F297570

General Info

Members Datasets Scaffolds Average Seq Length
193 114 386 257

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0413469|Ga0466959_0413469_36_893
Length 285
Sequence MPGRGAQAVGPFMNRTVGWPTILRMTKINGQAAGNFVWLELATTDQEAAKHFYGEMFGWTAQDFPMGPESAYTMFSLNGSLTGAAFTLSEPERASGLRPHWQLYIAVEDADATAERAKELGASVVHAPFDVMNFGRMAVFQDPTGAFFSVWQARDHKGIGVYGENGALCWADLMTRDRAKATEFYHGLFGWEFTAGKGKDAGGYLHIMNGDHGIGGLPDPQSLPQGVPPHWMAYIQSPDCKAQTAQAEQLGGRVLMPAMTIEGQLTFSVVTDPQGAVFALFTPGH

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
111 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.7
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 13.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0413469 3300045049 Unclassified 916
2 Ga0070659_100621828 3300005366 Bacteria 929
3 Ga0070709_10039919 3300005434 Bacteria 2883
4 Ga0070709_10335853 3300005434 Unclassified 1113
5 Ga0070709_10528674 3300005434 Bacteria 900
6 Ga0070714_100091133 3300005435 Bacteria 2671
7 Ga0070714_100178169 3300005435 Bacteria 1933
8 Ga0070714_100287028 3300005435 Bacteria 1530
9 Ga0070714_100393267 3300005435 Bacteria 1309
10 Ga0070713_100200124 3300005436 Bacteria 1803
11 Ga0070711_100316427 3300005439 Bacteria 1246
12 Ga0070705_100003560 3300005440 Bacteria 7628
13 Ga0070705_100038690 3300005440 Bacteria 2701
14 Ga0070708_100000001 3300005445 Bacteria 245117
15 Ga0070708_100008608 3300005445 Bacteria 8196
16 Ga0070706_100000004 3300005467 Bacteria 281790
17 Ga0070706_100000036 3300005467 Bacteria 151766
18 Ga0070706_100000109 3300005467 Bacteria 100476
19 Ga0070706_100003918 3300005467 Bacteria 14512
20 Ga0070706_100174401 3300005467 Bacteria 2008
21 Ga0070706_100272976 3300005467 Bacteria 1578
22 Ga0070706_100338618 3300005467 Unclassified 1402
23 Ga0070706_100644587 3300005467 Unclassified 983
24 Ga0070707_100000002 3300005468 Bacteria 291540
25 Ga0070707_100002080 3300005468 Bacteria 19196
26 Ga0070707_100015551 3300005468 Bacteria 7140
27 Ga0070707_100022567 3300005468 Bacteria 5951
28 Ga0070707_100045347 3300005468 Bacteria 4209
29 Ga0070707_100092406 3300005468 Bacteria 2930
30 Ga0070707_100556635 3300005468 Unclassified 1109
31 Ga0070698_100002280 3300005471 Bacteria 21240
32 Ga0070698_100007304 3300005471 Bacteria 11961
33 Ga0070698_100016633 3300005471 Bacteria 7762
34 Ga0070698_100089163 3300005471 Bacteria 3068
35 Ga0070698_100155130 3300005471 Unclassified 2235
36 Ga0070698_100192288 3300005471 Bacteria 1978
37 Ga0070699_100000050 3300005518 Bacteria 117160
38 Ga0070699_100000082 3300005518 Bacteria 91288
39 Ga0070699_100000184 3300005518 Bacteria 60897
40 Ga0070699_100030337 3300005518 Bacteria 4667
41 Ga0070699_100124138 3300005518 Unclassified 2272
42 Ga0070699_100178266 3300005518 Unclassified 1885
43 Ga0070699_100222291 3300005518 Bacteria 1683
44 Ga0070699_100259892 3300005518 Bacteria 1553
45 Ga0070699_100311850 3300005518 Unclassified 1413
46 Ga0070684_100701758 3300005535 Bacteria 943
47 Ga0070697_100002987 3300005536 Bacteria 12990
48 Ga0070697_100017399 3300005536 Bacteria 5656
49 Ga0070697_100021481 3300005536 Bacteria 5114
50 Ga0070697_100038009 3300005536 Bacteria 3888
51 Ga0070697_100038345 3300005536 Bacteria 3871
