F298586

General Info

Members Datasets Scaffolds Average Seq Length
194 143 170 123

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10025476|Ga0114129_100254762
Length 144
Sequence MTVNVRREYGWRLLFTEKEQSMELGAFSISLAVKDIHVSKAFYEKLGFEVFGGDISQNWLILKNGQHVIGLFQGMFEKNMLTFNPGWDQDAQNLDSFTDVRELQRQLKAKDIELITEADESTKGPAYMMLVDPDGNPILVDQHV

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
7 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
15 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
16 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
17 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
18 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
19 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
20 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
21 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
22 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
23 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
24 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
25 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
26 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
92 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
135 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 0
Isolates 12.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 2.58
Rhizosphere 81.44
Stem 0
Stem Tuber 0
Unclassified 13.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02H4UHL 2088090002 Bacteria 548
2 SwRhRL2b_contig_2921423 2162886007 Bacteria 1234
3 rootH2_10014893 3300003320 Bacteria 7388
4 rootL2_10301926 3300003322 Bacteria 1136
5 Ga0055536_1047225 3300003781 Bacteria 972
6 Ga0065714_10064571 3300005288 Bacteria 34225
7 Ga0065714_10497561 3300005288 Bacteria 525
8 Ga0065704_10141092 3300005289 Bacteria 1517
9 Ga0070680_100049792 3300005336 Bacteria 3416
10 Ga0070682_100000172 3300005337 Bacteria 48194
11 Ga0070660_100039733 3300005339 Bacteria 3577
12 Ga0070671_102019462 3300005355 Bacteria 513
13 Ga0070693_100652300 3300005547 Bacteria 765
14 Ga0070664_100617242 3300005564 Bacteria 1006
15 Ga0068863_101369774 3300005841 Unclassified 715
16 Ga0075428_101731777 3300006844 Archaea 652
17 Ga0075428_101849179 3300006844 Unclassified 628
18 Ga0075428_102285989 3300006844 Bacteria 557
19 Ga0075430_100698502 3300006846 Unclassified 836
20 Ga0075430_101198359 3300006846 Unclassified 625
21 Ga0075429_100001462 3300006880 Bacteria 19410
22 Ga0075429_100102812 3300006880 Archaea 2495
23 Ga0075429_101983299 3300006880 Bacteria 504
24 Ga0105244_10031392 3300009036 Bacteria 2819
25 Ga0111539_10051309 3300009094 Bacteria 4914
26 Ga0111539_10830202 3300009094 Bacteria 1075
27 Ga0111539_12894858 3300009094 Bacteria 555
28 Ga0114129_10025476 3300009147 Bacteria 8382
29 Ga0114129_10082735 3300009147 Bacteria 4460
30 Ga0114129_10083016 3300009147 Bacteria 4452
31 Ga0114129_11826391 3300009147 Bacteria 739
32 Ga0114129_13328009 3300009147 Bacteria 519
33 Ga0105243_10000307 3300009148 Bacteria 54238
34 Ga0105243_10012362 3300009148 Bacteria 6453
35 Ga0105243_10460719 3300009148 Bacteria 1195
36 Ga0105246_11564738 3300011119 Bacteria 622
37 Ga0157373_10000029 3300013100 Bacteria 131988
38 Ga0157371_10167955 3300013102 Bacteria 1567
