F297852

General Info

Members Datasets Scaffolds Average Seq Length
193 103 187 301

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0019561|Ga0500604_0019561_508_1482
Length 324
Sequence LSDVDTVGEIARLIDQLLSLHRVKKKKEVTIRSIADLHQFYQCGRPKHPLVSVMDLQTIDHTLLTPHVPLQMNLYIVACKHFDGNIHYGRSNYDFEEGTMMFTAPNQVVSPGSDIDLKEGWALFFHPDLLRGTDLERKMHRYSFFRYEANEALHISEDEKITLQECINNIRKEYTLPIDKHSQNLIASNIELLLNYCNRFYDRQFISRKSANNDVVIRFERLLADYFGDQGHTQEGLPDVGYFSEQLKLSSNYLSDLLSKYTGKTTQEHIHLYVVERAKSLLWNSDKSIREVAYALGFEHPSHFTKIFKAKVGVSPKEFRKISG

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
97 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
98 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
99 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
100 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
101 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
102 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
103 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.65
Nodule 0
Rhizoplane 0
Rhizosphere 67.36
Stem 0
Stem Tuber 0
Unclassified 13.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002512 3300001989 Bacteria 7076
2 JGI25162J39368_1000005 3300002737 Bacteria 435925
3 rootH1_10103844 3300003316 Unclassified 2802
4 rootH1_10135479 3300003316 Bacteria 3998
5 rootH2_10051807 3300003320 Bacteria 16238
6 rootH2_10191528 3300003320 Bacteria 1732
7 rootL2_10049151 3300003322 Bacteria 7327
8 rootL2_10136204 3300003322 Bacteria 4584
9 rootL2_10246913 3300003322 Bacteria 3890
10 rootH1_10068010 3300003323 Bacteria 13848
11 rootH1_10096866 3300003323 Bacteria 3279
12 rootH1_10233464 3300003323 Bacteria 1358
13 rootH1_10277005 3300003323 Bacteria 4543
14 rootH1_10372097 3300003323 Bacteria 1303
15 JGI25160J50197_1002881 3300003354 Bacteria 7873
16 Ga0055526_1020921 3300003771 Unclassified 2301
17 Ga0055528_1000232 3300003790 Bacteria 46543
18 Ga0055531_10000210 3300003794 Bacteria 64274
19 Ga0055531_10029982 3300003794 Bacteria 1838
20 Ga0065165_1000010 3300005262 Bacteria 323737
21 Ga0065165_1000130 3300005262 Bacteria 128998
22 Ga0065714_10090836 3300005288 Bacteria 1930
23 Ga0065704_10078443 3300005289 Bacteria 4426
24 Ga0065704_10088984 3300005289 Bacteria 2885
25 Ga0068868_100180852 3300005338 Bacteria 1749
26 Ga0070674_100092987 3300005356 Bacteria 2181
27 Ga0068853_100021708 3300005539 Bacteria 5356
28 Ga0068853_100165320 3300005539 Bacteria 1999
29 Ga0068853_100584126 3300005539 Unclassified 1060
30 Ga0068855_100002062 3300005563 Bacteria 24904
31 Ga0068855_100036459 3300005563 Bacteria 5853
32 Ga0068855_100166660 3300005563 Bacteria 2497
33 Ga0068855_100167728 3300005563 Bacteria 2488
34 Ga0068855_100221035 3300005563 Bacteria 2124
35 Ga0068856_100033532 3300005614 Bacteria 5028
36 Ga0068856_100190010 3300005614 Bacteria 2067
37 Ga0068852_100249754 3300005616 Unclassified 1699
38 Ga0068864_100313569 3300005618 Bacteria 1471
39 Ga0075366_10000026 3300006195 Bacteria 51752
40 Ga0075366_10118596 3300006195 Bacteria 1594
41 Ga0075366_10165668 3300006195 Bacteria 1340
42 Ga0097621_100339727 3300006237 Bacteria 1333
43 Ga0105240_10000008 3300009093 Bacteria 618862
44 Ga0105240_10000200 3300009093 Bacteria 121941
45 Ga0105240_10000326 3300009093 Bacteria 89982
46 Ga0105240_10001435 3300009093 Bacteria 40778