52 Ga0070697_100233679 3300005536 Bacteria 1568
53 Ga0070695_100010700 3300005545 Archaea 5482
54 Ga0070695_100078434 3300005545 Bacteria 2178
55 Ga0070695_100098064 3300005545 Bacteria 1969
56 Ga0070695_100099168 3300005545 Unclassified 1959
57 Ga0070696_100022391 3300005546 Bacteria 4292
58 Ga0070696_100120304 3300005546 Bacteria 1900
59 Ga0070704_100001531 3300005549 Bacteria 12481
60 Ga0070704_100074385 3300005549 Bacteria 2478
61 Ga0068856_100729537 3300005614 Bacteria 1011
62 Ga0068864_100117906 3300005618 Bacteria 2370
63 Ga0068864_100672834 3300005618 Bacteria 1009
64 Ga0068858_100123697 3300005842 Bacteria 2421
65 Ga0070717_10000327 3300006028 Bacteria 30863
66 Ga0070717_10002208 3300006028 Bacteria 13692
67 Ga0070716_100008172 3300006173 Bacteria 5184
68 Ga0070716_100035643 3300006173 Bacteria 2737
69 Ga0070716_100197157 3300006173 Bacteria 1335
70 Ga0070712_100112156 3300006175 Bacteria 2037
71 Ga0070712_100380497 3300006175 Bacteria 1162
72 Ga0068871_100274620 3300006358 Bacteria 1473
73 Ga0075433_10021602 3300006852 Bacteria 5398
74 Ga0075434_100174269 3300006871 Bacteria 2171
75 Ga0075434_100484746 3300006871 Bacteria 1257
76 Ga0075434_100534462 3300006871 Bacteria 1192
77 Ga0075436_100135543 3300006914 Bacteria 1728
78 Ga0075436_100142910 3300006914 Bacteria 1682
79 Ga0075436_100250777 3300006914 Bacteria 1260
80 Ga0075436_100308893 3300006914 Bacteria 1134
81 Ga0075435_100024206 3300007076 Bacteria 4708
82 Ga0111539_10492746 3300009094 Bacteria 1427
83 Ga0111539_10945047 3300009094 Bacteria 1002
84 Ga0105243_10116627 3300009148 Bacteria 2243
85 Ga0105243_10656733 3300009148 Bacteria 1017
86 Ga0105249_10055332 3300009553 Bacteria 3629
87 Ga0157372_10026141 3300013307 Bacteria 6351
88 Ga0157375_10949249 3300013308 Unclassified 1002
89 Ga0163163_10137839 3300014325 Bacteria 2481
90 Ga0163163_10208824 3300014325 Bacteria 2001
91 Ga0157380_10056642 3300014326 Unclassified 3119
92 Ga0206356_10817180 3300020070 Bacteria 1075
93 Ga0206352_10662848 3300020078 Bacteria 902
94 Ga0207653_10059049 3300025885 Bacteria 1290
95 Ga0207688_10133241 3300025901 Bacteria 1457
96 Ga0207643_10174028 3300025908 Bacteria 1300
97 Ga0207684_10000010 3300025910 Bacteria 552805
98 Ga0207684_10000020 3300025910 Bacteria 342787
99 Ga0207684_10000033 3300025910 Bacteria 291567
100 Ga0207684_10000040 3300025910 Bacteria 262703
101 Ga0207684_10009366 3300025910 Bacteria 8653
102 Ga0207684_10225018 3300025910 Bacteria 1619
103 Ga0207684_10359714 3300025910 Unclassified 1252
104 Ga0207693_10285987 3300025915 Bacteria 1292
105 Ga0207646_10000007 3300025922 Bacteria 478285
106 Ga0207646_10000021 3300025922 Bacteria 272003
107 Ga0207646_10004834 3300025922 Bacteria 14445
108 Ga0207646_10007488 3300025922 Bacteria 11081
109 Ga0207646_10029921 3300025922 Bacteria 4944
110 Ga0207646_10049075 3300025922 Bacteria 3781
111 Ga0207646_10129104 3300025922 Unclassified 2274
112 Ga0207646_10297548 3300025922 Unclassified 1458
113 Ga0207687_10610606 3300025927 Bacteria 920
114 Ga0207664_10079246 3300025929 Bacteria 2666
115 Ga0207706_10085087 3300025933 Bacteria 2780
116 Ga0207665_10005072 3300025939 Bacteria 8792
