F298183

General Info

Members Datasets Scaffolds Average Seq Length
194 142 388 164

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100137058|Ga0070682_1001370582
Length 168
Sequence VSPSEQDLVHLRRCVELAREALDAGDEPFGSVLVDRDGAVRHEDRNRTAGGDQTRHPEFELARWSTTAMTPDERAGATVYTSGEHCPMCSAAHAWVGLAKIVYAGSTEQYLRWRAEAGITEPSPVSALPVQAIAPHVLVDGPAPELADELRELHLRHLSGGRSARPEE

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
83 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
132 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
133 2643221615 Nocardioides sp. Root224 Isolate Unclassified
134 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
135 2643221696 Nocardioides sp. Root140 Isolate Unclassified
136 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
137 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
138 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
139 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
140 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
141 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
142 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.81
Metatranscriptomes 0.52
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.62
Nodule 0
Rhizoplane 10.82
Rhizosphere 64.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100137058 3300005337 Bacteria 1664
2 Ga0068869_100305287 3300005334 Bacteria 1286
3 Ga0070682_100046324 3300005337 Bacteria 2698
4 Ga0070661_100660876 3300005344 Bacteria 849
5 Ga0070674_100260503 3300005356 Bacteria 1366
6 Ga0070709_10036306 3300005434 Bacteria 3001
7 Ga0070714_100011018 3300005435 Bacteria 7160
8 Ga0070713_100093546 3300005436 Bacteria 2590
9 Ga0070710_10005841 3300005437 Bacteria 5872
10 Ga0070700_100136028 3300005441 Bacteria 1664
11 Ga0070663_100110582 3300005455 Bacteria 2064
12 Ga0070678_100389561 3300005456 Bacteria 1208
13 Ga0070662_100630593 3300005457 Bacteria 903
14 Ga0070706_100039408 3300005467 Bacteria 4362
15 Ga0070684_100208484 3300005535 Bacteria 1781
16 Ga0070684_100985560 3300005535 Bacteria 791
17 Ga0070664_100041893 3300005564 Bacteria 3865
18 Ga0068857_100330133 3300005577 Bacteria 1410
19 Ga0068857_101722881 3300005577 Bacteria 613
20 Ga0068856_100063632 3300005614 Bacteria 3644
21 Ga0068856_102160359 3300005614 Bacteria 566
22 Ga0068859_100727838 3300005617 Bacteria 1082
23 Ga0068860_100000282 3300005843 Bacteria 72471
24 Ga0070717_10377000 3300006028 Bacteria 1272
25 Ga0075365_10109919 3300006038 Bacteria 1894
26 Ga0075365_10601576 3300006038 Bacteria 777
27 Ga0075368_10008114 3300006042 Bacteria 3729
28 Ga0075363_100010120 3300006048 Bacteria 4460
29 Ga0075363_100030196 3300006048 Bacteria 2804
30 Ga0075363_100331496 3300006048 Bacteria 886
31 Ga0075364_10005061 3300006051 Bacteria 7643
32 Ga0075364_10018532 3300006051 Bacteria 4358
33 Ga0075364_10191842 3300006051 Bacteria 1384
34 Ga0075364_10693607 3300006051 Bacteria 695
35 Ga0075362_10032231 3300006177 Bacteria 2273
36 Ga0075367_10151682 3300006178 Bacteria 1438
37 Ga0075367_10210733 3300006178 Bacteria 1215
38 Ga0075367_10326279 3300006178 Bacteria 968
39 Ga0075367_10588798 3300006178 Bacteria 707
40 Ga0075369_10008396 3300006186 Bacteria 3970
41 Ga0075370_10035781 3300006353 Bacteria 2788
42 Ga0075370_10063352 3300006353 Bacteria 2108
43 Ga0097620_100727806 3300006931 Bacteria 1082
44 Ga0105250_10089594 3300009092 Bacteria 1250
45 Ga0105245_10225976 3300009098 Bacteria 1808
46 Ga0105245_10287727 3300009098 Bacteria 1609
47 Ga0105245_10500108 3300009098 Bacteria 1232
48 Ga0105245_12262182 3300009098 Bacteria 597
49 Ga0105243_10586693 3300009148 Bacteria 1071
50 Ga0105248_11554919 3300009177 Bacteria 749
51 Ga0105237_10002857 3300009545 Bacteria 21003
52 Ga0105249_10758857 3300009553 Bacteria 1032
