F298500

General Info

Members Datasets Scaffolds Average Seq Length
194 103 388 245

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100378768|Ga0075430_1003787682
Length 260
Sequence MPSQQWINKETFNMRIAVISDMHGNAVAFEAVEKDMQGHHIDQVVCLGDAIQGGPQPVAVVHQLRRLGCPVVMGNADAWLLSGEETGEDGIPEERLKKMGEIRLWSLSQLTDDERAFISGFQPTISIPLEEHLNLLCFHGSPTSFDDVILPDAPKDIFQKFLGAYSDQILTGGHTHAQQIRRNGDLFFFNPGSVGFAYSHYQPDGQFHADPWAEYAILTAEHGKTSLEFRRVPFDVAELIRVYVDSGRPFADEAIAQYQK

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.67
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 23.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100378768 3300006846 Bacteria 1168
2 SwRhRL2b_contig_2526238 2162886007 Bacteria 1210
3 JGI25406J46586_10007878 3300003203 Bacteria 4845
4 Ga0065715_10143568 3300005293 Bacteria 1819
5 Ga0065707_10084227 3300005295 Bacteria 7488
6 Ga0065707_10092281 3300005295 Bacteria 3794
7 Ga0065707_10106842 3300005295 Bacteria 2568
8 Ga0065707_10139381 3300005295 Bacteria 1793
9 Ga0070658_10051640 3300005327 Bacteria 3332
10 Ga0070683_100001193 3300005329 Bacteria 19767
11 Ga0070683_100788927 3300005329 Unclassified 910
12 Ga0070680_100349199 3300005336 Bacteria 1258
13 Ga0070689_100068886 3300005340 Bacteria 2760
14 Ga0070691_10139360 3300005341 Bacteria 1235
15 Ga0070713_100003587 3300005436 Bacteria 10256
16 Ga0070713_100177237 3300005436 Bacteria 1913
17 Ga0070700_100272417 3300005441 Bacteria 1224
18 Ga0070694_100037955 3300005444 Bacteria 3197
19 Ga0070694_100262217 3300005444 Bacteria 1311
20 Ga0070681_10298658 3300005458 Bacteria 1521
21 Ga0070706_100008389 3300005467 Bacteria 9629
22 Ga0070706_100128001 3300005467 Unclassified 2369
23 Ga0070706_100227783 3300005467 Unclassified 1740
24 Ga0070706_100321983 3300005467 Bacteria 1442
25 Ga0070706_100546364 3300005467 Bacteria 1078
26 Ga0070707_100116202 3300005468 Unclassified 2597
27 Ga0070707_100120567 3300005468 Bacteria 2546
28 Ga0070707_100528304 3300005468 Bacteria 1142
29 Ga0070698_100026584 3300005471 Bacteria 6024
30 Ga0070698_100340781 3300005471 Bacteria 1430
31 Ga0070698_100379356 3300005471 Unclassified 1346
32 Ga0070698_100379357 3300005471 Unclassified 1346
33 Ga0070698_100783114 3300005471 Unclassified 897
34 Ga0070698_100842962 3300005471 Bacteria 861
35 Ga0070699_100000765 3300005518 Bacteria 29681
36 Ga0070699_100089555 3300005518 Unclassified 2688
37 Ga0070699_100141026 3300005518 Bacteria 2128
38 Ga0070699_100198060 3300005518 Unclassified 1786
39 Ga0070699_100325120 3300005518 Unclassified 1383
40 Ga0070684_100011951 3300005535 Bacteria 6935
41 Ga0070684_100130990 3300005535 Bacteria 2262
42 Ga0070697_100656454 3300005536 Bacteria 924
43 Ga0070695_100607319 3300005545 Bacteria 859
44 Ga0070664_100022310 3300005564 Bacteria 5220
45 Ga0068857_100000294 3300005577 Bacteria 34550
46 Ga0068856_100000378 3300005614 Bacteria 48711
47 Ga0070702_100157964 3300005615 Bacteria 1462
48 Ga0068859_100024354 3300005617 Bacteria 6073
49 Ga0068860_100472987 3300005843 Bacteria 1248
50 Ga0068862_100003519 3300005844 Bacteria 13441
51 Ga0068862_100043882 3300005844 Bacteria 3812
52 Ga0068862_100177059 3300005844 Bacteria 1912
53 Ga0068862_100451147 3300005844 Bacteria 1212