117 Ga0207665_10055058 3300025939 Bacteria 2683
118 Ga0207679_10312738 3300025945 Bacteria 1358
119 Ga0207651_10118646 3300025960 Bacteria 2002
120 Ga0207641_10055803 3300026088 Bacteria 3355
121 Ga0207641_10361132 3300026088 Unclassified 1387
122 Ga0207676_10131899 3300026095 Bacteria 2126
123 Ga0207675_100493113 3300026118 Bacteria 1219
124 Ga0209974_10027289 3300027876 Bacteria 1889
125 Ga0207428_10131335 3300027907 Bacteria 1916
126 Ga0268266_10983070 3300028379 Bacteria 817
127 Ga0265326_10008344 3300028558 Bacteria 3126
128 Ga0265319_1005769 3300028563 Bacteria 5855
129 Ga0265324_10040476 3300029957 Unclassified 1614
130 Ga0265332_10128206 3300031238 Bacteria 1065
131 Ga0265320_10098448 3300031240 Bacteria 1348
132 Ga0265340_10056323 3300031247 Bacteria 1891
133 Ga0307408_100288289 3300031548 Bacteria 1370
134 Ga0265313_10111522 3300031595 Bacteria 1202
135 Ga0265342_10108330 3300031712 Unclassified 1575
136 Ga0307405_10067140 3300031731 Bacteria 2290
137 Ga0307406_10111874 3300031901 Unclassified 1882
138 Ga0307416_100118022 3300032002 Bacteria 2357
139 Ga0373947_0032308 3300035725 Bacteria 3084
140 Ga0373925_0247812 3300037068 Bacteria 1428
141 Ga0395898_0652403 3300037466 Bacteria 995
142 Ga0395901_0334634 3300038443 Bacteria 1565
143 Ga0436365_1504416 3300039437 Bacteria 669
144 Ga0450910_024259 3300042147 Unclassified 930
145 Ga0453684_0315104 3300044712 Unclassified 1774
146 Ga0466959_0090929 3300045049 Bacteria 2192
147 Ga0495653_0036411 3300046463 Bacteria 3876
148 Ga0495628_0017020 3300046516 Bacteria 6057
149 Ga0495630_0153412 3300046517 Bacteria 1753
150 Ga0495652_0271288 3300046529 Bacteria 1247
151 Ga0495640_0087108 3300046533 Bacteria 2066
152 Ga0495667_0102683 3300046559 Bacteria 1849
153 Ga0495634_0016447 3300046642 Bacteria 5292
154 Ga0495635_0147655 3300046663 Unclassified 1601
155 Ga0495613_0488643 3300046689 Bacteria 830
156 Ga0495680_0024139 3300047322 Bacteria 5046
157 Ga0495675_0141192 3300047444 Bacteria 1493
158 Ga0495593_0140805 3300047673 Bacteria 1222
159 Ga0496102_0038504 3300048905 Bacteria 4315
160 Ga0496103_0062297 3300048906 Bacteria 2321
161 Ga0496104_0033820 3300048907 Bacteria 4764
162 Ga0496106_0181233 3300048909 Bacteria 1672
163 Ga0496109_0230839 3300048912 Bacteria 1741
164 Ga0496110_0044075 3300048913 Bacteria 3895
165 Ga0496111_0291029 3300048914 Bacteria 1211
166 Ga0496113_0006968 3300048916 Bacteria 7225
167 Ga0496113_0252299 3300048916 Unclassified 1409
168 Ga0496114_0170190 3300048917 Bacteria 1898
169 Ga0496114_0203266 3300048917 Unclassified 1736
170 Ga0501036_0263293 3300049572 Bacteria 1444
171 Ga0501041_0438429 3300049577 Bacteria 829
172 Ga0501048_0186066 3300049582 Bacteria 1472
173 Ga0501067_0041190 3300049583 Bacteria 2565
174 Ga0501067_0073091 3300049583 Bacteria 1900
175 Ga0501069_0065239 3300049585 Bacteria 2036
176 Ga0501069_0284338 3300049585 Bacteria 968
177 Ga0501069_0372366 3300049585 Unclassified 843
178 Ga0501070_0096925 3300049586 Bacteria 2440
179 Ga0501072_0186882 3300049588 Bacteria 1653
180 Ga0501074_0231232 3300049590 Bacteria 1316
181 Ga0501076_0399860 3300049592 Bacteria 1130
182 Ga0501079_0225130 3300049741 Bacteria 1465
183 Ga0501045_0028682 3300049824 Bacteria 4017