47 Ga0105240_10003182 3300009093 Bacteria 25789
48 Ga0105240_10026169 3300009093 Bacteria 7656
49 Ga0105240_10041124 3300009093 Bacteria 5903
50 Ga0105240_10293175 3300009093 Bacteria 1864
51 Ga0105240_10422718 3300009093 Bacteria 1497
52 Ga0105240_10565176 3300009093 Bacteria 1257
53 Ga0105241_10029951 3300009174 Bacteria 4065
54 Ga0105241_10290310 3300009174 Bacteria 1400
55 Ga0105237_10000215 3300009545 Bacteria 81284
56 Ga0105237_10001314 3300009545 Bacteria 33011
57 Ga0105237_10003110 3300009545 Bacteria 19993
58 Ga0105237_10005461 3300009545 Bacteria 14336
59 Ga0105237_10022990 3300009545 Bacteria 6393
60 Ga0105237_10043542 3300009545 Bacteria 4521
61 Ga0105237_10062982 3300009545 Bacteria 3707
62 Ga0105237_10067858 3300009545 Bacteria 3560
63 Ga0105237_10089247 3300009545 Bacteria 3072
64 Ga0105237_10105084 3300009545 Bacteria 2815
65 Ga0105237_10209758 3300009545 Bacteria 1948
66 Ga0105237_10266831 3300009545 Unclassified 1715
67 Ga0105237_10366879 3300009545 Bacteria 1445
68 Ga0105238_10050060 3300009551 Bacteria 4206
69 Ga0105238_10061749 3300009551 Bacteria 3749
70 Ga0105238_10156121 3300009551 Bacteria 2257
71 Ga0105238_10298717 3300009551 Unclassified 1594
72 Ga0105238_10660075 3300009551 Bacteria 1056
73 Ga0105239_10000012 3300010375 Bacteria 332279
74 Ga0105239_10000032 3300010375 Bacteria 225528
75 Ga0105239_10000084 3300010375 Bacteria 130978
76 Ga0105239_10000530 3300010375 Bacteria 55219
77 Ga0105239_10000597 3300010375 Viruses 51483
78 Ga0105239_10001525 3300010375 Bacteria 30758
79 Ga0105239_10002939 3300010375 Bacteria 21260
80 Ga0105239_10005275 3300010375 Bacteria 15191
81 Ga0105239_10005586 3300010375 Bacteria 14708
82 Ga0105239_10071835 3300010375 Bacteria 3802
83 Ga0157370_10000099 3300013104 Bacteria 98110
84 Ga0157370_10001591 3300013104 Bacteria 28044
85 Ga0157370_10007875 3300013104 Bacteria 11548
86 Ga0157374_10000024 3300013296 Bacteria 265166
87 Ga0157378_10021583 3300013297 Bacteria 5664
88 Ga0163162_10018113 3300013306 Bacteria 6895
89 Ga0163162_10024844 3300013306 Bacteria 5918
90 Ga0157372_10003110 3300013307 Bacteria 17892
91 Ga0157376_10012683 3300014969 Bacteria 6267
92 Ga0209436_102379 3300025208 Bacteria 5709
93 Ga0209563_106632 3300025230 Unclassified 1971
94 Ga0209437_100043 3300025233 Bacteria 440454
95 Ga0209646_1000752 3300025246 Bacteria 11297
96 Ga0209673_1000082 3300025273 Bacteria 219716
97 Ga0209676_1000513 3300025292 Bacteria 60961
98 Ga0209564_1000938 3300025295 Bacteria 37831
99 Ga0209564_1001267 3300025295 Bacteria 27798
100 Ga0209758_1004606 3300025297 Bacteria 11330
101 Ga0209758_1014420 3300025297 Bacteria 4206
102 Ga0207426_1000763 3300025302 Bacteria 35780
103 Ga0207426_1007946 3300025302 Bacteria 4369
104 Ga0207426_1023940 3300025302 Unclassified 2078
105 Ga0209257_1000025 3300025304 Bacteria 724838
106 Ga0209257_1003849 3300025304 Bacteria 12288
107 Ga0207654_10141547 3300025911 Bacteria 1534
108 Ga0207695_10000021 3300025913 Bacteria 679399
109 Ga0207695_10000039 3300025913 Bacteria 454801
110 Ga0207695_10000055 3300025913 Bacteria 382776
111 Ga0207695_10005223 3300025913 Bacteria 17361
112 Ga0207695_10006599 3300025913 Bacteria 14998
113 Ga0207695_10022243 3300025913 Bacteria 7209
114 Ga0207671_10003149 3300025914 Bacteria 16723
115 Ga0207671_10003215 3300025914 Bacteria 16442