54 Ga0081539_10003780 3300005985 Bacteria 17895
55 Ga0081539_10114254 3300005985 Bacteria 1353
56 Ga0070717_10961114 3300006028 Unclassified 778
57 Ga0075432_10225467 3300006058 Unclassified 751
58 Ga0075427_10014937 3300006194 Unclassified 1194
59 Ga0075428_100030327 3300006844 Bacteria 5981
60 Ga0075428_100224649 3300006844 Bacteria 2027
61 Ga0075430_100771432 3300006846 Unclassified 792
62 Ga0075431_100158723 3300006847 Unclassified 2326
63 Ga0075431_100263170 3300006847 Bacteria 1750
64 Ga0075433_10197185 3300006852 Unclassified 1791
65 Ga0075433_10321014 3300006852 Unclassified 1370
66 Ga0075429_100002753 3300006880 Bacteria 14856
67 Ga0075429_100137369 3300006880 Bacteria 2139
68 Ga0075429_100167973 3300006880 Bacteria 1922
69 Ga0097620_100024354 3300006931 Bacteria 6073
70 Ga0105240_10438606 3300009093 Bacteria 1464
71 Ga0111539_11109660 3300009094 Bacteria 919
72 Ga0114129_10006821 3300009147 Bacteria 16219
73 Ga0114129_10007445 3300009147 Bacteria 15594
74 Ga0114129_10025344 3300009147 Bacteria 8403
75 Ga0114129_10171478 3300009147 Bacteria 2958
76 Ga0114129_10465016 3300009147 Unclassified 1657
77 Ga0114129_10471255 3300009147 Bacteria 1644
78 Ga0114129_10598470 3300009147 Bacteria 1429
79 Ga0105243_10075830 3300009148 Unclassified 2730
80 Ga0105237_10119316 3300009545 Bacteria 2631
81 Ga0105249_10044403 3300009553 Bacteria 4041
82 Ga0105249_10198965 3300009553 Unclassified 1960
83 Ga0105246_10083498 3300011119 Unclassified 2283
84 Ga0157369_10022145 3300013105 Bacteria 7099
85 Ga0157372_10364892 3300013307 Bacteria 1683
86 Ga0163163_10994435 3300014325 Bacteria 902
87 Ga0157377_10243098 3300014745 Unclassified 1163
88 Ga0206356_11187430 3300020070 Unclassified 2381
89 Ga0224712_10006942 3300022467 Unclassified 3266
90 Ga0207705_10212757 3300025909 Bacteria 1467
91 Ga0207684_10008540 3300025910 Bacteria 9111
92 Ga0207684_10109007 3300025910 Unclassified 2370
93 Ga0207707_10309442 3300025912 Bacteria 1365
94 Ga0207660_10249506 3300025917 Bacteria 1400
95 Ga0207662_10037590 3300025918 Bacteria 2833
96 Ga0207646_10104359 3300025922 Unclassified 2542
97 Ga0207646_10172888 3300025922 Bacteria 1951
98 Ga0207646_10346198 3300025922 Bacteria 1343
99 Ga0207646_10644257 3300025922 Bacteria 949
100 Ga0207700_10001580 3300025928 Bacteria 12936
101 Ga0207664_10018277 3300025929 Bacteria 5156
102 Ga0207690_10339183 3300025932 Bacteria 1186
103 Ga0207670_10068823 3300025936 Bacteria 2440
104 Ga0207670_10209721 3300025936 Bacteria 1485
105 Ga0207670_10592955 3300025936 Bacteria 909
106 Ga0207661_10005703 3300025944 Bacteria 8784
107 Ga0207661_10257186 3300025944 Bacteria 1554
108 Ga0207679_10020154 3300025945 Unclassified 4496
109 Ga0207712_10205096 3300025961 Bacteria 1566
110 Ga0207708_10102157 3300026075 Bacteria 2220
111 Ga0207702_10001761 3300026078 Bacteria 21314
112 Ga0207641_10672710 3300026088 Bacteria 1018
113 Ga0207674_10001031 3300026116 Bacteria 36347
114 Ga0207674_10342186 3300026116 Unclassified 1446
115 Ga0268265_10024709 3300028380 Bacteria 4255
116 Ga0268265_10232373 3300028380 Bacteria 1621
117 Ga0268265_10372388 3300028380 Bacteria 1311
118 Ga0268264_10790471 3300028381 Unclassified 947
119 Ga0307413_10133166 3300031824 Bacteria 1705
