria 6712
62 Ga0114129_10049892 3300009147 Bacteria 5880
63 Ga0114129_10119369 3300009147 Bacteria 3632
64 Ga0114129_10316320 3300009147 Bacteria 2076
65 Ga0114129_10568693 3300009147 Bacteria 1472
66 Ga0105242_10094274 3300009176 Bacteria 2525
67 Ga0105248_10078119 3300009177 Bacteria 3722
68 Ga0105249_10003223 3300009553 Bacteria 14124
69 Ga0105246_10049074 3300011119 Bacteria 2889
70 Ga0157369_10487354 3300013105 Bacteria 1276
71 Ga0157378_10052840 3300013297 Bacteria 3615
72 Ga0157378_10534256 3300013297 Unclassified 1176
73 Ga0163162_10067323 3300013306 Bacteria 3632
74 Ga0163162_10544214 3300013306 Bacteria 1289
75 Ga0163162_10763233 3300013306 Bacteria 1086
76 Ga0163162_10881389 3300013306 Bacteria 1009
77 Ga0157372_10068329 3300013307 Unclassified 3994
78 Ga0157375_10073492 3300013308 Bacteria 3438
79 Ga0157375_10110167 3300013308 Bacteria 2850
80 Ga0157375_10505335 3300013308 Bacteria 1373
81 Ga0163163_10009351 3300014325 Bacteria 8750
82 Ga0163163_10024217 3300014325 Bacteria 5775
83 Ga0163163_10066753 3300014325 Unclassified 3574
84 Ga0163163_11499001 3300014325 Bacteria 736
85 Ga0157380_10400573 3300014326 Bacteria 1302
86 Ga0157377_10238165 3300014745 Bacteria 1173
87 Ga0157376_10123991 3300014969 Bacteria 2294
88 Ga0157376_10175544 3300014969 Bacteria 1954
89 Ga0206350_10685528 3300020080 Bacteria 876
90 Ga0213876_10045246 3300021384 Bacteria 2328
91 Ga0207681_10340789 3300025923 Bacteria 1197
92 Ga0207650_10133387 3300025925 Bacteria 1946
93 Ga0207659_10160098 3300025926 Bacteria 1766
94 Ga0207700_10023687 3300025928 Bacteria 4240
95 Ga0207686_10179235 3300025934 Bacteria 1501
96 Ga0207670_10405701 3300025936 Bacteria 1090
97 Ga0207691_10147119 3300025940 Bacteria 2073
98 Ga0207711_10303726 3300025941 Bacteria 1472
99 Ga0207689_10541751 3300025942 Unclassified 977
100 Ga0207651_10140346 3300025960 Unclassified 1865
101 Ga0207658_10391126 3300025986 Bacteria 1220
102 Ga0207703_10387066 3300026035 Bacteria 1295
103 Ga0207641_10374255 3300026088 Bacteria 1362
104 Ga0207648_10724648 3300026089 Bacteria 922
105 Ga0207676_10363698 3300026095 Bacteria 1341
106 Ga0207676_10824061 3300026095 Unclassified 906
107 Ga0207674_10076259 3300026116 Bacteria 3361
108 Ga0207428_10039733 3300027907 Bacteria 3821
109 Ga0207428_10053518 3300027907 Unclassified 3218
110 Ga0265326_10065820 3300028558 Bacteria 1025
111 Ga0265338_10001565 3300028800 Bacteria 36898
112 Ga0265760_10000019 3300031090 Bacteria 81444
113 Ga0265325_10001402 3300031241 Bacteria 16987
114 Ga0265325_10051952 3300031241 Bacteria 2106
115 Ga0265339_10002093 3300031249 Bacteria 14565
116 Ga0265313_10014948 3300031595 Bacteria 4553
117 Ga0265314_10032498 3300031711 Bacteria 3838
118 Ga0307405_10055778 3300031731 Unclassified 2475
119 Ga0307410_10120961 3300031852 Bacteria 1909
120 Ga0307409_100041180 3300031995 Unclassified 3447
121 Ga0307416_100049986 3300032002 Unclassified 3329
122 Ga0307416_100321602 3300032002 Unclassified 1549
123 Ga0307411_10028064 3300032005 Unclassified 3416
124 Ga0307411_10226933 3300032005 Unclassified 1453
125 Ga0307415_100045182 3300032126 Bacteria 2951