116 Ga0207671_10006673 3300025914 Bacteria 10228
117 Ga0207671_10007063 3300025914 Bacteria 9827
118 Ga0207671_10007791 3300025914 Bacteria 9220
119 Ga0207671_10010389 3300025914 Bacteria 7685
120 Ga0207671_10028517 3300025914 Bacteria 4170
121 Ga0207671_10030023 3300025914 Bacteria 4055
122 Ga0207671_10049505 3300025914 Bacteria 3111
123 Ga0207694_10098870 3300025924 Bacteria 2311
124 Ga0207694_10186276 3300025924 Unclassified 1685
125 Ga0207669_10120824 3300025937 Bacteria 1778
126 Ga0207667_10001302 3300025949 Bacteria 31255
127 Ga0207667_10157443 3300025949 Unclassified 2337
128 Ga0207639_10005833 3300026041 Bacteria 8343
129 Ga0207639_10275951 3300026041 Bacteria 1476
130 Ga0207702_10024601 3300026078 Bacteria 4998
131 Ga0207702_10034230 3300026078 Bacteria 4247
132 Ga0207676_10209337 3300026095 Bacteria 1729
133 Ga0207698_10120665 3300026142 Bacteria 2218
134 Ga0307517_10017673 3300028786 Bacteria 9273
135 Ga0307511_10000502 3300030521 Bacteria 42121
136 Ga0307513_10073995 3300031456 Bacteria 3545
137 Ga0307516_10000579 3300031730 Bacteria 49479
138 Ga0307516_10070115 3300031730 Unclassified 3370
139 Ga0307405_10009486 3300031731 Bacteria 4992
140 Ga0307412_10058302 3300031911 Unclassified 2582
141 Ga0307414_10001213 3300032004 Bacteria 13284
142 Ga0307414_10060925 3300032004 Unclassified 2671
143 Ga0307510_10003043 3300033180 Bacteria 19355
144 Ga0395900_0010421 3300037418 Bacteria 9505
145 Ga0395905_0001686 3300037471 Bacteria 26039
146 Ga0395901_0001030 3300038443 Bacteria 30196
147 Ga0400490_48837 3300038726 Bacteria 14558
148 Ga0439439_0007926 3300041406 Unclassified 2497
149 Ga0451577_0026471 3300042876 Bacteria 5254
150 Ga0451577_0071780 3300042876 Bacteria 3088
151 Ga0451577_0194278 3300042876 Unclassified 1831
152 Ga0466972_0000078 3300044658 Bacteria 91188
153 Ga0466982_0176246 3300044672 Unclassified 1295
154 Ga0453683_0384574 3300044673 Bacteria 904
155 Ga0466964_0098680 3300044706 Unclassified 1284
156 Ga0453684_0000496 3300044712 Bacteria 154738
157 Ga0466957_0006040 3300044842 Bacteria 6836
158 Ga0495651_0122979 3300046462 Bacteria 1904
159 Ga0495606_0002671 3300046507 Bacteria 20238
160 Ga0495616_0004040 3300046513 Bacteria 9321
161 Ga0495643_0050852 3300046522 Bacteria 2231
162 Ga0495644_0049737 3300046523 Unclassified 1573
163 Ga0495633_0000002 3300046558 Bacteria 488754
164 Ga0495611_0000050 3300046648 Bacteria 84026
165 Ga0495625_0000252 3300046660 Bacteria 83831
166 Ga0495625_0019373 3300046660 Bacteria 5280
167 Ga0495625_0037691 3300046660 Bacteria 3543
168 Ga0495661_0001065 3300046665 Bacteria 24224
169 Ga0495670_0115313 3300046691 Unclassified 1393
170 Ga0495649_0011752 3300046694 Bacteria 5122
171 Ga0495686_0000066 3300047472 Bacteria 225023
172 Ga0495686_0001492 3300047472 Bacteria 25345
173 Ga0495686_0001772 3300047472 Bacteria 22013
174 Ga0496118_0085610 3300048921 Bacteria 2194
175 Ga0496121_0027345 3300048924 Bacteria 5339
176 Ga0495678_024227 3300049459 Bacteria 2624
177 nmdc:mga0k408_166543_c1 3300050493 Bacteria 1313
178 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
179 nmdc:mga0k408_53_c1 3300050493 Bacteria 57877
180 Ga0500583_0000680 3300053092 Bacteria 9955
181 Ga0500608_005595 3300053122 Bacteria 5012
182 Ga0500618_000245 3300053125 Bacteria 43176