39 Ga0157370_10007912 3300013104 Bacteria 11516
40 Ga0157370_11230324 3300013104 Bacteria 675
41 Ga0157370_11230325 3300013104 Bacteria 675
42 Ga0157369_10423120 3300013105 Bacteria 1381
43 Ga0157378_10592670 3300013297 Bacteria 1119
44 Ga0182008_10000026 3300014497 Bacteria 182845
45 Ga0182006_1000012 3300015261 Bacteria 394239
46 Ga0163161_10091315 3300017792 Bacteria 2254
47 Ga0209676_1006713 3300025292 Bacteria 5604
48 Ga0209676_1022864 3300025292 Bacteria 2060
49 Ga0209257_1000198 3300025304 Bacteria 149013
50 Ga0207655_1001164 3300025728 Bacteria 25590
51 Ga0207657_10064783 3300025919 Bacteria 3118
52 Ga0207650_10059950 3300025925 Bacteria 2839
53 Ga0207650_10874775 3300025925 Unclassified 763
54 Ga0207709_10000327 3300025935 Bacteria 51458
55 Ga0207691_11021342 3300025940 Bacteria 690
56 Ga0207679_10160843 3300025945 Bacteria 1838
57 Ga0207668_10935780 3300025972 Bacteria 772
58 Ga0207708_10095552 3300026075 Bacteria 2295
59 Ga0207708_10955278 3300026075 Bacteria 743
60 Ga0207641_10814224 3300026088 Bacteria 924
61 Ga0207428_10994389 3300027907 Bacteria 590
62 Ga0265322_10064020 3300028654 Unclassified 1043
63 Ga0265327_10455438 3300031251 Unclassified 553
64 Ga0307408_100243048 3300031548 Bacteria 1480
65 Ga0307514_10000722 3300031649 Bacteria 57107
66 Ga0316576_10380795 3300031727 Bacteria 1047
67 Ga0316576_10633544 3300031727 Unclassified 779
68 Ga0307405_10158815 3300031731 Bacteria 1599
69 Ga0307413_10092889 3300031824 Bacteria 1971
70 Ga0307413_11647673 3300031824 Bacteria 571
71 Ga0307410_10332275 3300031852 Bacteria 1209
72 Ga0307410_10467723 3300031852 Bacteria 1032
73 Ga0307406_11410075 3300031901 Unclassified 611
74 Ga0307407_10128847 3300031903 Bacteria 1616
75 Ga0307412_10000007 3300031911 Bacteria 486267
76 Ga0307412_10002069 3300031911 Bacteria 11133
77 Ga0307412_10022085 3300031911 Bacteria 3895
78 Ga0307409_101558505 3300031995 Bacteria 688
79 Ga0307409_102652214 3300031995 Bacteria 529
80 Ga0307416_100000003 3300032002 Bacteria 509060
81 Ga0307416_102724706 3300032002 Unclassified 591
82 Ga0307414_10000885 3300032004 Bacteria 15321
83 Ga0307414_10080382 3300032004 Bacteria 2383
84 Ga0307414_10103070 3300032004 Bacteria 2152
85 Ga0307414_11355037 3300032004 Bacteria 661
86 Ga0307414_11645507 3300032004 Bacteria 598
87 Ga0307414_11798356 3300032004 Unclassified 572
88 Ga0307415_101800840 3300032126 Unclassified 592
89 Ga0316574_0086982 3300035398 Bacteria 1989
90 Ga0400483_034705 3300039062 Bacteria 2256
91 Ga0400483_060446 3300039062 Bacteria 1243
92 Ga0400483_216081 3300039062 Bacteria 1138
93 Ga0400483_234634 3300039062 Bacteria 1286
94 Ga0400487_55878 3300039110 Bacteria 2667
95 Ga0439466_0014156 3300041411 Bacteria 2909
96 Ga0439466_0048147 3300041411 Bacteria 1403
97 Ga0451807_0231690 3300041486 Bacteria 867
98 Ga0439433_0035054 3300041999 Bacteria 1156
99 Ga0439449_0006278 3300042007 Bacteria 4543
100 Ga0439449_0017727 3300042007 Bacteria 2673
101 Ga0439457_061609 3300042014 Bacteria 850
102 Ga0450920_001545 3300042122 Bacteria 3828
103 Ga0450905_094562 3300042142 Bacteria 531
104 Ga0450907_009836 3300042146 Bacteria 1586
105 Ga0495606_0028797 3300046507 Bacteria 3911
106 Ga0495610_0000009 3300046512 Bacteria 554843