184 nmdc:mga0n895_305477_c1 3300050512 Bacteria 1613
185 nmdc:mga08x19_208657_c1 3300050514 Bacteria 1341
186 nmdc:mga08x19_250529_c1 3300050514 Bacteria 1223
187 nmdc:mga08x19_27708_c1 3300050514 Bacteria 3545
188 nmdc:mga0a205_179462_c1 3300050515 Unclassified 2012
189 Ga0495601_0041497 3300053077 Unclassified 2884
190 Ga0495595_0004234 3300053084 Bacteria 5768
191 Ga0495619_0011196 3300053085 Bacteria 5641
192 Ga0501082_0243101 3300060353 Bacteria 1566
193 Ga0530510_0032945 3300061734 Bacteria 3729
194 Ga0466959_0413469
195 Ga0070659_100621828
196 Ga0070709_10039919
197 Ga0070709_10335853
198 Ga0070709_10528674
199 Ga0070714_100091133
200 Ga0070714_100178169
201 Ga0070714_100287028
202 Ga0070714_100393267
203 Ga0070713_100200124
204 Ga0070711_100316427
205 Ga0070705_100003560
206 Ga0070705_100038690
207 Ga0070708_100000001
208 Ga0070708_100008608
209 Ga0070706_100000004
210 Ga0070706_100000036
211 Ga0070706_100000109
212 Ga0070706_100003918
213 Ga0070706_100174401
214 Ga0070706_100272976
215 Ga0070706_100338618
216 Ga0070706_100644587
217 Ga0070707_100000002
218 Ga0070707_100002080
219 Ga0070707_100015551
220 Ga0070707_100022567
221 Ga0070707_100045347
222 Ga0070707_100092406
223 Ga0070707_100556635
224 Ga0070698_100002280
225 Ga0070698_100007304
226 Ga0070698_100016633
227 Ga0070698_100089163
228 Ga0070698_100155130
229 Ga0070698_100192288
230 Ga0070699_100000050
231 Ga0070699_100000082
232 Ga0070699_100000184
233 Ga0070699_100030337
234 Ga0070699_100124138
235 Ga0070699_100178266
236 Ga0070699_100222291
237 Ga0070699_100259892
238 Ga0070699_100311850
239 Ga0070684_100701758
240 Ga0070697_100002987
241 Ga0070697_100017399
242 Ga0070697_100021481
243 Ga0070697_100038009
244 Ga0070697_100038345
245 Ga0070697_100233679
246 Ga0070695_100010700
247 Ga0070695_100078434
248 Ga0070695_100098064
249 Ga0070695_100099168
250 Ga0070696_100022391
251 Ga0070696_100120304
252 Ga0070704_100001531
253 Ga0070704_100074385
254 Ga0068856_100729537
255 Ga0068864_100117906
256 Ga0068864_100672834
257 Ga0068858_100123697
258 Ga0070717_10000327
259 Ga0070717_10002208
260 Ga0070716_100008172
261 Ga0070716_100035643
262 Ga0070716_100197157
263 Ga0070712_100112156
264 Ga0070712_100380497
265 Ga0068871_100274620
266 Ga0075433_10021602
267 Ga0075434_100174269
268 Ga0075434_100484746
269 Ga0075434_100534462
270 Ga0075436_100135543
271 Ga0075436_100142910
272 Ga0075436_100250777
273 Ga0075436_100308893
274 Ga0075435_100024206
275 Ga0111539_10492746
276 Ga0111539_10945047
277 Ga0105243_10116627
278 Ga0105243_10656733
279 Ga0105249_10055332
280 Ga0157372_10026141
281 Ga0157375_10949249
282 Ga0163163_10137839
283 Ga0163163_10208824
284 Ga0157380_10056642
285 Ga0206356_10817180
286 Ga0206352_10662848
287 Ga0207653_10059049
288 Ga0207688_10133241
289 Ga0207643_10174028
290 Ga0207684_10000010
291 Ga0207684_10000020
292 Ga0207684_10000033
293 Ga0207684_10000040
294 Ga0207684_10009366
295 Ga0207684_10225018
296 Ga0207684_10359714
297 Ga0207693_10285987
298 Ga0207646_10000007
299 Ga0207646_10000021
300 Ga0207646_10004834
301 Ga0207646_10007488
302 Ga0207646_10029921
303 Ga0207646_10049075
304 Ga0207646_10129104