53 Ga0105035_101115 3300009988 Bacteria 1790
54 Ga0105239_11239272 3300010375 Bacteria 860
55 Ga0105246_10290637 3300011119 Bacteria 1315
56 Ga0157369_10919240 3300013105 Bacteria 897
57 Ga0157374_10717116 3300013296 Bacteria 1014
58 Ga0163162_10550958 3300013306 Bacteria 1281
59 Ga0157375_10427984 3300013308 Bacteria 1490
60 Ga0157375_10451269 3300013308 Bacteria 1451
61 Ga0157515_141397 3300013875 Bacteria 1535
62 Ga0163163_11288742 3300014325 Bacteria 793
63 Ga0157377_10112797 3300014745 Bacteria 1636
64 Ga0157379_10613913 3300014968 Bacteria 1016
65 Ga0157376_10099509 3300014969 Bacteria 2537
66 Ga0157376_10536516 3300014969 Bacteria 1156
67 Ga0157376_12239418 3300014969 Bacteria 585
68 Ga0163161_10600424 3300017792 Bacteria 907
69 Ga0163161_11519429 3300017792 Bacteria 588
70 Ga0163161_11530473 3300017792 Bacteria 586
71 Ga0224572_1004574 3300024225 Bacteria 2415
72 Ga0207696_1062475 3300025711 Bacteria 1045
73 Ga0207642_10879762 3300025899 Bacteria 573
74 Ga0207662_10549304 3300025918 Bacteria 800
75 Ga0207649_10569156 3300025920 Bacteria 869
76 Ga0207659_10679613 3300025926 Bacteria 881
77 Ga0207687_10163664 3300025927 Bacteria 1710
78 Ga0207664_10017123 3300025929 Bacteria 5304
79 Ga0207709_10456532 3300025935 Bacteria 989
80 Ga0207669_10353623 3300025937 Bacteria 1136
81 Ga0207669_10589907 3300025937 Bacteria 902
82 Ga0207689_10118460 3300025942 Bacteria 2178
83 Ga0207679_10012154 3300025945 Bacteria 5605
84 Ga0207668_10743985 3300025972 Bacteria 865
85 Ga0207658_10071340 3300025986 Bacteria 2630
86 Ga0207658_11442066 3300025986 Bacteria 630
87 Ga0207678_10135465 3300026067 Bacteria 2101
88 Ga0207702_11813572 3300026078 Bacteria 602
89 Ga0207676_10583772 3300026095 Bacteria 1072
90 Ga0207683_10044684 3300026121 Bacteria 3873
91 Ga0207698_10277361 3300026142 Bacteria 1549
92 Ga0207698_11215286 3300026142 Bacteria 768
93 Ga0209813_10002397 3300027866 Bacteria 4300
94 Ga0268266_11273098 3300028379 Bacteria 711
95 Ga0268264_10000390 3300028381 Bacteria 63138
96 Ga0265760_10058461 3300031090 Bacteria 1169
97 Ga0307416_100067631 3300032002 Bacteria 2948
98 Ga0307414_11236417 3300032004 Bacteria 692
99 Ga0307411_10274381 3300032005 Bacteria 1339
100 Ga0373951_0000016 3300035091 Bacteria 66469
101 Ga0395905_0859610 3300037471 Bacteria 810
102 Ga0451791_1761986 3300041451 Bacteria 3998
103 Ga0451793_0062069 3300041452 Bacteria 15417
104 Ga0451795_0952416 3300041456 Bacteria 652
105 Ga0451800_0747236 3300041459 Bacteria 893
106 Ga0451837_1112174 3300041494 Bacteria 2384
107 Ga0451839_0803270 3300041496 Bacteria 2527
108 Ga0451851_1361412 3300041507 Bacteria 582
109 Ga0451853_0455971 3300041512 Bacteria 6480
110 Ga0439459_0029491 3300042438 Bacteria 1107
111 Ga0466965_0059061 3300044683 Bacteria 1913
112 Ga0466958_0050887 3300045836 Bacteria 2508
113 Ga0495651_0109068 3300046462 Bacteria 2049
114 Ga0495653_0496865 3300046463 Bacteria 761
115 Ga0495628_0050592 3300046516 Bacteria 3286
116 Ga0495665_0331041 3300046531 Bacteria 777
117 Ga0495667_0191421 3300046559 Bacteria 1311
118 Ga0495588_0226691 3300046674 Bacteria 986
119 Ga0496102_0176707 3300048905 Bacteria 2011
120 Ga0496102_0259711 3300048905 Bacteria 1637
121 Ga0496102_1107518 3300048905 Bacteria 712
122 Ga0496108_0031295 3300048911 Bacteria 4414
123 Ga0496108_0144207 3300048911 Bacteria 2052
124 Ga0496108_0651577 3300048911 Bacteria 915
125 Ga0496109_0079371 3300048912 Bacteria 3024
126 Ga0496109_0134663 3300048912 Bacteria 2308
127 Ga0496109_0274108 3300048912 Bacteria 1590
128 Ga0496109_0491940 3300048912 Bacteria 1158
129 Ga0496110_0347224 3300048913 Bacteria 1352
130 Ga0496110_1637354 3300048913 Bacteria 554
131 Ga0496111_0049000 3300048914 Bacteria 3046
132 Ga0496112_1673167 3300048915 Bacteria 549
