F297646

General Info

Members Datasets Scaffolds Average Seq Length
193 157 159 419

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0119263|Ga0495634_0119263_208_1533
Length 441
Sequence MKSRQDMAPSMSLWRDRRFVRFWAGQSVSQFGDRISELALPLIAVAALHASASQVAWLSALAWAPNLLAIVLGAWVDHRVHKRRLMVLADLMRACVLVTLPAAYLLGTVTLLQLYAVALLTGAAAVLFNTAYPPFFAHLVPRSSYVDANSKLSASRSASYVVGPAVGGALVQVLTAPVAVIADALSFLASAALLGPIRVDEPAIAAYETAGPSLLRRAREGLVFVVRHPVLRASLGCATTLNFFTFVSSTGLTVLFADRVLGLSAGTIGLAFGIGSTGALVGAVIAPKISRWIGVGRSIAAGAVLFPAPIAIAATASGPTWARAGALGVAEFLAGIGVMLFDVNLNSLQAAVIPDGMRSRVAGAYSTVNYGIRPIGAIVGGMLATLFGLRTTLITAAVGGTLSLLWLLPSPIPRIRSLAPDDPLATDGGTGQTADRYLNDT

Samples

Sample ID Description Type Environment
1 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
5 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
6 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
9 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
10 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
11 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
12 2858882152 Micromonospora noduli MED15 Isolate Nodule
13 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
14 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
17 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
18 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
19 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
20 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
21 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
22 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
23 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
24 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
25 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
26 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
27 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
152 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
153 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
154 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
155 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
156 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
157 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.38
Metatranscriptomes 0
Isolates 17.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 2.59
Rhizoplane 2.59
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 18.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013251 3300001989 Bacteria 3013
2 rootH1_10035634 3300003316 Bacteria 3782
3 rootH1_10036032 3300003323 Bacteria 4985
4 rootH1_10085149 3300003323 Bacteria 3993
5 Ga0070670_100248300 3300005331 Bacteria 1550
6 Ga0070660_100104228 3300005339 Bacteria 2250
7 Ga0070675_100200691 3300005354 Bacteria 1731
8 Ga0070714_100028839 3300005435 Bacteria 4609
9 Ga0070663_100246406 3300005455 Bacteria 1413
10 Ga0070678_100133141 3300005456 Bacteria 1978
11 Ga0070665_100001091 3300005548 Bacteria 33648
12 Ga0070665_100084623 3300005548 Bacteria 3177
13 Ga0068855_100068525 3300005563 Bacteria 4131
14 Ga0068857_100151685 3300005577 Bacteria 2100
15 Ga0068854_100007120 3300005578 Bacteria 7141
16 Ga0068856_100071439 3300005614 Bacteria 3436
17 Ga0068852_100001356 3300005616 Bacteria 16430
18 Ga0068852_100258271 3300005616 Bacteria 1672
19 Ga0068852_100285978 3300005616 Bacteria 1591
