F297566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 136 | 386 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0069495|Ga0466960_0069495_619_1584 |
| Length | 321 |
| Sequence | MTRVVVVGAGVVGLTCAVRLLEAGHEVGVVARDLPLETTSSAAAALWYPHRAYPFERVTAWAATTYRELAELAVDDATGVVMRTGTELFRAGRPDPWWASAVPHLAHETDVPTPYAAGLTFEAPVVEMPVYLRWLTARVEALGGTVTRIALSGLPDTAPVVVDAAGLGARLFARDGSVVPVRGQVVYVEQVGLDRWWLDGSGPTYVVPRARDIVVGGTEEEGAWDRNPDEATAKEILERARELVPALRAARVLGHRVGLRPARPTVRLEAATTAEGVRVVHCYGHGGAGVTLSWGCADEVAGLVEAQNSRSEGSSMPRSAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 62 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 64 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 65 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 66 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 67 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 68 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 69 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 70 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 71 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 72 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 73 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 74 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 75 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 76 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 77 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 78 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 79 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 80 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 81 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 82 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 83 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 84 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 85 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 86 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 88 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 89 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 90 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 92 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 93 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 94 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 95 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 96 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 97 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 98 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 116 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 117 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 118 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 120 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 121 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 123 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 124 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 125 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 126 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 127 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 128 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 129 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 130 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 131 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 132 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 133 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 134 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 135 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 136 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.26 |
| Metatranscriptomes | 0 |
| Isolates | 6.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.88 |
| Nodule | 0.52 |
| Rhizoplane | 7.25 |