107 Ga0495643_0117279 3300046522 Bacteria 1348
108 Ga0495663_0000298 3300046525 Bacteria 18879
109 Ga0495597_0002758 3300046542 Bacteria 10818
110 Ga0495633_0000002 3300046558 Bacteria 488754
111 Ga0495625_0039871 3300046660 Bacteria 3428
112 Ga0496100_0872758 3300048903 Bacteria 706
113 Ga0496102_0072585 3300048905 Bacteria 3163
114 Ga0496103_0054113 3300048906 Bacteria 2488
115 Ga0496113_0201008 3300048916 Bacteria 1584
116 Ga0496116_0000452 3300048919 Bacteria 57179
117 Ga0496117_0000023 3300048920 Bacteria 438585
118 Ga0496118_0000564 3300048921 Bacteria 61236
119 Ga0496119_0000010 3300048922 Bacteria 438534
120 Ga0496120_0087148 3300048923 Bacteria 1677
121 Ga0496121_0146869 3300048924 Bacteria 1741
122 Ga0496122_0000123 3300048925 Bacteria 180420
123 Ga0496122_0000598 3300048925 Bacteria 74168
124 Ga0496122_0001774 3300048925 Bacteria 33049
125 Ga0496122_0006903 3300048925 Bacteria 12836
126 Ga0496123_0001283 3300048926 Bacteria 35856
127 Ga0496123_0011285 3300048926 Bacteria 7764
128 Ga0496123_0275430 3300048926 Bacteria 816
129 Ga0496124_0001264 3300048927 Bacteria 38468
130 Ga0496125_0014693 3300048928 Bacteria 7609
131 Ga0496126_0001845 3300048929 Bacteria 30914
132 Ga0501298_103279 3300049521 Bacteria 653
133 Ga0501299_192308 3300049522 Unclassified 538
134 Ga0501036_1252882 3300049572 Unclassified 604
135 Ga0501040_0696933 3300049576 Bacteria 734
136 Ga0501042_0643292 3300049578 Unclassified 771
137 Ga0501043_0004052 3300049579 Bacteria 11985
138 Ga0501068_0121776 3300049584 Bacteria 1627
139 Ga0501071_0384836 3300049587 Unclassified 1070
140 Ga0501072_0211618 3300049588 Bacteria 1545
141 Ga0501073_0264998 3300049589 Bacteria 1186
142 Ga0501074_0393936 3300049590 Bacteria 982
143 Ga0501075_0144070 3300049591 Unclassified 1816
144 Ga0501075_0638096 3300049591 Bacteria 812
145 Ga0501076_0893556 3300049592 Bacteria 732
146 Ga0501076_0961652 3300049592 Unclassified 704
147 Ga0501076_0985863 3300049592 Bacteria 694
148 Ga0501202_154530 3300049652 Bacteria 603
149 Ga0501223_085266 3300049663 Bacteria 636
150 Ga0501227_144573 3300049665 Bacteria 654
151 Ga0501080_0168752 3300049742 Unclassified 2019
152 Ga0501081_0083493 3300049743 Bacteria 2239
153 Ga0501083_0660369 3300049744 Bacteria 680
154 Ga0501241_000006 3300049758 Bacteria 149999
155 Ga0501269_000237 3300049766 Bacteria 16063
156 nmdc:mga05p37_249751_c1 3300050507 Bacteria 2128
157 nmdc:mga05p37_38293_c1 3300050507 Bacteria 5882
158 nmdc:mga05p37_390748_c1 3300050507 Bacteria 1627
159 nmdc:mga05p37_884302_c1 3300050507 Bacteria 965
160 nmdc:mga09592_390368_c1 3300050508 Bacteria 1203
161 nmdc:mga09592_8429_c1 3300050508 Bacteria 8381
162 nmdc:mga06r32_921458_c1 3300050510 Unclassified 829
163 nmdc:mga08y16_1082130_c1 3300050511 Bacteria 778
164 nmdc:mga08y16_1203001_c1 3300050511 Bacteria 728
165 nmdc:mga08y16_42510_c1 3300050511 Bacteria 4759
166 nmdc:mga0n895_88499_c1 3300050512 Bacteria 3096
167 nmdc:mga0a205_672910_c1 3300050515 Bacteria 886
168 Ga0500627_0323975 3300053158 Bacteria 669
169 Ga0501082_0030373 3300060353 Unclassified 4657
170 Ga0501082_0054486 3300060353 Bacteria 3447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10380795 Ga0316576_103807952 116