183 Ga0500564_038520 3300053138 Bacteria 2203
184 Ga0500604_0019561 3300053151 Bacteria 1897
185 Ga0500622_0002861 3300053156 Bacteria 12075
186 Ga0500627_0100482 3300053158 Bacteria 1298
187 Ga0500645_002622 3300053730 Bacteria 7874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044672 Ga0466982_0176246 Ga0466982_0176246_86_907 270
2 3300044673 Ga0453683_0384574 Ga0453683_0384574_33_884 280
3 3300005618 Ga0068864_100313569 Ga0068864_1003135692 283
4 3300009093 Ga0105240_10293175 Ga0105240_102931752 283
5 3300009545 Ga0105237_10062982 Ga0105237_100629825 283
6 3300010375 Ga0105239_10071835 Ga0105239_100718354 283
7 3300042876 Ga0451577_0194278 Ga0451577_0194278_426_1391 283
8 3300025914 Ga0207671_10007063 Ga0207671_100070638 284
9 3300026095 Ga0207676_10209337 Ga0207676_102093372 284
10 3300046523 Ga0495644_0049737 Ga0495644_0049737_32_895 287
11 3300003316 rootH1_10103844 rootH1_101038443 288
12 3300033180 Ga0307510_10003043 Ga0307510_1000304312 293
13 3300042876 Ga0451577_0071780 Ga0451577_0071780_97_993 295
14 3300044712 Ga0453684_0000496 Ga0453684_0000496_72683_73579 295
15 iso_pu_bacteria 2522125168 2522551877 296
16 iso_pu_bacteria 2821136567 2821142319 296
17 iso_pu_bacteria 2904467357 2904470514 296
18 iso_pu_bacteria 2919399522 2919400246 296
19 3300003323 rootH1_10372097 rootH1_103720971 297
20 3300042876 Ga0451577_0026471 Ga0451577_0026471_2676_3578 297
21 iso_pu_bacteria 2919437846 2919439357 297
22 3300031456 Ga0307513_10073995 Ga0307513_100739953 298
23 3300003320 rootH2_10191528 rootH2_101915281 299
24 3300003323 rootH1_10096866 rootH1_100968663 299
25 3300005614 Ga0068856_100190010 Ga0068856_1001900103 299
26 3300010375 Ga0105239_10000597 Ga0105239_1000059713 299
27 3300013307 Ga0157372_10003110 Ga0157372_100031108 299
28 3300026078 Ga0207702_10034230 Ga0207702_100342305 299
29 3300038726 Ga0400490_48837 Ga0400490_48837_5692_6606 299
30 3300046522 Ga0495643_0050852 Ga0495643_0050852_1001_1903 299
31 3300053156 Ga0500622_0002861 Ga0500622_0002861_10340_11239 299
32 iso_pu_bacteria 2738541278 2738728555 299
33 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005308 300
34 3300003316 rootH1_10135479 rootH1_101354792 300
35 3300003322 rootL2_10049151 rootL2_100491511 300
36 3300003323 rootH1_10068010 rootH1_100680102 300
37 3300003323 rootH1_10277005 rootH1_102770053 300
38 3300003794 Ga0055531_10000210 Ga0055531_1000021047 300
39 3300005262 Ga0065165_1000130 Ga0065165_100013073 300
40 3300005288 Ga0065714_10090836 Ga0065714_100908362 300
41 3300005289 Ga0065704_10078443 Ga0065704_100784434 300
42 3300005289 Ga0065704_10088984 Ga0065704_100889842 300
43 3300005356 Ga0070674_100092987 Ga0070674_1000929872 300
44 3300005539 Ga0068853_100165320 Ga0068853_1001653202 300
45 3300005563 Ga0068855_100002062 Ga0068855_10000206225 300
46 3300005563 Ga0068855_100166660 Ga0068855_1001666602 300
47 3300005563 Ga0068855_100221035 Ga0068855_1002210353 300
48 3300006195 Ga0075366_10000026 Ga0075366_100000266 300
49 3300006195 Ga0075366_10118596 Ga0075366_101185962 300
50 3300006195 Ga0075366_10165668 Ga0075366_101656681 300
51 3300009093 Ga0105240_10000200 Ga0105240_1000020090 300
52 3300009093 Ga0105240_10026169 Ga0105240_100261699 300
53 3300009093 Ga0105240_10422718 Ga0105240_104227181 300