20 Ga0075365_10080680 3300006038 Bacteria 2203
21 Ga0075365_10091212 3300006038 Bacteria 2076
22 Ga0075362_10058084 3300006177 Bacteria 1744
23 Ga0075434_100025760 3300006871 Bacteria 5757
24 Ga0068865_100154312 3300006881 Bacteria 1745
25 Ga0068865_100214918 3300006881 Bacteria 1500
26 Ga0075435_100053908 3300007076 Bacteria 3245
27 Ga0105245_10137603 3300009098 Bacteria 2297
28 Ga0114129_10149749 3300009147 Bacteria 3194
29 Ga0105243_10040154 3300009148 Bacteria 3652
30 Ga0105241_10024297 3300009174 Bacteria 4500
31 Ga0157369_10109707 3300013105 Bacteria 2934
32 Ga0157372_10000004 3300013307 Bacteria 435659
33 Ga0157372_10061959 3300013307 Bacteria 4190
34 Ga0157375_10018651 3300013308 Bacteria 6296
35 Ga0157380_10012197 3300014326 Bacteria 6226
36 Ga0183367_1001 3300015688 Bacteria 1225545
37 Ga0207654_10026460 3300025911 Bacteria 3141
38 Ga0207695_10039000 3300025913 Bacteria 5108
39 Ga0207671_10004401 3300025914 Bacteria 13499
40 Ga0207649_10015577 3300025920 Bacteria 4271
41 Ga0207652_10246012 3300025921 Bacteria 1613
42 Ga0207650_10111229 3300025925 Bacteria 2121
43 Ga0207664_10023426 3300025929 Bacteria 4626
44 Ga0207686_10056586 3300025934 Bacteria 2466
45 Ga0207704_10119226 3300025938 Bacteria 1801
46 Ga0207704_10155532 3300025938 Bacteria 1620
47 Ga0207667_10056374 3300025949 Bacteria 4128
48 Ga0207678_10022206 3300026067 Bacteria 5560
49 Ga0207648_10249665 3300026089 Bacteria 1582
50 Ga0207674_10177077 3300026116 Bacteria 2085
51 Ga0207683_10098484 3300026121 Bacteria 2609
52 Ga0207698_10004476 3300026142 Bacteria 8524
53 Ga0207698_10034405 3300026142 Bacteria 3693
54 Ga0209974_10009482 3300027876 Bacteria 3305
55 Ga0268266_10064024 3300028379 Bacteria 3176
56 Ga0307515_10000501 3300028794 Bacteria 93663
57 Ga0307511_10000220 3300030521 Bacteria 57569
58 Ga0307509_10003119 3300031507 Bacteria 25717
59 Ga0307509_10011911 3300031507 Bacteria 10453
60 Ga0307508_10201973 3300031616 Bacteria 1588
61 Ga0307516_10051804 3300031730 Bacteria 4021
62 Ga0307507_10005212 3300033179 Bacteria 21681
63 Ga0307507_10061720 3300033179 Bacteria 3488
64 Ga0307510_10057002 3300033180 Bacteria 4060
65 Ga0307510_10071295 3300033180 Bacteria 3461
66 Ga0395898_0052120 3300037466 Bacteria 3998
67 Ga0395905_0110945 3300037471 Bacteria 2576
68 Ga0395901_0178426 3300038443 Bacteria 2227
69 Ga0436365_0354631 3300039437 Bacteria 3426
70 Ga0466965_0008912 3300044683 Bacteria 4651
71 Ga0466963_0264550 3300044694 Bacteria 1208
72 Ga0466967_0064470 3300045976 Bacteria 3258
73 Ga0466967_0081684 3300045976 Bacteria 2920
74 Ga0495592_0015536 3300046454 Bacteria 5776
75 Ga0495603_0106926 3300046455 Bacteria 1633
76 Ga0495629_0006329 3300046459 Bacteria 8781
77 Ga0495629_0011067 3300046459 Bacteria 6555
78 Ga0495629_0042472 3300046459 Bacteria 3194
79 Ga0495651_0005327 3300046462 Bacteria 9814
80 Ga0495651_0015302 3300046462 Bacteria 5930
81 Ga0495651_0077551 3300046462 Bacteria 2515
82 Ga0495582_0023168 3300046473 Bacteria 3396
83 Ga0495662_0001041 3300046476 Bacteria 13618
84 Ga0495662_0002542 3300046476 Bacteria 9209
85 Ga0495662_0072837 3300046476 Bacteria 1666
86 Ga0495664_0013945 3300046477 Bacteria 4554
87 Ga0495585_0039254 3300046492 Bacteria 2662
88 Ga0495628_0048488 3300046516 Bacteria 3367