| Rhizosphere | 75.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466960_0069495 | 3300044901 | Bacteria | 1750 |
| 2 | Ga0070658_10146791 | 3300005327 | Bacteria | 1973 |
| 3 | Ga0070680_100039721 | 3300005336 | Bacteria | 3807 |
| 4 | Ga0070682_100019989 | 3300005337 | Bacteria | 3935 |
| 5 | Ga0068868_100073621 | 3300005338 | Bacteria | 2728 |
| 6 | Ga0070691_10027470 | 3300005341 | Bacteria | 2655 |
| 7 | Ga0070687_100028921 | 3300005343 | Bacteria | 2693 |
| 8 | Ga0070692_10001148 | 3300005345 | Bacteria | 9309 |
| 9 | Ga0070675_100060477 | 3300005354 | Bacteria | 3128 |
| 10 | Ga0070659_100047290 | 3300005366 | Bacteria | 3374 |
| 11 | Ga0070667_100078650 | 3300005367 | Bacteria | 2818 |
| 12 | Ga0070714_100078646 | 3300005435 | Bacteria | 2867 |
| 13 | Ga0070701_10011734 | 3300005438 | Bacteria | 3931 |
| 14 | Ga0070700_100007023 | 3300005441 | Bacteria | 6048 |
| 15 | Ga0070708_100256828 | 3300005445 | Bacteria | 1642 |
| 16 | Ga0068867_100007932 | 3300005459 | Bacteria | 7499 |
| 17 | Ga0070685_10038764 | 3300005466 | Bacteria | 2703 |
| 18 | Ga0070707_100291659 | 3300005468 | Bacteria | 1585 |
| 19 | Ga0070698_100002329 | 3300005471 | Bacteria | 21013 |
| 20 | Ga0070684_100015481 | 3300005535 | Bacteria | 6211 |
| 21 | Ga0068853_100022799 | 3300005539 | Bacteria | 5233 |
| 22 | Ga0070672_100001435 | 3300005543 | Bacteria | 14737 |
| 23 | Ga0068852_100001572 | 3300005616 | Bacteria | 15504 |
| 24 | Ga0068864_100101570 | 3300005618 | Bacteria | 2551 |
| 25 | Ga0068870_10014567 | 3300005840 | Bacteria | 3716 |
| 26 | Ga0068870_10080807 | 3300005840 | Bacteria | 1797 |
| 27 | Ga0068860_100072491 | 3300005843 | Bacteria | 3273 |
| 28 | Ga0081539_10049427 | 3300005985 | Bacteria | 2386 |
| 29 | Ga0075365_10001959 | 3300006038 | Bacteria | 9723 |
| 30 | Ga0075365_10007337 | 3300006038 | Bacteria | 6166 |
| 31 | Ga0075365_10007792 | 3300006038 | Bacteria | 6030 |
| 32 | Ga0075365_10031818 | 3300006038 | Bacteria | 3386 |
| 33 | Ga0075365_10035871 | 3300006038 | Bacteria | 3211 |
| 34 | Ga0075365_10070823 | 3300006038 | Bacteria | 2346 |
| 35 | Ga0075365_10078647 | 3300006038 | Bacteria | 2230 |
| 36 | Ga0075365_10150217 | 3300006038 | Bacteria | 1620 |
| 37 | Ga0075365_10208248 | 3300006038 | Bacteria | 1371 |
| 38 | Ga0075363_100030852 | 3300006048 | Bacteria | 2777 |
| 39 | Ga0075364_10082294 | 3300006051 | Bacteria | 2130 |
| 40 | Ga0068865_100023338 | 3300006881 | Bacteria | 4050 |
| 41 | Ga0105245_10047791 | 3300009098 | Bacteria | 3826 |
| 42 | Ga0105245_10254876 | 3300009098 | Bacteria | 1706 |
| 43 | Ga0105243_10002624 | 3300009148 | Bacteria | 14957 |
| 44 | Ga0105242_10180267 | 3300009176 | Bacteria | 1863 |
| 45 | Ga0105249_10008555 | 3300009553 | Bacteria | 8924 |
| 46 | Ga0105239_10076381 | 3300010375 | Bacteria | 3684 |
| 47 | Ga0105246_10148684 | 3300011119 | Bacteria | 1771 |
| 48 | Ga0157372_10021693 | 3300013307 | Bacteria | 6942 |
| 49 | Ga0157372_10121058 | 3300013307 | Bacteria | 3006 |
| 50 | Ga0157372_10167253 | 3300013307 | Bacteria | 2543 |
| 51 | Ga0157372_10518448 | 3300013307 | Bacteria | 1390 |
| 52 | Ga0157375_10087192 | 3300013308 | Bacteria | 3173 |
| 53 | Ga0163163_10230913 | 3300014325 | Bacteria | 1899 |
| 54 | Ga0163163_10362137 | 3300014325 | Bacteria | 1507 |
| 55 | Ga0157380_10011737 | 3300014326 | Bacteria | 6335 |
| 56 | Ga0182008_10017597 | 3300014497 | Bacteria | 3706 |
| 57 | Ga0157377_10023763 | 3300014745 | Bacteria | 3252 |
| 58 | Ga0163161_10086640 | 3300017792 | Bacteria | 2312 |
| 59 | Ga0163161_10313872 | 3300017792 | Bacteria | 1238 |
| 60 | Ga0207643_10014825 | 3300025908 | Bacteria | 4239 |
| 61 | Ga0207662_10013882 | 3300025918 | Bacteria | 4509 |
| 62 | Ga0207657_10244226 | 3300025919 | Bacteria | 1433 |