2 iso_pu_bacteria 2582581873 2585425106 119
3 iso_pu_bacteria 2585428045 2587677754 119
4 iso_pu_bacteria 2585428060 2587746890 119
5 iso_pu_bacteria 2585428061 2587750727 119
6 iso_pu_bacteria 2585428095 2587867904 119
7 iso_pu_bacteria 2585428183 2588215251 119
8 iso_pu_bacteria 2585428184 2588218429 119
9 iso_pu_bacteria 2585428185 2588222260 119
10 iso_pu_bacteria 2588253712 2588444876 119
11 iso_pu_bacteria 2588254255 2590604276 119
12 iso_pu_bacteria 2588254257 2590612542 119
13 iso_pu_bacteria 2751185877 2753671121 119
14 iso_pu_bacteria 2772190705 2772607671 119
15 iso_pu_bacteria 2775506739 2775672438 119
16 iso_pu_bacteria 2889290771 2889290949 119
17 iso_pu_bacteria 2905999023 2905999697 119
18 iso_pu_bacteria 2919097161 2919098934 119
19 iso_pu_bacteria 2928510474 2928511961 119
20 iso_pu_bacteria 2939598168 2939602056 119
21 iso_pu_bacteria 2945924605 2945927960 119
22 iso_pu_bacteria 2946019816 2946022006 119
23 iso_pu_bacteria 2977243572 2977245633 119
24 iso_pu_bacteria 2993372514 2993373007 119
25 iso_pu_bacteria 2993480792 2993483695 119
26 3300003322 rootL2_10301926 rootL2_103019262 122
27 3300009094 Ga0111539_10051309 Ga0111539_100513094 122
28 3300009147 Ga0114129_10083016 Ga0114129_100830163 122
29 3300050507 nmdc:mga05p37_390748_c1 nmdc:mga05p37_390748_c1_709_1077 122
30 3300050511 nmdc:mga08y16_1082130_c1 nmdc:mga08y16_1082130_c1_67_435 122
31 3300050512 nmdc:mga0n895_88499_c1 nmdc:mga0n895_88499_c1_2207_2575 122
32 3300050515 nmdc:mga0a205_672910_c1 nmdc:mga0a205_672910_c1_271_639 122
33 2088090002 CNA_F6ESG4R02H4UHL CNA_00170630 123
34 2162886007 SwRhRL2b_contig_2921423 SwRhRL2b_0216.00004670 123
35 3300003320 rootH2_10014893 rootH2_100148935 123
36 3300003781 Ga0055536_1047225 Ga0055536_10472251 123
37 3300005288 Ga0065714_10064571 Ga0065714_1006457118 123
38 3300005288 Ga0065714_10497561 Ga0065714_104975611 123
39 3300005289 Ga0065704_10141092 Ga0065704_101410922 123
40 3300005336 Ga0070680_100049792 Ga0070680_1000497926 123
41 3300005337 Ga0070682_100000172 Ga0070682_10000017238 123
42 3300005339 Ga0070660_100039733 Ga0070660_1000397332 123
43 3300005355 Ga0070671_102019462 Ga0070671_1020194621 123
44 3300005547 Ga0070693_100652300 Ga0070693_1006523002 123
45 3300005564 Ga0070664_100617242 Ga0070664_1006172422 123
46 3300005841 Ga0068863_101369774 Ga0068863_1013697741 123
47 3300006844 Ga0075428_101731777 Ga0075428_1017317771 123
48 3300006844 Ga0075428_101849179 Ga0075428_1018491792 123
49 3300006844 Ga0075428_102285989 Ga0075428_1022859891 123
50 3300006846 Ga0075430_100698502 Ga0075430_1006985022 123
51 3300006846 Ga0075430_101198359 Ga0075430_1011983592 123
52 3300006880 Ga0075429_100001462 Ga0075429_1000014622 123
53 3300006880 Ga0075429_100102812 Ga0075429_1001028122 123
54 3300006880 Ga0075429_101983299 Ga0075429_1019832991 123
55 3300009036 Ga0105244_10031392 Ga0105244_100313922 123
56 3300009094 Ga0111539_10830202 Ga0111539_108302023 123
57 3300009094 Ga0111539_12894858 Ga0111539_128948581 123
58 3300009147 Ga0114129_10025476 Ga0114129_100254762 123
59 3300009147 Ga0114129_10082735 Ga0114129_100827352 123
60 3300009147 Ga0114129_11826391 Ga0114129_118263912 123