126 Ga0373937_0008692 3300036401 Bacteria 8823
127 Ga0373937_0030526 3300036401 Bacteria 4881
128 Ga0436365_0486770 3300039437 Bacteria 3591
129 Ga0439460_0057107 3300042461 Bacteria 1184
130 Ga0453684_0161330 3300044712 Bacteria 2652
131 Ga0495629_0113167 3300046459 Bacteria 1892
132 Ga0495653_0203781 3300046463 Bacteria 1341
133 Ga0495582_0081158 3300046473 Unclassified 1801
134 Ga0495630_0290149 3300046517 Bacteria 1250
135 Ga0495609_0251459 3300046538 Bacteria 728
136 Ga0495645_0128332 3300046543 Bacteria 1780
137 Ga0495667_0081098 3300046559 Bacteria 2109
138 Ga0495667_0313508 3300046559 Bacteria 993
139 Ga0495635_0389506 3300046663 Bacteria 927
140 Ga0495659_0000818 3300046664 Bacteria 11076
141 Ga0495657_0302306 3300046675 Bacteria 954
142 Ga0495623_0209268 3300046679 Bacteria 1117
143 Ga0495669_0197242 3300046684 Bacteria 962
144 Ga0495674_0167321 3300047319 Bacteria 1836
145 Ga0495675_0135224 3300047444 Bacteria 1531
146 Ga0495675_0176510 3300047444 Bacteria 1310
147 Ga0495675_0203146 3300047444 Bacteria 1205
148 Ga0495684_0063927 3300047471 Bacteria 2797
149 Ga0496112_0359487 3300048915 Bacteria 1398
150 Ga0501031_0032970 3300049568 Bacteria 3377
151 Ga0501032_0015625 3300049569 Bacteria 5353
152 Ga0501033_0009366 3300049570 Bacteria 7539
153 Ga0501034_0163230 3300049571 Bacteria 2198
154 Ga0501037_0010617 3300049573 Bacteria 6766
155 Ga0501039_0328183 3300049575 Bacteria 1202
156 Ga0501040_0054219 3300049576 Unclassified 2748
157 Ga0501042_0118643 3300049578 Bacteria 1904
158 Ga0501046_0233641 3300049580 Bacteria 1357
159 Ga0501068_0008978 3300049584 Bacteria 5577
160 Ga0501069_0020075 3300049585 Bacteria 3617
161 Ga0501070_0020326 3300049586 Bacteria 5570
162 Ga0501071_0129294 3300049587 Bacteria 1875
163 Ga0501074_0128234 3300049590 Bacteria 1815
164 Ga0501075_0021447 3300049591 Bacteria 4709
165 Ga0501075_0475871 3300049591 Unclassified 953
166 Ga0501076_0037239 3300049592 Unclassified 3814
167 Ga0501076_0127543 3300049592 Bacteria 2062
168 Ga0501077_0015368 3300049593 Bacteria 4820
169 Ga0501077_0090887 3300049593 Bacteria 1934
170 Ga0501079_0107412 3300049741 Bacteria 2166
171 Ga0501080_0037068 3300049742 Bacteria 4552
172 Ga0501081_0544879 3300049743 Unclassified 866
173 Ga0501083_0069774 3300049744 Bacteria 2338
174 Ga0501035_0018691 3300049822 Bacteria 6383
175 Ga0501044_0053898 3300049823 Bacteria 4136
176 nmdc:mga05p37_209675_c1 3300050507 Unclassified 2356
177 nmdc:mga05p37_225520_c1 3300050507 Bacteria 2260
178 nmdc:mga05p37_26330_c1 3300050507 Bacteria 7075
179 nmdc:mga05p37_296474_c1 3300050507 Bacteria 1923
180 nmdc:mga05p37_7281_c1 3300050507 Bacteria 13057
181 nmdc:mga05p37_89214_c1 3300050507 Bacteria 3800
182 nmdc:mga09592_344523_c1 3300050508 Bacteria 1290
183 nmdc:mga06r32_112016_c1 3300050510 Bacteria 2685
184 nmdc:mga06r32_137889_c1 3300050510 Unclassified 2414
185 nmdc:mga08y16_33144_c1 3300050511 Bacteria 5426
186 nmdc:mga08y16_81773_c1 3300050511 Unclassified 3367
187 nmdc:mga0n895_32105_c1 3300050512 Bacteria 5037
188 nmdc:mga0n895_57093_c1 3300050512 Bacteria 3847