133 Ga0496114_0020561 3300048917 Bacteria 5357
134 Ga0496114_0150910 3300048917 Bacteria 2016
135 Ga0496114_0212113 3300048917 Bacteria 1698
136 Ga0501031_0009792 3300049568 Bacteria 6239
137 Ga0501032_0079691 3300049569 Bacteria 2180
138 Ga0501034_1005610 3300049571 Bacteria 718
139 Ga0501036_0058613 3300049572 Bacteria 3262
140 Ga0501038_0077884 3300049574 Bacteria 2798
141 Ga0501041_0303999 3300049577 Bacteria 1005
142 Ga0501042_0067991 3300049578 Bacteria 2547
143 Ga0501042_0129055 3300049578 Bacteria 1822
144 Ga0501048_0039973 3300049582 Bacteria 3362
145 Ga0501068_0479491 3300049584 Bacteria 806
146 Ga0501069_0584341 3300049585 Bacteria 670
147 Ga0501070_0027725 3300049586 Bacteria 4752
148 Ga0501071_0109111 3300049587 Bacteria 2044
149 Ga0501071_0304274 3300049587 Bacteria 1209
150 Ga0501074_0012900 3300049590 Bacteria 6075
151 Ga0501076_0127193 3300049592 Bacteria 2065
152 Ga0501077_0177566 3300049593 Bacteria 1353
153 Ga0501079_0088733 3300049741 Bacteria 2394
154 Ga0501080_0247333 3300049742 Bacteria 1626
155 Ga0501081_0126203 3300049743 Bacteria 1825
156 Ga0501044_0343996 3300049823 Bacteria 1412
157 nmdc:mga03683_28157_c1 3300050489 Bacteria 2232
158 nmdc:mga03n38_112027_c1 3300050490 Bacteria 1330
159 nmdc:mga03n38_152403_c1 3300050490 Bacteria 1164
160 nmdc:mga03n38_3649_c1 3300050490 Bacteria 3369
161 nmdc:mga03n38_3936_c1 3300050490 Bacteria 4843
162 nmdc:mga00v17_136248_c1 3300050491 Bacteria 1572
163 nmdc:mga00v17_143715_c1 3300050491 Bacteria 1531
164 nmdc:mga00v17_6505_c1 3300050491 Bacteria 6202
165 nmdc:mga00v17_92218_c1 3300050491 Bacteria 1904
166 nmdc:mga0yw44_141690_c1 3300050492 Bacteria 1563
167 nmdc:mga0yw44_553466_c1 3300050492 Bacteria 781
168 nmdc:mga0yw44_596245_c1 3300050492 Bacteria 751
169 nmdc:mga0yw44_741948_c1 3300050492 Bacteria 667
170 nmdc:mga0yw44_85089_c1 3300050492 Bacteria 1989
171 nmdc:mga06z11_361805_c1 3300050494 Bacteria 870
172 nmdc:mga06z11_37766_c1 3300050494 Bacteria 2394
173 nmdc:mga06z11_446603_c1 3300050494 Bacteria 781
174 nmdc:mga04h51_11499_c1 3300050495 Bacteria 2458
175 nmdc:mga07m45_138061_c1 3300050496 Bacteria 1411
176 nmdc:mga07m45_41786_c1 3300050496 Bacteria 2568
177 nmdc:mga07m45_52138_c1 3300050496 Bacteria 2309
178 Ga0495655_0021430 3300053083 Bacteria 1463
179 Ga0495595_0300949 3300053084 Bacteria 807
180 Ga0501084_0094008 3300054114 Bacteria 2517
181 Ga0501084_0486006 3300054114 Bacteria 1044
182 Ga0501082_0175684 3300060353 Bacteria 1862
183 Ga0530510_0082616 3300061734 Bacteria 2339
184 2537897566 2537561592 Bacteria 4348607
185 2644092437 2643221615 Bacteria 5487866
186 2644323303 2643221657 Bacteria 5490246
187 2644534849 2643221696 Bacteria 5431823
188 2676474736 2675903058 Bacteria 6822861
189 2827631096 2827628540 Bacteria 6858585
190 2844851847 2844849076 Bacteria 4091819
191 2883826035 2883821847 Bacteria 5121194
192 2902798139 2902792274 Bacteria 7270173
193 2919448669 2919446982 Bacteria 3994487
194 2995727543 2995726249 Bacteria 3470435
195 Ga0070682_100137058
196 Ga0068869_100305287
197 Ga0070682_100046324
198 Ga0070661_100660876
199 Ga0070674_100260503
200 Ga0070709_10036306
201 Ga0070714_100011018
202 Ga0070713_100093546
203 Ga0070710_10005841
204 Ga0070700_100136028
205 Ga0070663_100110582
206 Ga0070678_100389561
207 Ga0070662_100630593
208 Ga0070706_100039408
209 Ga0070684_100208484
210 Ga0070684_100985560
211 Ga0070664_100041893
212 Ga0068857_100330133
213 Ga0068857_101722881
214 Ga0068856_100063632
215 Ga0068856_102160359
216 Ga0068859_100727838
217 Ga0068860_100000282
218 Ga0070717_10377000
219 Ga0075365_10109919
220 Ga0075365_10601576
221 Ga0075368_10008114
222 Ga0075363_100010120
223 Ga0075363_100030196
224 Ga0075363_100331496
225 Ga0075364_10005061
226 Ga0075364_10018532