89 Ga0495630_0087293 3300046517 Bacteria 2356
90 Ga0495652_0003754 3300046529 Bacteria 14863
91 Ga0495652_0190327 3300046529 Bacteria 1566
92 Ga0495586_0017237 3300046535 Bacteria 3839
93 Ga0495645_0016076 3300046543 Bacteria 5336
94 Ga0495634_0044647 3300046642 Bacteria 2998
95 Ga0495634_0119263 3300046642 Bacteria 1690
96 Ga0495625_0005261 3300046660 Bacteria 11889
97 Ga0495635_0019876 3300046663 Bacteria 4679
98 Ga0495588_0040367 3300046674 Bacteria 2380
99 Ga0495657_0000819 3300046675 Bacteria 27569
100 Ga0495657_0007178 3300046675 Bacteria 8642
101 Ga0495657_0078551 3300046675 Bacteria 2139
102 Ga0495623_0037480 3300046679 Bacteria 3102
103 Ga0495646_0007499 3300046680 Bacteria 6931
104 Ga0495658_0094846 3300046683 Bacteria 1772
105 Ga0495613_0000711 3300046689 Bacteria 26036
106 Ga0495613_0003950 3300046689 Bacteria 11103
107 Ga0495613_0075924 3300046689 Bacteria 2446
108 Ga0495600_0014188 3300046809 Bacteria 5019
109 Ga0495581_0013037 3300047315 Bacteria 4818
110 Ga0495581_0071732 3300047315 Bacteria 2004
111 Ga0495604_0005925 3300047317 Bacteria 9693
112 Ga0495604_0014331 3300047317 Bacteria 6323
113 Ga0495674_0010621 3300047319 Bacteria 8711
114 Ga0495676_0006846 3300047321 Bacteria 10475
115 Ga0495676_0043916 3300047321 Bacteria 3653
116 Ga0495680_0032543 3300047322 Bacteria 4231
117 Ga0495687_004735 3300047443 Bacteria 9008
118 Ga0495675_0072097 3300047444 Bacteria 2179
119 Ga0495681_0007962 3300047470 Bacteria 6692
120 Ga0495684_0084478 3300047471 Bacteria 2408
121 Ga0495593_0000583 3300047673 Bacteria 20771
122 Ga0495602_0002426 3300048088 Bacteria 18977
123 Ga0495614_0003445 3300048089 Bacteria 7081
124 Ga0495614_0020101 3300048089 Bacteria 2889
125 Ga0495614_0059447 3300048089 Bacteria 1641
126 Ga0496109_0075775 3300048912 Bacteria 3093
127 Ga0496110_0071669 3300048913 Bacteria 3073
128 Ga0496114_0045046 3300048917 Bacteria 3663
129 Ga0496114_0071372 3300048917 Bacteria 2918
130 Ga0496114_0133282 3300048917 Bacteria 2147
131 Ga0501031_0138153 3300049568 Bacteria 1592
132 Ga0501032_0014157 3300049569 Bacteria 5654
133 Ga0501033_0013313 3300049570 Bacteria 6268
134 Ga0501034_0024422 3300049571 Bacteria 6149
135 Ga0501036_0004637 3300049572 Bacteria 11112
136 Ga0501036_0144469 3300049572 Bacteria 2007
137 Ga0501038_0023897 3300049574 Bacteria 5458
138 Ga0501069_0032896 3300049585 Bacteria 2855
139 Ga0501070_0004558 3300049586 Bacteria 11883
140 Ga0501073_0121131 3300049589 Bacteria 1813
141 Ga0501074_0055022 3300049590 Bacteria 2869
142 Ga0501076_0157515 3300049592 Unclassified 1849
143 Ga0501080_0153141 3300049742 Bacteria 2130
144 Ga0501080_0259460 3300049742 Bacteria 1584
145 Ga0501035_0142969 3300049822 Bacteria 2079
146 Ga0501044_0048296 3300049823 Bacteria 4397
147 Ga0501044_0067679 3300049823 Bacteria 3638
148 Ga0501044_0069618 3300049823 Bacteria 3581
149 Ga0501045_0203731 3300049824 Bacteria 1474
150 nmdc:mga0yw44_105744_c1 3300050492 Bacteria 1798
151 nmdc:mga06r32_183881_c1 3300050510 Bacteria 2076
152 nmdc:mga0n895_999_c1 3300050512 Bacteria 20523
153 nmdc:mga0rr50_3120_c1 3300050513 Bacteria 9472
154 Ga0495619_0071031 3300053085 Bacteria 2329
155 Ga0500644_0001209 3300053088 Bacteria 7272
156 Ga0500640_000471 3300053095 Bacteria 9913