189 nmdc:mga0rr50_152411_c1 3300050513 Unclassified 1869
190 nmdc:mga0a205_178163_c1 3300050515 Bacteria 2021
191 Ga0501082_0013826 3300060353 Bacteria 6940
192 Ga0530510_0046673 3300061734 Bacteria 3129
193 Ga0530510_0159851 3300061734 Bacteria 1666
194 2997452478 2997451912 Bacteria 8492419
195 Ga0157375_10483970
196 JGI25405J52794_10014043
197 Ga0065715_10213562
198 Ga0065707_10084444
199 Ga0068869_100007983
200 Ga0070666_10024659
201 Ga0070689_100094628
202 Ga0070669_100000945
203 Ga0070675_100249541
204 Ga0070671_100043819
205 Ga0070667_100081342
206 Ga0070709_10300103
207 Ga0070713_100061536
208 Ga0070700_100675530
209 Ga0070694_100188329
210 Ga0070708_100094383
211 Ga0070708_100840982
212 Ga0070662_100419835
213 Ga0070681_10353802
214 Ga0070707_100051574
215 Ga0070707_100584822
216 Ga0070698_100446845
217 Ga0070684_100561889
218 Ga0070684_100582290
219 Ga0070697_100000003
220 Ga0068853_100238587
221 Ga0070686_100148117
222 Ga0070664_100063067
223 Ga0068857_100347034
224 Ga0070702_100251555
225 Ga0068859_100028183
226 Ga0068859_100435143
227 Ga0068859_100441463
228 Ga0068859_100691942
229 Ga0068864_100040001
230 Ga0068864_100046961
231 Ga0068861_100740228
232 Ga0068863_100044992
233 Ga0081455_10090503
234 Ga0081539_10000108
235 Ga0097621_100010558
236 Ga0097621_100096068
237 Ga0068871_100087071
238 Ga0068871_100135887
239 Ga0068871_100316922
240 Ga0075428_100047350
241 Ga0075428_100168365
242 Ga0075433_10016529
243 Ga0075434_100128440
244 Ga0075434_100237894
245 Ga0075429_100361419
246 Ga0097620_100028183
247 Ga0097620_100435052
248 Ga0097620_100691921
249 Ga0105240_10206169
250 Ga0111539_10003082
251 Ga0111539_10037199
252 Ga0114129_10000161
253 Ga0114129_10013577
254 Ga0114129_10024881
255 Ga0114129_10038818
256 Ga0114129_10049892
257 Ga0114129_10119369
258 Ga0114129_10316320
259 Ga0114129_10568693
260 Ga0105242_10094274
261 Ga0105248_10078119
262 Ga0105249_10003223
263 Ga0105246_10049074
264 Ga0157369_10487354
265 Ga0157378_10052840
266 Ga0157378_10534256
267 Ga0163162_10067323
268 Ga0163162_10544214
269 Ga0163162_10763233
270 Ga0163162_10881389
271 Ga0157372_10068329
272 Ga0157375_10073492
273 Ga0157375_10110167
274 Ga0157375_10505335
275 Ga0163163_10009351
276 Ga0163163_10024217
277 Ga0163163_10066753
278 Ga0163163_11499001
279 Ga0157380_10400573
280 Ga0157377_10238165
281 Ga0157376_10123991
282 Ga0157376_10175544
283 Ga0206350_10685528
284 Ga0213876_10045246
285 Ga0207681_10340789
286 Ga0207650_10133387
287 Ga0207659_10160098
288 Ga0207700_10023687
289 Ga0207686_10179235
290 Ga0207670_10405701
291 Ga0207691_10147119
292 Ga0207711_10303726
293 Ga0207689_10541751
294 Ga0207651_10140346
295 Ga0207658_10391126
296 Ga0207703_10387066
297 Ga0207641_10374255
298 Ga0207648_10724648
299 Ga0207676_10363698
300 Ga0207676_10824061
301 Ga0207674_10076259
302 Ga0207428_10039733
303 Ga0207428_10053518
304 Ga0265326_10065820
305 Ga0265338_10001565
306 Ga0265760_10000019
307 Ga0265325_10001402
308 Ga0265325_10051952
309 Ga0265339_10002093
310 Ga0265313_10014948
311 Ga0265314_10032498
312 Ga0307405_10055778
313 Ga0307410_10120961