227 Ga0075364_10191842
228 Ga0075364_10693607
229 Ga0075362_10032231
230 Ga0075367_10151682
231 Ga0075367_10210733
232 Ga0075367_10326279
233 Ga0075367_10588798
234 Ga0075369_10008396
235 Ga0075370_10035781
236 Ga0075370_10063352
237 Ga0097620_100727806
238 Ga0105250_10089594
239 Ga0105245_10225976
240 Ga0105245_10287727
241 Ga0105245_10500108
242 Ga0105245_12262182
243 Ga0105243_10586693
244 Ga0105248_11554919
245 Ga0105237_10002857
246 Ga0105249_10758857
247 Ga0105035_101115
248 Ga0105239_11239272
249 Ga0105246_10290637
250 Ga0157369_10919240
251 Ga0157374_10717116
252 Ga0163162_10550958
253 Ga0157375_10427984
254 Ga0157375_10451269
255 Ga0157515_141397
256 Ga0163163_11288742
257 Ga0157377_10112797
258 Ga0157379_10613913
259 Ga0157376_10099509
260 Ga0157376_10536516
261 Ga0157376_12239418
262 Ga0163161_10600424
263 Ga0163161_11519429
264 Ga0163161_11530473
265 Ga0224572_1004574
266 Ga0207696_1062475
267 Ga0207642_10879762
268 Ga0207662_10549304
269 Ga0207649_10569156
270 Ga0207659_10679613
271 Ga0207687_10163664
272 Ga0207664_10017123
273 Ga0207709_10456532
274 Ga0207669_10353623
275 Ga0207669_10589907
276 Ga0207689_10118460
277 Ga0207679_10012154
278 Ga0207668_10743985
279 Ga0207658_10071340
280 Ga0207658_11442066
281 Ga0207678_10135465
282 Ga0207702_11813572
283 Ga0207676_10583772
284 Ga0207683_10044684
285 Ga0207698_10277361
286 Ga0207698_11215286
287 Ga0209813_10002397
288 Ga0268266_11273098
289 Ga0268264_10000390
290 Ga0265760_10058461
291 Ga0307416_100067631
292 Ga0307414_11236417
293 Ga0307411_10274381
294 Ga0373951_0000016
295 Ga0395905_0859610
296 Ga0451791_1761986
297 Ga0451793_0062069
298 Ga0451795_0952416
299 Ga0451800_0747236
300 Ga0451837_1112174
301 Ga0451839_0803270
302 Ga0451851_1361412
303 Ga0451853_0455971
304 Ga0439459_0029491
305 Ga0466965_0059061
306 Ga0466958_0050887
307 Ga0495651_0109068
308 Ga0495653_0496865
309 Ga0495628_0050592
310 Ga0495665_0331041
311 Ga0495667_0191421
312 Ga0495588_0226691
313 Ga0496102_0176707
314 Ga0496102_0259711
315 Ga0496102_1107518
316 Ga0496108_0031295
317 Ga0496108_0144207
318 Ga0496108_0651577
319 Ga0496109_0079371
320 Ga0496109_0134663
321 Ga0496109_0274108
322 Ga0496109_0491940
323 Ga0496110_0347224
324 Ga0496110_1637354
325 Ga0496111_0049000
326 Ga0496112_1673167
327 Ga0496114_0020561
328 Ga0496114_0150910
329 Ga0496114_0212113
330 Ga0501031_0009792
331 Ga0501032_0079691
332 Ga0501034_1005610
333 Ga0501036_0058613
334 Ga0501038_0077884
335 Ga0501041_0303999
336 Ga0501042_0067991
337 Ga0501042_0129055
338 Ga0501048_0039973
339 Ga0501068_0479491
340 Ga0501069_0584341
341 Ga0501070_0027725
342 Ga0501071_0109111
343 Ga0501071_0304274
344 Ga0501074_0012900
345 Ga0501076_0127193
346 Ga0501077_0177566
347 Ga0501079_0088733
348 Ga0501080_0247333
349 Ga0501081_0126203
350 Ga0501044_0343996
351 nmdc:mga03683_28157_c1
352 nmdc:mga03n38_112027_c1
353 nmdc:mga03n38_152403_c1
354 nmdc:mga03n38_3649_c1
355 nmdc:mga03n38_3936_c1
356 nmdc:mga00v17_136248_c1
357 nmdc:mga00v17_143715_c1
358 nmdc:mga00v17_6505_c1
359 nmdc:mga00v17_92218_c1
360 nmdc:mga0yw44_141690_c1
361 nmdc:mga0yw44_553466_c1
362 nmdc:mga0yw44_596245_c1
363 nmdc:mga0yw44_741948_c1
364 nmdc:mga0yw44_85089_c1
365 nmdc:mga06z11_361805_c1
366 nmdc:mga06z11_37766_c1
367 nmdc:mga06z11_446603_c1
368 nmdc:mga04h51_11499_c1
369 nmdc:mga07m45_138061_c1
370 nmdc:mga07m45_41786_c1
371 nmdc:mga07m45_52138_c1
372 Ga0495655_0021430
373 Ga0495595_0300949
374 Ga0501084_0094008
375 Ga0501084_0486006
376 Ga0501082_0175684
377 Ga0530510_0082616
378 2537897566
379 2644092437
380 2644323303
381 2644534849
382 2676474736
383 2827631096
384 2844851847
385 2883826035
386 2902798139
387 2919448669
388 2995727543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