305 Ga0207646_10297548
306 Ga0207687_10610606
307 Ga0207664_10079246
308 Ga0207706_10085087
309 Ga0207665_10005072
310 Ga0207665_10055058
311 Ga0207679_10312738
312 Ga0207651_10118646
313 Ga0207641_10055803
314 Ga0207641_10361132
315 Ga0207676_10131899
316 Ga0207675_100493113
317 Ga0209974_10027289
318 Ga0207428_10131335
319 Ga0268266_10983070
320 Ga0265326_10008344
321 Ga0265319_1005769
322 Ga0265324_10040476
323 Ga0265332_10128206
324 Ga0265320_10098448
325 Ga0265340_10056323
326 Ga0307408_100288289
327 Ga0265313_10111522
328 Ga0265342_10108330
329 Ga0307405_10067140
330 Ga0307406_10111874
331 Ga0307416_100118022
332 Ga0373947_0032308
333 Ga0373925_0247812
334 Ga0395898_0652403
335 Ga0395901_0334634
336 Ga0436365_1504416
337 Ga0450910_024259
338 Ga0453684_0315104
339 Ga0466959_0090929
340 Ga0495653_0036411
341 Ga0495628_0017020
342 Ga0495630_0153412
343 Ga0495652_0271288
344 Ga0495640_0087108
345 Ga0495667_0102683
346 Ga0495634_0016447
347 Ga0495635_0147655
348 Ga0495613_0488643
349 Ga0495680_0024139
350 Ga0495675_0141192
351 Ga0495593_0140805
352 Ga0496102_0038504
353 Ga0496103_0062297
354 Ga0496104_0033820
355 Ga0496106_0181233
356 Ga0496109_0230839
357 Ga0496110_0044075
358 Ga0496111_0291029
359 Ga0496113_0006968
360 Ga0496113_0252299
361 Ga0496114_0170190
362 Ga0496114_0203266
363 Ga0501036_0263293
364 Ga0501041_0438429
365 Ga0501048_0186066
366 Ga0501067_0041190
367 Ga0501067_0073091
368 Ga0501069_0065239
369 Ga0501069_0284338
370 Ga0501069_0372366
371 Ga0501070_0096925
372 Ga0501072_0186882
373 Ga0501074_0231232
374 Ga0501076_0399860
375 Ga0501079_0225130
376 Ga0501045_0028682
377 nmdc:mga0n895_305477_c1
378 nmdc:mga08x19_208657_c1
379 nmdc:mga08x19_250529_c1
380 nmdc:mga08x19_27708_c1
381 nmdc:mga0a205_179462_c1
382 Ga0495601_0041497
383 Ga0495595_0004234
384 Ga0495619_0011196
385 Ga0501082_0243101
386 Ga0530510_0032945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

150

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

167

280

0.9

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

35

78

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

170

281

0.79

PF18029

Glyoxalase_6

Glyoxalase-like domain

38

151

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9366 8 256
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8791 8 256
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8166 8 127
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8117 13 127
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.7606 138 255
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9333 9 127 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9244 135 252 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9184 1 130 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9112 9 127 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8946 134 256 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A535KGR8-F1-model_v4 VOC family protein 0.9879 145 258
AF-A0A535SSU6-F1-model_v4 VOC family protein 0.9821 14 257
AF-A0A536KP93-F1-model_v4 VOC family protein 0.9783 1 257
AF-A0A522N9Q8-F1-model_v4 VOC family protein 0.9711 3 257
AF-A0A535KGR8-F1-model_v4 VOC family protein 0.971 145 258

Map