157 Ga0500573_0013206 3300053140 Bacteria 4650
158 Ga0501082_0168804 3300060353 Bacteria 1902
159 Ga0466962_0121457 3300061719 Bacteria 1261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048089 Ga0495614_0059447 Ga0495614_0059447_584_1630 332
2 3300046517 Ga0495630_0087293 Ga0495630_0087293_28_1077 336
3 3300053085 Ga0495619_0071031 Ga0495619_0071031_31_1080 336
4 3300061719 Ga0466962_0121457 Ga0466962_0121457_22_1095 353
5 3300005339 Ga0070660_100104228 Ga0070660_1001042282 356
6 3300025921 Ga0207652_10246012 Ga0207652_102460122 358
7 3300005616 Ga0068852_100285978 Ga0068852_1002859782 374
8 3300006881 Ga0068865_100154312 Ga0068865_1001543121 374
9 3300013308 Ga0157375_10018651 Ga0157375_100186513 374
10 3300049822 Ga0501035_0142969 Ga0501035_0142969_686_1897 374
11 3300033180 Ga0307510_10071295 Ga0307510_100712953 380
12 3300003316 rootH1_10035634 rootH1_100356343 381
13 3300044694 Ga0466963_0264550 Ga0466963_0264550_14_1171 381
14 3300049590 Ga0501074_0055022 Ga0501074_0055022_238_1482 382
15 3300049742 Ga0501080_0259460 Ga0501080_0259460_208_1452 382
16 3300049585 Ga0501069_0032896 Ga0501069_0032896_1419_2657 383
17 3300049823 Ga0501044_0067679 Ga0501044_0067679_1780_3024 383
18 3300046462 Ga0495651_0015302 Ga0495651_0015302_1020_2348 388
19 3300046476 Ga0495662_0072837 Ga0495662_0072837_261_1577 388
20 3300046516 Ga0495628_0048488 Ga0495628_0048488_1731_3059 388
21 3300046529 Ga0495652_0003754 Ga0495652_0003754_7750_9078 388
22 3300006038 Ga0075365_10091212 Ga0075365_100912122 390
23 3300050492 nmdc:mga0yw44_105744_c1 nmdc:mga0yw44_105744_c1_199_1437 390
24 3300049572 Ga0501036_0144469 Ga0501036_0144469_437_1702 392
25 3300049589 Ga0501073_0121131 Ga0501073_0121131_353_1618 392
26 3300049742 Ga0501080_0153141 Ga0501080_0153141_551_1816 392
27 3300049823 Ga0501044_0048296 Ga0501044_0048296_2155_3420 392
28 3300049824 Ga0501045_0203731 Ga0501045_0203731_74_1339 392
29 3300050510 nmdc:mga06r32_183881_c1 nmdc:mga06r32_183881_c1_730_1959 394
30 3300048913 Ga0496110_0071669 Ga0496110_0071669_907_2178 398
31 3300048917 Ga0496114_0071372 Ga0496114_0071372_497_1768 398
32 3300006038 Ga0075365_10080680 Ga0075365_100806803 400
33 3300025913 Ga0207695_10039000 Ga0207695_100390003 401
34 3300045976 Ga0466967_0064470 Ga0466967_0064470_926_2167 404
35 3300025938 Ga0207704_10119226 Ga0207704_101192262 405
36 3300003323 rootH1_10036032 rootH1_100360323 406
37 3300015688 Ga0183367_1001 Ga0183367_1001330 406
38 3300026142 Ga0207698_10034405 Ga0207698_100344053 406
39 iso_pu_bacteria 2884693830 2884698725 406
40 iso_pu_bacteria 2895442618 2895451307 406
41 3300003323 rootH1_10085149 rootH1_100851494 408
42 3300005548 Ga0070665_100001091 Ga0070665_1000010914 408
43 3300005563 Ga0068855_100068525 Ga0068855_1000685253 408
44 3300005614 Ga0068856_100071439 Ga0068856_1000714393 408
45 3300005616 Ga0068852_100001356 Ga0068852_10000135611 408
46 3300006177 Ga0075362_10058084 Ga0075362_100580842 408
47 3300009174 Ga0105241_10024297 Ga0105241_100242972 408
48 3300013105 Ga0157369_10109707 Ga0157369_101097072 408
49 3300013307 Ga0157372_10061959 Ga0157372_100619593 408
50 3300025911 Ga0207654_10026460 Ga0207654_100264602 408
51 3300025920 Ga0207649_10015577 Ga0207649_100155772 408
52 3300025949 Ga0207667_10056374 Ga0207667_100563742 408