5

112

0.9

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

4

105

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkp-assembly1.cif.gz_B crystal structure of msmeg3575 in complex with 5-azacytosine 0.9834 2 153
5xkq-assembly1.cif.gz_A crystal structure of msmeg3575 in complex with ammeline 0.9827 2 152
5xkq-assembly2.cif.gz_C crystal structure of msmeg3575 in complex with ammeline 0.9824 2 152
5xkp-assembly2.cif.gz_C crystal structure of msmeg3575 in complex with 5-azacytosine 0.9806 2 153
5xkq-assembly2.cif.gz_D crystal structure of msmeg3575 in complex with ammeline 0.9769 1 153
ID Description Score Start End Superfamily
af_A0A1D8PFE5_422_777_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9485 27 42 2.120.10.80
af_A0A1D6EFG6_210_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.936 76 105 3.40.140.10
af_B2RU80_1175_1263_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9037 27 42 2.60.40.10
4ypjB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8976 27 42 2.60.40.10
af_O59834_3_162_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8898 1 156 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3Q9TJU1-F1-model_v4 deleted 0.9953 1 101
AF-A0A5C4J1U7-F1-model_v4 Nucleoside deaminase 0.9899 1 101 GO:0003824
AF-A0A0A0JI34-F1-model_v4 deleted 0.9895 2 95
AF-A0A7C1R5M9-F1-model_v4 Nucleoside deaminase 0.9886 1 92 GO:0003824
AF-A0A543L4K2-F1-model_v4 deleted 0.9877 1 157

Map