54 3300009093 Ga0105240_10565176 Ga0105240_105651761 300
55 3300009174 Ga0105241_10029951 Ga0105241_100299514 300
56 3300009174 Ga0105241_10290310 Ga0105241_102903102 300
57 3300009545 Ga0105237_10000215 Ga0105237_1000021518 300
58 3300009545 Ga0105237_10003110 Ga0105237_1000311011 300
59 3300009545 Ga0105237_10089247 Ga0105237_100892472 300
60 3300009545 Ga0105237_10105084 Ga0105237_101050845 300
61 3300009545 Ga0105237_10209758 Ga0105237_102097582 300
62 3300009551 Ga0105238_10156121 Ga0105238_101561212 300
63 3300009551 Ga0105238_10298717 Ga0105238_102987172 300
64 3300009551 Ga0105238_10660075 Ga0105238_106600751 300
65 3300010375 Ga0105239_10000012 Ga0105239_1000001271 300
66 3300010375 Ga0105239_10000032 Ga0105239_10000032148 300
67 3300010375 Ga0105239_10000530 Ga0105239_100005307 300
68 3300010375 Ga0105239_10001525 Ga0105239_100015259 300
69 3300010375 Ga0105239_10002939 Ga0105239_1000293912 300
70 3300010375 Ga0105239_10005586 Ga0105239_1000558611 300
71 3300013104 Ga0157370_10001591 Ga0157370_1000159115 300
72 3300013297 Ga0157378_10021583 Ga0157378_100215833 300
73 3300013306 Ga0163162_10018113 Ga0163162_100181138 300
74 3300025208 Ga0209436_102379 Ga0209436_1023794 300
75 3300025233 Ga0209437_100043 Ga0209437_10004399 300
76 3300025292 Ga0209676_1000513 Ga0209676_100051347 300
77 3300025302 Ga0207426_1023940 Ga0207426_10239401 300
78 3300025304 Ga0209257_1000025 Ga0209257_1000025136 300
79 3300025911 Ga0207654_10141547 Ga0207654_101415472 300
80 3300025913 Ga0207695_10000055 Ga0207695_1000005591 300
81 3300025914 Ga0207671_10003149 Ga0207671_100031493 300
82 3300025914 Ga0207671_10003215 Ga0207671_100032153 300
83 3300025914 Ga0207671_10006673 Ga0207671_1000667312 300
84 3300025914 Ga0207671_10028517 Ga0207671_100285174 300
85 3300025914 Ga0207671_10030023 Ga0207671_100300233 300
86 3300025924 Ga0207694_10098870 Ga0207694_100988702 300
87 3300025937 Ga0207669_10120824 Ga0207669_101208242 300
88 3300025949 Ga0207667_10001302 Ga0207667_1000130215 300
89 3300031731 Ga0307405_10009486 Ga0307405_100094866 300
90 3300031911 Ga0307412_10058302 Ga0307412_100583022 300
91 3300046462 Ga0495651_0122979 Ga0495651_0122979_289_1191 300
92 3300046558 Ga0495633_0000002 Ga0495633_0000002_162111_163028 300
93 3300046660 Ga0495625_0000252 Ga0495625_0000252_25339_26244 300
94 3300046660 Ga0495625_0019373 Ga0495625_0019373_3484_4386 300
95 3300046691 Ga0495670_0115313 Ga0495670_0115313_28_930 300
96 3300047472 Ga0495686_0001492 Ga0495686_0001492_15277_16179 300
97 3300047472 Ga0495686_0001772 Ga0495686_0001772_7581_8483 300
98 3300048924 Ga0496121_0027345 Ga0496121_0027345_4218_5123 300
99 3300050493 nmdc:mga0k408_26_c4 nmdc:mga0k408_26_c4_4754_5659 300
100 3300053122 Ga0500608_005595 Ga0500608_005595_2534_3436 300
101 3300053125 Ga0500618_000245 Ga0500618_000245_10124_11029 300
102 3300053138 Ga0500564_038520 Ga0500564_038520_1067_1972 300
103 3300053158 Ga0500627_0100482 Ga0500627_0100482_217_1119 300
104 3300053730 Ga0500645_002622 Ga0500645_002622_3896_4807 300
105 3300003320 rootH2_10051807 rootH2_100518075 301
106 3300005563 Ga0068855_100036459 Ga0068855_1000364596 301
107 3300006237 Ga0097621_100339727 Ga0097621_1003397272 301
108 3300009093 Ga0105240_10041124 Ga0105240_100411246 301
109 3300009545 Ga0105237_10001314 Ga0105237_1000131423 301