53 3300026142 Ga0207698_10004476 Ga0207698_100044762 408
54 3300038443 Ga0395901_0178426 Ga0395901_0178426_867_2135 408
55 3300005435 Ga0070714_100028839 Ga0070714_1000288394 409
56 3300005578 Ga0068854_100007120 Ga0068854_1000071207 409
57 3300025914 Ga0207671_10004401 Ga0207671_1000440113 409
58 3300025929 Ga0207664_10023426 Ga0207664_100234264 409
59 3300045976 Ga0466967_0081684 Ga0466967_0081684_1160_2437 409
60 3300053140 Ga0500573_0013206 Ga0500573_0013206_3127_4410 409
61 iso_pu_bacteria 2784746768 2785372385 409
62 3300009098 Ga0105245_10137603 Ga0105245_101376032 410
63 3300009148 Ga0105243_10040154 Ga0105243_100401544 410
64 3300046492 Ga0495585_0039254 Ga0495585_0039254_725_1984 410
65 iso_pu_bacteria 2643221567 2643853318 410
66 iso_pu_bacteria 2643221624 2644137278 410
67 iso_pu_bacteria 2883821847 2883824996 410
68 3300005354 Ga0070675_100200691 Ga0070675_1002006912 411
69 3300005455 Ga0070663_100246406 Ga0070663_1002464061 411
70 3300005456 Ga0070678_100133141 Ga0070678_1001331412 411
71 3300005548 Ga0070665_100084623 Ga0070665_1000846232 411
72 3300005616 Ga0068852_100258271 Ga0068852_1002582712 411
73 3300006881 Ga0068865_100214918 Ga0068865_1002149182 411
74 3300025934 Ga0207686_10056586 Ga0207686_100565862 411
75 3300025938 Ga0207704_10155532 Ga0207704_101555321 411
76 3300026067 Ga0207678_10022206 Ga0207678_100222064 411
77 3300026089 Ga0207648_10249665 Ga0207648_102496652 411
78 3300026121 Ga0207683_10098484 Ga0207683_100984842 411
79 3300028379 Ga0268266_10064024 Ga0268266_100640243 411
80 3300046455 Ga0495603_0106926 Ga0495603_0106926_326_1600 411
81 3300048917 Ga0496114_0133282 Ga0496114_0133282_186_1460 411
82 iso_pu_bacteria 8054727385 8054727775 411
83 3300039437 Ga0436365_0354631 Ga0436365_0354631_1612_2907 412
84 3300053088 Ga0500644_0001209 Ga0500644_0001209_2375_3667 412
85 iso_pu_bacteria 2855670206 2855673165 412
86 iso_pu_bacteria 2855676851 2855681739 412
87 iso_pu_bacteria 2857288857 2857293643 412
88 iso_pu_bacteria 2858848962 2858851183 412
89 iso_pu_bacteria 2858882152 2858887703 412
90 iso_pu_bacteria 2858888857 2858893537 412
91 iso_pu_bacteria 2858895516 2858896929 412
92 iso_pu_bacteria 2869048445 2869052601 412
93 iso_pu_bacteria 2869061728 2869065933 412
94 iso_pu_bacteria 2869068681 2869069028 412
95 iso_pu_bacteria 2929226422 2929229086 412
96 iso_pu_bacteria 8054734606 8054736702 412
97 3300028794 Ga0307515_10000501 Ga0307515_1000050152 413
98 3300033179 Ga0307507_10061720 Ga0307507_100617202 413
99 3300046459 Ga0495629_0011067 Ga0495629_0011067_4465_5775 413
100 3300046660 Ga0495625_0005261 Ga0495625_0005261_7848_9152 413
101 3300047470 Ga0495681_0007962 Ga0495681_0007962_3731_5035 413
102 iso_pu_bacteria 2880489317 2880491736 413
103 iso_pu_bacteria 8054704163 8054709319 413
104 3300044683 Ga0466965_0008912 Ga0466965_0008912_57_1313 414
105 iso_pu_bacteria 2880495981 2880500593 414
106 iso_pu_bacteria 2929219909 2929222776 414
107 iso_pu_bacteria 8003830390 8003832662 414
108 iso_pu_bacteria 8003870546 8003874633 414
109 iso_pu_bacteria 8055172936 8055176311 414
110 3300031507 Ga0307509_10011911 Ga0307509_1001191110 415
111 3300048917 Ga0496114_0045046 Ga0496114_0045046_2124_3383 415
112 iso_pu_bacteria 2772190715 2772645575 415