120 Ga0307412_10483195 3300031911 Unclassified 1028
121 Ga0307416_100737259 3300032002 Bacteria 1077
122 Ga0307416_101015437 3300032002 Bacteria 933
123 Ga0307415_100835474 3300032126 Unclassified 844
124 Ga0373954_0112017 3300035118 Unclassified 1320
125 Ga0373933_0232256 3300035724 Bacteria 1185
126 Ga0373937_0017013 3300036401 Bacteria 6468
127 Ga0373937_0127092 3300036401 Bacteria 2379
128 Ga0395898_0371436 3300037466 Bacteria 1364
129 Ga0395901_0017831 3300038443 Bacteria 7246
130 Ga0451791_1928846 3300041451 Unclassified 750
131 Ga0451577_0208628 3300042876 Bacteria 1764
132 Ga0451577_0213215 3300042876 Bacteria 1744
133 Ga0453683_0000712 3300044673 Bacteria 34352
134 Ga0453683_0004843 3300044673 Bacteria 9471
135 Ga0453683_0021962 3300044673 Unclassified 4072
136 Ga0453683_0083838 3300044673 Bacteria 1997
137 Ga0453684_0000106 3300044712 Bacteria 364365
138 Ga0453684_0001153 3300044712 Bacteria 82518
139 Ga0453684_0017556 3300044712 Bacteria 11074
140 Ga0453684_0026817 3300044712 Bacteria 8302
141 Ga0453684_0029660 3300044712 Bacteria 7756
142 Ga0453684_0063789 3300044712 Unclassified 4709
143 Ga0453684_0068977 3300044712 Bacteria 4487
144 Ga0453684_0093228 3300044712 Bacteria 3710
145 Ga0453684_0109006 3300044712 Bacteria 3369
146 Ga0453684_0115362 3300044712 Unclassified 3254
147 Ga0453684_0131131 3300044712 Unclassified 3007
148 Ga0453684_0141239 3300044712 Unclassified 2875
149 Ga0453684_0221334 3300044712 Bacteria 2192
150 Ga0453684_0263849 3300044712 Bacteria 1971
151 Ga0453684_0427237 3300044712 Bacteria 1479
152 Ga0453684_0502583 3300044712 Bacteria 1342
153 Ga0453684_0522249 3300044712 Bacteria 1312
154 Ga0453684_0544826 3300044712 Unclassified 1279
155 Ga0453684_0928799 3300044712 Bacteria 930
156 Ga0451576_0004371 3300045051 Bacteria 18428
157 Ga0451576_0040771 3300045051 Bacteria 4911
158 Ga0451576_0040808 3300045051 Bacteria 4909
159 Ga0451576_0120093 3300045051 Bacteria 2736
160 Ga0451576_0152605 3300045051 Bacteria 2409
161 Ga0451576_0248909 3300045051 Bacteria 1857
162 Ga0466967_0233027 3300045976 Unclassified 1754
163 Ga0495592_0087697 3300046454 Bacteria 2238
164 Ga0495628_0206447 3300046516 Bacteria 1479
165 Ga0495674_0056978 3300047319 Bacteria 3421
166 Ga0495674_0146000 3300047319 Bacteria 1986
167 Ga0495602_0047990 3300048088 Bacteria 3843
168 Ga0496104_0059734 3300048907 Bacteria 3610
169 Ga0496105_0164730 3300048908 Unclassified 1819
170 Ga0496107_0394909 3300048910 Bacteria 1029
171 Ga0496109_0173775 3300048912 Bacteria 2022
172 Ga0496109_0305795 3300048912 Bacteria 1500
173 Ga0496112_0004739 3300048915 Bacteria 11590
174 Ga0496112_0390605 3300048915 Bacteria 1332
175 Ga0496112_0614578 3300048915 Bacteria 1018
176 Ga0496113_0113391 3300048916 Unclassified 2113
177 Ga0496115_0113382 3300048918 Bacteria 2228
178 Ga0501034_0057947 3300049571 Bacteria 3894
179 nmdc:mga05p37_59315_c1 3300050507 Bacteria 4713
180 nmdc:mga05p37_597295_c1 3300050507 Unclassified 1247
181 nmdc:mga05p37_617379_c1 3300050507 Bacteria 1221
182 nmdc:mga05p37_636786_c1 3300050507 Bacteria 1197
183 nmdc:mga09592_1986_c1 3300050508 Bacteria 16501
184 nmdc:mga09592_37553_c1 3300050508 Bacteria 4063
185 nmdc:mga09592_398966_c1 3300050508 Bacteria 1189