314 Ga0307409_100041180
315 Ga0307416_100049986
316 Ga0307416_100321602
317 Ga0307411_10028064
318 Ga0307411_10226933
319 Ga0307415_100045182
320 Ga0373937_0008692
321 Ga0373937_0030526
322 Ga0436365_0486770
323 Ga0439460_0057107
324 Ga0453684_0161330
325 Ga0495629_0113167
326 Ga0495653_0203781
327 Ga0495582_0081158
328 Ga0495630_0290149
329 Ga0495609_0251459
330 Ga0495645_0128332
331 Ga0495667_0081098
332 Ga0495667_0313508
333 Ga0495635_0389506
334 Ga0495659_0000818
335 Ga0495657_0302306
336 Ga0495623_0209268
337 Ga0495669_0197242
338 Ga0495674_0167321
339 Ga0495675_0135224
340 Ga0495675_0176510
341 Ga0495675_0203146
342 Ga0495684_0063927
343 Ga0496112_0359487
344 Ga0501031_0032970
345 Ga0501032_0015625
346 Ga0501033_0009366
347 Ga0501034_0163230
348 Ga0501037_0010617
349 Ga0501039_0328183
350 Ga0501040_0054219
351 Ga0501042_0118643
352 Ga0501046_0233641
353 Ga0501068_0008978
354 Ga0501069_0020075
355 Ga0501070_0020326
356 Ga0501071_0129294
357 Ga0501074_0128234
358 Ga0501075_0021447
359 Ga0501075_0475871
360 Ga0501076_0037239
361 Ga0501076_0127543
362 Ga0501077_0015368
363 Ga0501077_0090887
364 Ga0501079_0107412
365 Ga0501080_0037068
366 Ga0501081_0544879
367 Ga0501083_0069774
368 Ga0501035_0018691
369 Ga0501044_0053898
370 nmdc:mga05p37_209675_c1
371 nmdc:mga05p37_225520_c1
372 nmdc:mga05p37_26330_c1
373 nmdc:mga05p37_296474_c1
374 nmdc:mga05p37_7281_c1
375 nmdc:mga05p37_89214_c1
376 nmdc:mga09592_344523_c1
377 nmdc:mga06r32_112016_c1
378 nmdc:mga06r32_137889_c1
379 nmdc:mga08y16_33144_c1
380 nmdc:mga08y16_81773_c1
381 nmdc:mga0n895_32105_c1
382 nmdc:mga0n895_57093_c1
383 nmdc:mga0rr50_152411_c1
384 nmdc:mga0a205_178163_c1
385 Ga0501082_0013826
386 Ga0530510_0046673
387 Ga0530510_0159851
388 2997452478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

35

267

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v92-assembly1.cif.gz_B s663a stable-5-lox 0.7939 176 197
3v98-assembly1.cif.gz_A s663d stable-5-lox 0.7892 176 197
8iua-assembly1.cif.gz_A crystal structure of gh66 endodextranase from flavobacterium johnsoniae in complex with isomaltose 0.7886 175 196
7ttl-assembly1.cif.gz_A stable-5-lox elongated ha2 (4 copies asu) 0.7829 176 197
7ttj-assembly1.cif.gz_B stable-5-lox elongated ha2 0.7794 176 197
ID Description Score Start End Superfamily
af_A0A1P8BBR6_371_459_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8091 175 197 3.30.420.10
af_Q9LU90_53_414_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8064 176 197 2.120.10.30
af_Q941L2_17_141_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8007 174 197 2.60.40.150
af_Q8IJD0_13_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7863 76 197 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7773 50 197 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V9WH38-F1-model_v4 DUF899 domain-containing protein 0.9604 1 211
AF-C4B471-F1-model_v4 deleted 0.9133 11 200
AF-A0A6G4VAH6-F1-model_v4 DUF899 family protein 0.8894 10 235
AF-A0A6G4VAH6-F1-model_v4 DUF899 family protein 0.8855 10 235
AF-A0A192IFP0-F1-model_v4 deleted 0.872 13 230

Map