110 3300010375 Ga0105239_10000084 Ga0105239_1000008431 301
111 3300013104 Ga0157370_10007875 Ga0157370_100078759 301
112 3300013296 Ga0157374_10000024 Ga0157374_1000002482 301
113 3300014969 Ga0157376_10012683 Ga0157376_100126835 301
114 3300025230 Ga0209563_106632 Ga0209563_1066322 301
115 3300025914 Ga0207671_10007791 Ga0207671_100077914 301
116 3300025949 Ga0207667_10157443 Ga0207667_101574432 301
117 3300046507 Ga0495606_0002671 Ga0495606_0002671_4447_5361 301
118 3300046665 Ga0495661_0001065 Ga0495661_0001065_10978_11883 301
119 3300046694 Ga0495649_0011752 Ga0495649_0011752_1046_1954 301
120 3300050493 nmdc:mga0k408_166543_c1 nmdc:mga0k408_166543_c1_217_1176 301
121 3300050493 nmdc:mga0k408_53_c1 nmdc:mga0k408_53_c1_9980_10939 301
122 3300053092 Ga0500583_0000680 Ga0500583_0000680_6260_7165 301
123 3300003322 rootL2_10246913 rootL2_102469134 302
124 3300013104 Ga0157370_10000099 Ga0157370_1000009983 302
125 3300013306 Ga0163162_10024844 Ga0163162_100248443 302
126 3300032004 Ga0307414_10001213 Ga0307414_100012133 302
127 3300048921 Ga0496118_0085610 Ga0496118_0085610_950_1867 302
128 3300001989 JGI24739J22299_10002512 JGI24739J22299_100025121 303
129 3300003322 rootL2_10136204 rootL2_101362044 303
130 3300003323 rootH1_10233464 rootH1_102334641 303
131 3300003354 JGI25160J50197_1002881 JGI25160J50197_10028815 303
132 3300003771 Ga0055526_1020921 Ga0055526_10209212 303
133 3300003790 Ga0055528_1000232 Ga0055528_100023224 303
134 3300003794 Ga0055531_10029982 Ga0055531_100299822 303
135 3300005262 Ga0065165_1000010 Ga0065165_100001087 303
136 3300005338 Ga0068868_100180852 Ga0068868_1001808521 303
137 3300005539 Ga0068853_100021708 Ga0068853_1000217086 303
138 3300005539 Ga0068853_100584126 Ga0068853_1005841261 303
139 3300005563 Ga0068855_100167728 Ga0068855_1001677283 303
140 3300005614 Ga0068856_100033532 Ga0068856_1000335326 303
141 3300005616 Ga0068852_100249754 Ga0068852_1002497542 303
142 3300009093 Ga0105240_10000008 Ga0105240_1000000815 303
143 3300009093 Ga0105240_10000326 Ga0105240_1000032617 303
144 3300009093 Ga0105240_10001435 Ga0105240_1000143530 303
145 3300009093 Ga0105240_10003182 Ga0105240_100031827 303
146 3300009545 Ga0105237_10005461 Ga0105237_1000546111 303
147 3300009545 Ga0105237_10022990 Ga0105237_100229905 303
148 3300009545 Ga0105237_10043542 Ga0105237_100435424 303
149 3300009545 Ga0105237_10067858 Ga0105237_100678583 303
150 3300009545 Ga0105237_10266831 Ga0105237_102668312 303
151 3300009545 Ga0105237_10366879 Ga0105237_103668792 303
152 3300009551 Ga0105238_10050060 Ga0105238_100500605 303
153 3300009551 Ga0105238_10061749 Ga0105238_100617493 303
154 3300010375 Ga0105239_10005275 Ga0105239_1000527513 303
155 3300025246 Ga0209646_1000752 Ga0209646_10007527 303
156 3300025273 Ga0209673_1000082 Ga0209673_100008262 303
157 3300025295 Ga0209564_1000938 Ga0209564_100093821 303
158 3300025295 Ga0209564_1001267 Ga0209564_10012674 303
159 3300025297 Ga0209758_1004606 Ga0209758_10046069 303
160 3300025297 Ga0209758_1014420 Ga0209758_10144203 303
161 3300025302 Ga0207426_1000763 Ga0207426_100076330 303
162 3300025302 Ga0207426_1007946 Ga0207426_10079463 303
163 3300025304 Ga0209257_1003849 Ga0209257_10038491 303
164 3300025913 Ga0207695_10000021 Ga0207695_10000021388 303