186 nmdc:mga09592_55102_c1 3300050508 Bacteria 3360
187 nmdc:mga06r32_239763_c1 3300050510 Bacteria 1801
188 nmdc:mga06r32_297534_c1 3300050510 Bacteria 1600
189 nmdc:mga06r32_91428_c1 3300050510 Bacteria 2974
190 nmdc:mga0a205_265869_c1 3300050515 Unclassified 1592
191 nmdc:mga0a205_379669_c1 3300050515 Bacteria 1278
192 Ga0495595_0081007 3300053084 Bacteria 1546
193 Ga0495619_0303597 3300053085 Unclassified 1106
194 Ga0501082_0180301 3300060353 Bacteria 1837
195 Ga0075430_100378768
196 SwRhRL2b_contig_2526238
197 JGI25406J46586_10007878
198 Ga0065715_10143568
199 Ga0065707_10084227
200 Ga0065707_10092281
201 Ga0065707_10106842
202 Ga0065707_10139381
203 Ga0070658_10051640
204 Ga0070683_100001193
205 Ga0070683_100788927
206 Ga0070680_100349199
207 Ga0070689_100068886
208 Ga0070691_10139360
209 Ga0070713_100003587
210 Ga0070713_100177237
211 Ga0070700_100272417
212 Ga0070694_100037955
213 Ga0070694_100262217
214 Ga0070681_10298658
215 Ga0070706_100008389
216 Ga0070706_100128001
217 Ga0070706_100227783
218 Ga0070706_100321983
219 Ga0070706_100546364
220 Ga0070707_100116202
221 Ga0070707_100120567
222 Ga0070707_100528304
223 Ga0070698_100026584
224 Ga0070698_100340781
225 Ga0070698_100379356
226 Ga0070698_100379357
227 Ga0070698_100783114
228 Ga0070698_100842962
229 Ga0070699_100000765
230 Ga0070699_100089555
231 Ga0070699_100141026
232 Ga0070699_100198060
233 Ga0070699_100325120
234 Ga0070684_100011951
235 Ga0070684_100130990
236 Ga0070697_100656454
237 Ga0070695_100607319
238 Ga0070664_100022310
239 Ga0068857_100000294
240 Ga0068856_100000378
241 Ga0070702_100157964
242 Ga0068859_100024354
243 Ga0068860_100472987
244 Ga0068862_100003519
245 Ga0068862_100043882
246 Ga0068862_100177059
247 Ga0068862_100451147
248 Ga0081539_10003780
249 Ga0081539_10114254
250 Ga0070717_10961114
251 Ga0075432_10225467
252 Ga0075427_10014937
253 Ga0075428_100030327
254 Ga0075428_100224649
255 Ga0075430_100771432
256 Ga0075431_100158723
257 Ga0075431_100263170
258 Ga0075433_10197185
259 Ga0075433_10321014
260 Ga0075429_100002753
261 Ga0075429_100137369
262 Ga0075429_100167973
263 Ga0097620_100024354
264 Ga0105240_10438606
265 Ga0111539_11109660
266 Ga0114129_10006821
267 Ga0114129_10007445
268 Ga0114129_10025344
269 Ga0114129_10171478
270 Ga0114129_10465016
271 Ga0114129_10471255
272 Ga0114129_10598470
273 Ga0105243_10075830
274 Ga0105237_10119316
275 Ga0105249_10044403
276 Ga0105249_10198965
277 Ga0105246_10083498
278 Ga0157369_10022145
279 Ga0157372_10364892
280 Ga0163163_10994435
281 Ga0157377_10243098
282 Ga0206356_11187430
283 Ga0224712_10006942
284 Ga0207705_10212757
285 Ga0207684_10008540
286 Ga0207684_10109007
287 Ga0207707_10309442
288 Ga0207660_10249506
289 Ga0207662_10037590
290 Ga0207646_10104359
291 Ga0207646_10172888
292 Ga0207646_10346198
293 Ga0207646_10644257
294 Ga0207700_10001580
295 Ga0207664_10018277
296 Ga0207690_10339183
297 Ga0207670_10068823
298 Ga0207670_10209721
299 Ga0207670_10592955
300 Ga0207661_10005703
301 Ga0207661_10257186
302 Ga0207679_10020154
303 Ga0207712_10205096
304 Ga0207708_10102157
305 Ga0207702_10001761
306 Ga0207641_10672710
307 Ga0207674_10001031
308 Ga0207674_10342186
309 Ga0268265_10024709
310 Ga0268265_10232373
311 Ga0268265_10372388