| 63 | Ga0207659_10081689 | 3300025926 | Bacteria | 2390 |
| 64 | Ga0207687_10038907 | 3300025927 | Bacteria | 3253 |
| 65 | Ga0207687_10134856 | 3300025927 | Bacteria | 1866 |
| 66 | Ga0207690_10094888 | 3300025932 | Bacteria | 2118 |
| 67 | Ga0207686_10024733 | 3300025934 | Bacteria | 3484 |
| 68 | Ga0207709_10006669 | 3300025935 | Bacteria | 6474 |
| 69 | Ga0207691_10021500 | 3300025940 | Bacteria | 6091 |
| 70 | Ga0207640_10049415 | 3300025981 | Bacteria | 2723 |
| 71 | Ga0207703_10404281 | 3300026035 | Bacteria | 1267 |
| 72 | Ga0207678_10227140 | 3300026067 | Bacteria | 1598 |
| 73 | Ga0207708_10009698 | 3300026075 | Bacteria | 7145 |
| 74 | Ga0207648_10006174 | 3300026089 | Bacteria | 11936 |
| 75 | Ga0207675_100005115 | 3300026118 | Bacteria | 12627 |
| 76 | Ga0207675_100561686 | 3300026118 | Bacteria | 1141 |
| 77 | Ga0207683_10036411 | 3300026121 | Bacteria | 4285 |
| 78 | Ga0207683_10191562 | 3300026121 | Bacteria | 1857 |
| 79 | Ga0207428_10077513 | 3300027907 | Bacteria | 2602 |
| 80 | Ga0268264_10059428 | 3300028381 | Bacteria | 3203 |
| 81 | Ga0307405_10107426 | 3300031731 | Bacteria | 1884 |
| 82 | Ga0307406_10170103 | 3300031901 | Bacteria | 1576 |
| 83 | Ga0307407_10011542 | 3300031903 | Bacteria | 4209 |
| 84 | Ga0307409_100104244 | 3300031995 | Bacteria | 2361 |
| 85 | Ga0307416_100022786 | 3300032002 | Bacteria | 4530 |
| 86 | Ga0307414_10283687 | 3300032004 | Bacteria | 1393 |
| 87 | Ga0307411_10091216 | 3300032005 | Bacteria | 2128 |
| 88 | Ga0307415_100420945 | 3300032126 | Bacteria | 1146 |
| 89 | Ga0395905_0222819 | 3300037471 | Bacteria | 1765 |
| 90 | Ga0395901_0023720 | 3300038443 | Bacteria | 6291 |
| 91 | Ga0451791_1704911 | 3300041451 | Bacteria | 1924 |
| 92 | Ga0439445_0017354 | 3300042004 | Bacteria | 1779 |
| 93 | Ga0439446_0007896 | 3300042156 | Bacteria | 2810 |
| 94 | Ga0466969_0116606 | 3300044656 | Bacteria | 1246 |
| 95 | Ga0466965_0013526 | 3300044683 | Bacteria | 3852 |
| 96 | Ga0466961_0020674 | 3300044693 | Bacteria | 4236 |
| 97 | Ga0466961_0094065 | 3300044693 | Bacteria | 1891 |
| 98 | Ga0466961_0125616 | 3300044693 | Bacteria | 1610 |
| 99 | Ga0466963_0217561 | 3300044694 | Bacteria | 1337 |
| 100 | Ga0466963_0244586 | 3300044694 | Bacteria | 1258 |
| 101 | Ga0466964_0008244 | 3300044706 | Bacteria | 3910 |
| 102 | Ga0466971_0068042 | 3300044719 | Bacteria | 1615 |
| 103 | Ga0466968_0121802 | 3300044735 | Bacteria | 1181 |
| 104 | Ga0466970_0002049 | 3300044765 | Bacteria | 9758 |
| 105 | Ga0466970_0048239 | 3300044765 | Bacteria | 2270 |
| 106 | Ga0466970_0108146 | 3300044765 | Bacteria | 1518 |
| 107 | Ga0466957_0013501 | 3300044842 | Bacteria | 4738 |
| 108 | Ga0466957_0185899 | 3300044842 | Bacteria | 1359 |
| 109 | Ga0466960_0000363 | 3300044901 | Bacteria | 15482 |
| 110 | Ga0466960_0001952 | 3300044901 | Bacteria | 7623 |
| 111 | Ga0466960_0016463 | 3300044901 | Bacteria | 3209 |
| 112 | Ga0466960_0181893 | 3300044901 | Bacteria | 1140 |
| 113 | Ga0466967_0089842 | 3300045976 | Bacteria | 2789 |
| 114 | Ga0466967_0135551 | 3300045976 | Bacteria | 2289 |
| 115 | Ga0495674_0375513 | 3300047319 | Bacteria | 1151 |
| 116 | Ga0496100_0090606 | 3300048903 | Bacteria | 2085 |
| 117 | Ga0496103_0041392 | 3300048906 | Bacteria | 2832 |
| 118 | Ga0496107_0150423 | 3300048910 | Bacteria | 1722 |
| 119 | Ga0496108_0109476 | 3300048911 | Bacteria | 2361 |
| 120 | Ga0496109_0157361 | 3300048912 | Bacteria | 2128 |
| 121 | Ga0496109_0423909 | 3300048912 | Bacteria | 1257 |
| 122 | Ga0496110_0208183 | 3300048913 | Bacteria | 1777 |
| 123 | Ga0496111_0078557 | 3300048914 | Bacteria | 2407 |
| 124 | Ga0496113_0091633 | 3300048916 | Bacteria | 2343 |
| 125 | Ga0496114_0186389 | 3300048917 | Bacteria | 1814 |
| 126 | Ga0496114_0248094 | 3300048917 | Bacteria | 1566 |