61 3300009147 Ga0114129_13328009 Ga0114129_133280091 123
62 3300009148 Ga0105243_10000307 Ga0105243_1000030730 123
63 3300009148 Ga0105243_10012362 Ga0105243_100123622 123
64 3300009148 Ga0105243_10460719 Ga0105243_104607192 123
65 3300011119 Ga0105246_11564738 Ga0105246_115647382 123
66 3300013100 Ga0157373_10000029 Ga0157373_1000002932 123
67 3300013102 Ga0157371_10167955 Ga0157371_101679553 123
68 3300013104 Ga0157370_10007912 Ga0157370_100079124 123
69 3300013104 Ga0157370_11230324 Ga0157370_112303242 123
70 3300013104 Ga0157370_11230325 Ga0157370_112303252 123
71 3300013105 Ga0157369_10423120 Ga0157369_104231202 123
72 3300013297 Ga0157378_10592670 Ga0157378_105926702 123
73 3300014497 Ga0182008_10000026 Ga0182008_1000002690 123
74 3300015261 Ga0182006_1000012 Ga0182006_100001229 123
75 3300017792 Ga0163161_10091315 Ga0163161_100913152 123
76 3300025292 Ga0209676_1006713 Ga0209676_10067132 123
77 3300025292 Ga0209676_1022864 Ga0209676_10228641 123
78 3300025304 Ga0209257_1000198 Ga0209257_100019825 123
79 3300025728 Ga0207655_1001164 Ga0207655_100116410 123
80 3300025919 Ga0207657_10064783 Ga0207657_100647832 123
81 3300025925 Ga0207650_10059950 Ga0207650_100599502 123
82 3300025925 Ga0207650_10874775 Ga0207650_108747752 123
83 3300025935 Ga0207709_10000327 Ga0207709_1000032716 123
84 3300025940 Ga0207691_11021342 Ga0207691_110213422 123
85 3300025945 Ga0207679_10160843 Ga0207679_101608432 123
86 3300025972 Ga0207668_10935780 Ga0207668_109357802 123
87 3300026075 Ga0207708_10095552 Ga0207708_100955524 123
88 3300026075 Ga0207708_10955278 Ga0207708_109552781 123
89 3300026088 Ga0207641_10814224 Ga0207641_108142242 123
90 3300027907 Ga0207428_10994389 Ga0207428_109943891 123
91 3300028654 Ga0265322_10064020 Ga0265322_100640201 123
92 3300031251 Ga0265327_10455438 Ga0265327_104554381 123
93 3300031548 Ga0307408_100243048 Ga0307408_1002430482 123
94 3300031649 Ga0307514_10000722 Ga0307514_1000072222 123
95 3300031727 Ga0316576_10633544 Ga0316576_106335442 123
96 3300031731 Ga0307405_10158815 Ga0307405_101588152 123
97 3300031824 Ga0307413_10092889 Ga0307413_100928892 123
98 3300031824 Ga0307413_11647673 Ga0307413_116476731 123
99 3300031852 Ga0307410_10332275 Ga0307410_103322752 123
100 3300031852 Ga0307410_10467723 Ga0307410_104677232 123
101 3300031901 Ga0307406_11410075 Ga0307406_114100752 123
102 3300031903 Ga0307407_10128847 Ga0307407_101288472 123
103 3300031911 Ga0307412_10000007 Ga0307412_10000007390 123
104 3300031911 Ga0307412_10002069 Ga0307412_100020697 123
105 3300031911 Ga0307412_10022085 Ga0307412_100220851 123
106 3300031995 Ga0307409_101558505 Ga0307409_1015585052 123
107 3300031995 Ga0307409_102652214 Ga0307409_1026522141 123
108 3300032002 Ga0307416_100000003 Ga0307416_100000003289 123
109 3300032002 Ga0307416_102724706 Ga0307416_1027247061 123
110 3300032004 Ga0307414_10000885 Ga0307414_1000088513 123
111 3300032004 Ga0307414_10080382 Ga0307414_100803825 123
112 3300032004 Ga0307414_10103070 Ga0307414_101030702 123
113 3300032004 Ga0307414_11355037 Ga0307414_113550372 123
114 3300032004 Ga0307414_11645507 Ga0307414_116455072 123
115 3300032004 Ga0307414_11798356 Ga0307414_117983561 123
116 3300032126 Ga0307415_101800840 Ga0307415_1018008401 123