312 Ga0268264_10790471
313 Ga0307413_10133166
314 Ga0307412_10483195
315 Ga0307416_100737259
316 Ga0307416_101015437
317 Ga0307415_100835474
318 Ga0373954_0112017
319 Ga0373933_0232256
320 Ga0373937_0017013
321 Ga0373937_0127092
322 Ga0395898_0371436
323 Ga0395901_0017831
324 Ga0451791_1928846
325 Ga0451577_0208628
326 Ga0451577_0213215
327 Ga0453683_0000712
328 Ga0453683_0004843
329 Ga0453683_0021962
330 Ga0453683_0083838
331 Ga0453684_0000106
332 Ga0453684_0001153
333 Ga0453684_0017556
334 Ga0453684_0026817
335 Ga0453684_0029660
336 Ga0453684_0063789
337 Ga0453684_0068977
338 Ga0453684_0093228
339 Ga0453684_0109006
340 Ga0453684_0115362
341 Ga0453684_0131131
342 Ga0453684_0141239
343 Ga0453684_0221334
344 Ga0453684_0263849
345 Ga0453684_0427237
346 Ga0453684_0502583
347 Ga0453684_0522249
348 Ga0453684_0544826
349 Ga0453684_0928799
350 Ga0451576_0004371
351 Ga0451576_0040771
352 Ga0451576_0040808
353 Ga0451576_0120093
354 Ga0451576_0152605
355 Ga0451576_0248909
356 Ga0466967_0233027
357 Ga0495592_0087697
358 Ga0495628_0206447
359 Ga0495674_0056978
360 Ga0495674_0146000
361 Ga0495602_0047990
362 Ga0496104_0059734
363 Ga0496105_0164730
364 Ga0496107_0394909
365 Ga0496109_0173775
366 Ga0496109_0305795
367 Ga0496112_0004739
368 Ga0496112_0390605
369 Ga0496112_0614578
370 Ga0496113_0113391
371 Ga0496115_0113382
372 Ga0501034_0057947
373 nmdc:mga05p37_59315_c1
374 nmdc:mga05p37_597295_c1
375 nmdc:mga05p37_617379_c1
376 nmdc:mga05p37_636786_c1
377 nmdc:mga09592_1986_c1
378 nmdc:mga09592_37553_c1
379 nmdc:mga09592_398966_c1
380 nmdc:mga09592_55102_c1
381 nmdc:mga06r32_239763_c1
382 nmdc:mga06r32_297534_c1
383 nmdc:mga06r32_91428_c1
384 nmdc:mga0a205_265869_c1
385 nmdc:mga0a205_379669_c1
386 Ga0495595_0081007
387 Ga0495619_0303597
388 Ga0501082_0180301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

14

222

0.83

PF00149

Metallophos

Calcineurin-like phosphoesterase

14

204

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8736 1 244
7jij-assembly1.cif.gz_B atp-bound amp-activated protein kinase 0.8242 197 221
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8205 2 245
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8029 2 245
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.7997 1 249
ID Description Score Start End Superfamily
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8736 1 244 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8092 2 245 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7909 2 245 3.60.21.10
af_Q9U2D5_568_750_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7841 197 222 2.40.128.20
af_A0A2R8QD26_15_112_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7826 197 222 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D4JDU4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9903 1 247 GO:0005737
GO:0016791
GO:0046872
AF-A0A521I0C8-F1-model_v4 Metallophosphoesterase 0.9896 1 247 GO:0005737
GO:0016791
AF-A0A3D4JDU4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9863 1 247 GO:0005737
GO:0016791
GO:0046872
AF-A0A521I0C8-F1-model_v4 Metallophosphoesterase 0.9857 1 247 GO:0005737
GO:0016791
AF-A0A6L4A591-F1-model_v4 Metallophosphoesterase 0.9833 1 121 GO:0005737
GO:0016791

Map