113 3300006871 Ga0075434_100025760 Ga0075434_1000257606 417
114 3300007076 Ga0075435_100053908 Ga0075435_1000539083 417
115 3300031616 Ga0307508_10201973 Ga0307508_102019732 417
116 3300033179 Ga0307507_10005212 Ga0307507_1000521214 417
117 3300046454 Ga0495592_0015536 Ga0495592_0015536_1291_2598 417
118 3300046459 Ga0495629_0042472 Ga0495629_0042472_173_1480 417
119 3300046462 Ga0495651_0005327 Ga0495651_0005327_465_1772 417
120 3300046473 Ga0495582_0023168 Ga0495582_0023168_433_1740 417
121 3300046476 Ga0495662_0001041 Ga0495662_0001041_6934_8241 417
122 3300046477 Ga0495664_0013945 Ga0495664_0013945_733_2040 417
123 3300046529 Ga0495652_0190327 Ga0495652_0190327_142_1449 417
124 3300046535 Ga0495586_0017237 Ga0495586_0017237_1995_3302 417
125 3300046543 Ga0495645_0016076 Ga0495645_0016076_3301_4608 417
126 3300046642 Ga0495634_0044647 Ga0495634_0044647_1668_2975 417
127 3300046663 Ga0495635_0019876 Ga0495635_0019876_731_2038 417
128 3300046674 Ga0495588_0040367 Ga0495588_0040367_253_1560 417
129 3300046675 Ga0495657_0000819 Ga0495657_0000819_583_1890 417
130 3300046680 Ga0495646_0007499 Ga0495646_0007499_3343_4650 417
131 3300046683 Ga0495658_0094846 Ga0495658_0094846_406_1713 417
132 3300046689 Ga0495613_0003950 Ga0495613_0003950_7386_8693 417
133 3300046809 Ga0495600_0014188 Ga0495600_0014188_3248_4555 417
134 3300047315 Ga0495581_0013037 Ga0495581_0013037_2734_4041 417
135 3300047317 Ga0495604_0005925 Ga0495604_0005925_6719_8026 417
136 3300047319 Ga0495674_0010621 Ga0495674_0010621_2642_3949 417
137 3300047321 Ga0495676_0006846 Ga0495676_0006846_6936_8243 417
138 3300047444 Ga0495675_0072097 Ga0495675_0072097_728_2035 417
139 3300047471 Ga0495684_0084478 Ga0495684_0084478_1018_2325 417
140 3300047673 Ga0495593_0000583 Ga0495593_0000583_18610_19917 417
141 3300048088 Ga0495602_0002426 Ga0495602_0002426_4450_5757 417
142 3300048089 Ga0495614_0003445 Ga0495614_0003445_231_1538 417
143 3300049592 Ga0501076_0157515 Ga0501076_0157515_435_1838 417
144 3300050512 nmdc:mga0n895_999_c1 nmdc:mga0n895_999_c1_1062_2315 417
145 3300050513 nmdc:mga0rr50_3120_c1 nmdc:mga0rr50_3120_c1_785_2038 417
146 3300053095 Ga0500640_000471 Ga0500640_000471_6773_8080 417
147 iso_pu_bacteria 2616644814 2616700939 417
148 iso_pu_bacteria 2816332119 2816425420 417
149 iso_pu_bacteria 2862507626 2862516666 417
150 iso_pu_bacteria 2919446982 2919447039 417
151 iso_pu_bacteria 8055066027 8055067043 417
152 3300001989 JGI24739J22299_10013251 JGI24739J22299_100132513 418
153 3300005331 Ga0070670_100248300 Ga0070670_1002483002 418
154 3300005577 Ga0068857_100151685 Ga0068857_1001516852 418
155 3300009147 Ga0114129_10149749 Ga0114129_101497493 418
156 3300013307 Ga0157372_10000004 Ga0157372_10000004313 418
157 3300014326 Ga0157380_10012197 Ga0157380_100121975 418
158 3300025925 Ga0207650_10111229 Ga0207650_101112291 418
159 3300026116 Ga0207674_10177077 Ga0207674_101770772 418
160 3300027876 Ga0209974_10009482 Ga0209974_100094822 418
161 3300030521 Ga0307511_10000220 Ga0307511_1000022047 418
162 3300031507 Ga0307509_10003119 Ga0307509_100031198 418
163 3300031730 Ga0307516_10051804 Ga0307516_100518044 418
164 3300033180 Ga0307510_10057002 Ga0307510_100570022 418
165 3300037466 Ga0395898_0052120 Ga0395898_0052120_1078_2385 418