117 3300035398 Ga0316574_0086982 Ga0316574_0086982_348_719 123
118 3300039062 Ga0400483_034705 Ga0400483_034705_1306_1677 123
119 3300039062 Ga0400483_060446 Ga0400483_060446_248_619 123
120 3300039062 Ga0400483_216081 Ga0400483_216081_114_485 123
121 3300039062 Ga0400483_234634 Ga0400483_234634_403_774 123
122 3300039110 Ga0400487_55878 Ga0400487_55878_991_1362 123
123 3300041411 Ga0439466_0014156 Ga0439466_0014156_1035_1406 123
124 3300041411 Ga0439466_0048147 Ga0439466_0048147_218_589 123
125 3300041486 Ga0451807_0231690 Ga0451807_0231690_16_402 123
126 3300041999 Ga0439433_0035054 Ga0439433_0035054_552_923 123
127 3300042007 Ga0439449_0006278 Ga0439449_0006278_2621_2992 123
128 3300042007 Ga0439449_0017727 Ga0439449_0017727_1769_2140 123
129 3300042014 Ga0439457_061609 Ga0439457_061609_349_720 123
130 3300042122 Ga0450920_001545 Ga0450920_001545_1154_1525 123
131 3300042142 Ga0450905_094562 Ga0450905_094562_143_514 123
132 3300042146 Ga0450907_009836 Ga0450907_009836_808_1179 123
133 3300046507 Ga0495606_0028797 Ga0495606_0028797_1860_2231 123
134 3300046512 Ga0495610_0000009 Ga0495610_0000009_185086_185457 123
135 3300046522 Ga0495643_0117279 Ga0495643_0117279_283_654 123
136 3300046525 Ga0495663_0000298 Ga0495663_0000298_10568_10939 123
137 3300046542 Ga0495597_0002758 Ga0495597_0002758_6286_6660 123
138 3300046558 Ga0495633_0000002 Ga0495633_0000002_299582_299953 123
139 3300046660 Ga0495625_0039871 Ga0495625_0039871_1176_1550 123
140 3300048903 Ga0496100_0872758 Ga0496100_0872758_174_545 123
141 3300048905 Ga0496102_0072585 Ga0496102_0072585_877_1248 123
142 3300048906 Ga0496103_0054113 Ga0496103_0054113_777_1148 123
143 3300048916 Ga0496113_0201008 Ga0496113_0201008_211_582 123
144 3300048919 Ga0496116_0000452 Ga0496116_0000452_46151_46522 123
145 3300048920 Ga0496117_0000023 Ga0496117_0000023_428735_429106 123
146 3300048921 Ga0496118_0000564 Ga0496118_0000564_52956_53327 123
147 3300048922 Ga0496119_0000010 Ga0496119_0000010_9486_9857 123
148 3300048923 Ga0496120_0087148 Ga0496120_0087148_125_496 123
149 3300048924 Ga0496121_0146869 Ga0496121_0146869_500_871 123
150 3300048925 Ga0496122_0000123 Ga0496122_0000123_149749_150120 123
151 3300048925 Ga0496122_0000598 Ga0496122_0000598_65309_65680 123
152 3300048925 Ga0496122_0001774 Ga0496122_0001774_9486_9857 123
153 3300048925 Ga0496122_0006903 Ga0496122_0006903_4120_4491 123
154 3300048926 Ga0496123_0001283 Ga0496123_0001283_9451_9822 123
155 3300048926 Ga0496123_0011285 Ga0496123_0011285_4519_4890 123
156 3300048926 Ga0496123_0275430 Ga0496123_0275430_352_723 123
157 3300048927 Ga0496124_0001264 Ga0496124_0001264_27453_27824 123
158 3300048928 Ga0496125_0014693 Ga0496125_0014693_5509_5880 123
159 3300048929 Ga0496126_0001845 Ga0496126_0001845_11205_11576 123
160 3300049521 Ga0501298_103279 Ga0501298_103279_188_559 123
161 3300049522 Ga0501299_192308 Ga0501299_192308_73_444 123
162 3300049572 Ga0501036_1252882 Ga0501036_1252882_30_401 123
163 3300049576 Ga0501040_0696933 Ga0501040_0696933_258_629 123
164 3300049578 Ga0501042_0643292 Ga0501042_0643292_133_504 123
165 3300049579 Ga0501043_0004052 Ga0501043_0004052_8913_9284 123
166 3300049584 Ga0501068_0121776 Ga0501068_0121776_1129_1500 123