165 3300025913 Ga0207695_10000039 Ga0207695_10000039116 303
166 3300025913 Ga0207695_10005223 Ga0207695_1000522319 303
167 3300025913 Ga0207695_10006599 Ga0207695_100065993 303
168 3300025913 Ga0207695_10022243 Ga0207695_100222437 303
169 3300025914 Ga0207671_10010389 Ga0207671_100103896 303
170 3300025914 Ga0207671_10049505 Ga0207671_100495053 303
171 3300025924 Ga0207694_10186276 Ga0207694_101862762 303
172 3300026041 Ga0207639_10005833 Ga0207639_100058332 303
173 3300026041 Ga0207639_10275951 Ga0207639_102759511 303
174 3300026078 Ga0207702_10024601 Ga0207702_100246015 303
175 3300026142 Ga0207698_10120665 Ga0207698_101206652 303
176 3300028786 Ga0307517_10017673 Ga0307517_100176734 303
177 3300030521 Ga0307511_10000502 Ga0307511_1000050212 303
178 3300031730 Ga0307516_10000579 Ga0307516_1000057915 303
179 3300031730 Ga0307516_10070115 Ga0307516_100701152 303
180 3300032004 Ga0307414_10060925 Ga0307414_100609252 303
181 3300037418 Ga0395900_0010421 Ga0395900_0010421_1426_2349 303
182 3300037471 Ga0395905_0001686 Ga0395905_0001686_23457_24380 303
183 3300038443 Ga0395901_0001030 Ga0395901_0001030_29037_29960 303
184 3300041406 Ga0439439_0007926 Ga0439439_0007926_749_1660 303
185 3300044658 Ga0466972_0000078 Ga0466972_0000078_73747_74658 303
186 3300044706 Ga0466964_0098680 Ga0466964_0098680_239_1150 303
187 3300044842 Ga0466957_0006040 Ga0466957_0006040_1067_1978 303
188 3300046513 Ga0495616_0004040 Ga0495616_0004040_2487_3434 303
189 3300046648 Ga0495611_0000050 Ga0495611_0000050_40853_41770 303
190 3300046660 Ga0495625_0037691 Ga0495625_0037691_2355_3302 303
191 3300047472 Ga0495686_0000066 Ga0495686_0000066_124306_125220 303
192 3300049459 Ga0495678_024227 Ga0495678_024227_288_1235 303
193 3300053151 Ga0500604_0019561 Ga0500604_0019561_508_1482 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

243

322

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

283

321

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5chh-assembly1.cif.gz_A crystal structure of transcriptional regulator cdpr from pseudomonas aeruginosa 0.9271 218 300
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9113 193 300
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.894 194 301
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.89 195 303
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8782 194 301
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9644 256 301 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9528 254 302 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9487 254 300 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9387 256 301 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9266 256 301 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I4TB30-F1-model_v4 Helix-turn-helix domain-containing protein 0.9489 193 303 GO:0003700
GO:0043565
AF-A0A5B9QIN2-F1-model_v4 Xylose operon regulatory protein 0.9353 195 302 GO:0000976
GO:0003700
AF-A0A497RNU0-F1-model_v4 Transcriptional regulator 0.9353 199 302 GO:0000976
GO:0003700
AF-A0A3A8WRE6-F1-model_v4 AraC family transcriptional regulator 0.9325 190 300 GO:0003700
GO:0043565
AF-A0A5C6FXA1-F1-model_v4 Xylose operon regulatory protein 0.9322 195 302 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.53 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map