166 3300037471 Ga0395905_0110945 Ga0395905_0110945_1077_2411 418
167 3300046459 Ga0495629_0006329 Ga0495629_0006329_3697_4995 418
168 3300046462 Ga0495651_0077551 Ga0495651_0077551_615_1928 418
169 3300046476 Ga0495662_0002542 Ga0495662_0002542_1685_2983 418
170 3300046642 Ga0495634_0119263 Ga0495634_0119263_208_1533 418
171 3300046675 Ga0495657_0007178 Ga0495657_0007178_6287_7600 418
172 3300046675 Ga0495657_0078551 Ga0495657_0078551_513_1838 418
173 3300046679 Ga0495623_0037480 Ga0495623_0037480_1106_2428 418
174 3300046689 Ga0495613_0000711 Ga0495613_0000711_8505_9818 418
175 3300046689 Ga0495613_0075924 Ga0495613_0075924_827_2152 418
176 3300047315 Ga0495581_0071732 Ga0495581_0071732_400_1725 418
177 3300047317 Ga0495604_0014331 Ga0495604_0014331_2078_3400 418
178 3300047321 Ga0495676_0043916 Ga0495676_0043916_395_1720 418
179 3300047322 Ga0495680_0032543 Ga0495680_0032543_469_1782 418
180 3300047443 Ga0495687_004735 Ga0495687_004735_5698_7005 418
181 3300048089 Ga0495614_0020101 Ga0495614_0020101_200_1525 418
182 3300048912 Ga0496109_0075775 Ga0496109_0075775_78_1370 418
183 3300049568 Ga0501031_0138153 Ga0501031_0138153_33_1355 418
184 3300049569 Ga0501032_0014157 Ga0501032_0014157_943_2265 418
185 3300049570 Ga0501033_0013313 Ga0501033_0013313_742_2064 418
186 3300049571 Ga0501034_0024422 Ga0501034_0024422_1404_2726 418
187 3300049572 Ga0501036_0004637 Ga0501036_0004637_8085_9407 418
188 3300049574 Ga0501038_0023897 Ga0501038_0023897_2146_3468 418
189 3300049586 Ga0501070_0004558 Ga0501070_0004558_254_1576 418
190 3300049823 Ga0501044_0069618 Ga0501044_0069618_1861_3183 418
191 3300060353 Ga0501082_0168804 Ga0501082_0168804_349_1650 418
192 iso_pu_bacteria 2808606365 2808874742 418
193 iso_pu_bacteria 2862281513 2862283692 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

8

427

0.87

PF07690

MFS_1

Major Facilitator Superfamily

22

377

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8615 9 399
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8424 8 405
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8345 8 405
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8305 9 399
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.83 8 405
ID Description Score Start End Superfamily
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9132 8 205 1.20.1250.20
af_F4I5Q2_87_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8996 18 194 1.20.1250.20
af_Q9W509_423_624_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8986 13 193 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.896 8 205 1.20.1250.20
af_P9WJX9_6_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.891 15 196 1.20.1250.20
ID Description Score Start End GO Terms
AF-U5WF21-F1-model_v4 Major facilitator superfamily protein 0.9724 14 410 GO:0005886
GO:0022857
AF-A0A495JL88-F1-model_v4 MFS transporter 0.9711 15 411 GO:0005886
GO:0022857
AF-A0A521S1T6-F1-model_v4 MFS transporter 0.9703 14 417 GO:0005886
GO:0022857
AF-A0A7V9CSY7-F1-model_v4 MFS transporter 0.97 1 412 GO:0005886
GO:0022857
AF-A0A7Z0DQ01-F1-model_v4 Putative MFS family arabinose efflux permease 0.9672 6 407 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.43 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map