167 3300049587 Ga0501071_0384836 Ga0501071_0384836_121_492 123
168 3300049588 Ga0501072_0211618 Ga0501072_0211618_232_603 123
169 3300049589 Ga0501073_0264998 Ga0501073_0264998_291_665 123
170 3300049590 Ga0501074_0393936 Ga0501074_0393936_550_921 123
171 3300049591 Ga0501075_0144070 Ga0501075_0144070_884_1255 123
172 3300049591 Ga0501075_0638096 Ga0501075_0638096_181_552 123
173 3300049592 Ga0501076_0893556 Ga0501076_0893556_293_664 123
174 3300049592 Ga0501076_0961652 Ga0501076_0961652_44_415 123
175 3300049592 Ga0501076_0985863 Ga0501076_0985863_77_448 123
176 3300049652 Ga0501202_154530 Ga0501202_154530_181_552 123
177 3300049663 Ga0501223_085266 Ga0501223_085266_149_520 123
178 3300049665 Ga0501227_144573 Ga0501227_144573_86_457 123
179 3300049742 Ga0501080_0168752 Ga0501080_0168752_1477_1848 123
180 3300049743 Ga0501081_0083493 Ga0501081_0083493_1535_1906 123
181 3300049744 Ga0501083_0660369 Ga0501083_0660369_297_668 123
182 3300049758 Ga0501241_000006 Ga0501241_000006_15738_16109 123
183 3300049766 Ga0501269_000237 Ga0501269_000237_4076_4447 123
184 3300050507 nmdc:mga05p37_249751_c1 nmdc:mga05p37_249751_c1_1277_1711 123
185 3300050507 nmdc:mga05p37_38293_c1 nmdc:mga05p37_38293_c1_701_1135 123
186 3300050507 nmdc:mga05p37_884302_c1 nmdc:mga05p37_884302_c1_482_853 123
187 3300050508 nmdc:mga09592_390368_c1 nmdc:mga09592_390368_c1_586_957 123
188 3300050508 nmdc:mga09592_8429_c1 nmdc:mga09592_8429_c1_2858_3292 123
189 3300050510 nmdc:mga06r32_921458_c1 nmdc:mga06r32_921458_c1_428_799 123
190 3300050511 nmdc:mga08y16_1203001_c1 nmdc:mga08y16_1203001_c1_22_393 123
191 3300050511 nmdc:mga08y16_42510_c1 nmdc:mga08y16_42510_c1_654_1034 123
192 3300053158 Ga0500627_0323975 Ga0500627_0323975_71_442 123
193 3300060353 Ga0501082_0030373 Ga0501082_0030373_988_1359 123
194 3300060353 Ga0501082_0054486 Ga0501082_0054486_1985_2356 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

140

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.7749 6 123
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.7628 6 123
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.7102 9 54
3fcd-assembly1.cif.gz_A crystal structure of a putative glyoxalase from an environmental bacteria 0.699 6 123
2rk9-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase superfamily member from vibrio splendidus 12b01 0.6921 6 123
ID Description Score Start End Superfamily
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7925 9 51 3.30.720.120
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7884 78 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7802 78 123 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7691 9 55 3.30.720.120
af_Q4CQ87_202_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7688 104 121 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2D6QEZ6-F1-model_v4 Glyoxalase 0.9937 3 123
AF-A0A3A0DCX4-F1-model_v4 Glyoxalase 0.9927 1 123
AF-A0A2E5E1H6-F1-model_v4 VOC domain-containing protein 0.9916 1 123
AF-A0A5N7Z2I8-F1-model_v4 deleted 0.9896 1 123
AF-A0A1M7L2J8-F1-model_v4 Predicted lactoylglutathione lyase 0.9877 1 123 GO:0016829

Feature Viewer

pLDDT pTM Quality
95.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map