| 127 | Ga0496114_0519621 | 3300048917 | Bacteria | 1053 |
| 128 | Ga0496115_0023003 | 3300048918 | Bacteria | 4834 |
| 129 | Ga0501031_0083631 | 3300049568 | Bacteria | 2080 |
| 130 | Ga0501031_0123132 | 3300049568 | Bacteria | 1694 |
| 131 | Ga0501031_0136109 | 3300049568 | Bacteria | 1605 |
| 132 | Ga0501032_0284473 | 3300049569 | Bacteria | 1070 |
| 133 | Ga0501036_0018835 | 3300049572 | Bacteria | 5790 |
| 134 | Ga0501036_0072883 | 3300049572 | Bacteria | 2903 |
| 135 | Ga0501036_0134247 | 3300049572 | Bacteria | 2089 |
| 136 | Ga0501039_0034667 | 3300049575 | Bacteria | 3894 |
| 137 | Ga0501039_0066420 | 3300049575 | Bacteria | 2800 |
| 138 | Ga0501039_0097277 | 3300049575 | Bacteria | 2295 |
| 139 | Ga0501039_0128497 | 3300049575 | Bacteria | 1988 |
| 140 | Ga0501040_0063722 | 3300049576 | Bacteria | 2537 |
| 141 | Ga0501041_0053168 | 3300049577 | Bacteria | 2470 |
| 142 | Ga0501042_0070238 | 3300049578 | Bacteria | 2505 |
| 143 | Ga0501048_0179269 | 3300049582 | Bacteria | 1502 |
| 144 | Ga0501067_0019765 | 3300049583 | Bacteria | 3728 |
| 145 | Ga0501067_0034291 | 3300049583 | Bacteria | 2817 |
| 146 | Ga0501067_0117493 | 3300049583 | Bacteria | 1479 |
| 147 | Ga0501068_0037327 | 3300049584 | Bacteria | 2909 |
| 148 | Ga0501068_0224104 | 3300049584 | Bacteria | 1195 |
| 149 | Ga0501069_0068010 | 3300049585 | Bacteria | 1993 |
| 150 | Ga0501069_0194628 | 3300049585 | Bacteria | 1174 |
| 151 | Ga0501070_0377556 | 3300049586 | Bacteria | 1148 |
| 152 | Ga0501071_0041650 | 3300049587 | Bacteria | 3289 |
| 153 | Ga0501071_0061306 | 3300049587 | Bacteria | 2724 |
| 154 | Ga0501071_0158860 | 3300049587 | Bacteria | 1689 |
| 155 | Ga0501072_0133316 | 3300049588 | Bacteria | 1981 |
| 156 | Ga0501072_0189461 | 3300049588 | Bacteria | 1641 |
| 157 | Ga0501075_0314652 | 3300049591 | Bacteria | 1193 |
| 158 | Ga0501076_0064922 | 3300049592 | Bacteria | 2910 |
| 159 | Ga0501076_0179326 | 3300049592 | Bacteria | 1727 |
| 160 | Ga0501076_0305880 | 3300049592 | Bacteria | 1304 |
| 161 | Ga0501077_0156675 | 3300049593 | Bacteria | 1445 |
| 162 | Ga0501045_0153389 | 3300049824 | Bacteria | 1714 |
| 163 | Ga0501045_0175131 | 3300049824 | Bacteria | 1598 |
| 164 | Ga0501045_0295670 | 3300049824 | Bacteria | 1205 |
| 165 | Ga0501045_0326536 | 3300049824 | Bacteria | 1142 |
| 166 | nmdc:mga03683_29225_c1 | 3300050489 | Bacteria | 2196 |
| 167 | nmdc:mga00v17_61631_c1 | 3300050491 | Bacteria | 2306 |
| 168 | nmdc:mga0yw44_104684_c1 | 3300050492 | Bacteria | 1807 |
| 169 | nmdc:mga0yw44_10948_c1 | 3300050492 | Bacteria | 4653 |
| 170 | nmdc:mga0yw44_1351_c1 | 3300050492 | Bacteria | 9723 |
| 171 | nmdc:mga0yw44_149384_c1 | 3300050492 | Bacteria | 1523 |
| 172 | nmdc:mga0yw44_33419_c1 | 3300050492 | Bacteria | 3005 |
| 173 | nmdc:mga0yw44_90260_c1 | 3300050492 | Bacteria | 1935 |
| 174 | nmdc:mga08y16_123694_c1 | 3300050511 | Bacteria | 2692 |
| 175 | nmdc:mga08y16_400303_c1 | 3300050511 | Bacteria | 1405 |
| 176 | Ga0500556_0000573 | 3300053104 | Bacteria | 24462 |
| 177 | Ga0500593_000129 | 3300053117 | Bacteria | 29908 |
| 178 | Ga0501084_0260715 | 3300054114 | Bacteria | 1463 |
| 179 | Ga0466962_0058829 | 3300061719 | Bacteria | 1834 |
| 180 | Ga0530510_0175167 | 3300061734 | Bacteria | 1590 |
| 181 | 2643828334 | 2643221561 | Bacteria | 4984412 |
| 182 | 2644090631 | 2643221615 | Bacteria | 5487866 |
| 183 | 2644230699 | 2643221641 | Bacteria | 4490190 |
| 184 | 2644320435 | 2643221657 | Bacteria | 5490246 |
| 185 | 2644535149 | 2643221696 | Bacteria | 5431823 |
| 186 | 2740167668 | 2739367898 | Bacteria | 4367674 |
| 187 | 2774396852 | 2773857762 | Bacteria | 5971770 |
| 188 | 2809198492 | 2808606439 | Bacteria | 5952208 |
| 189 | 2812349713 | 2811994878 | Bacteria | 5992952 |
| 190 | 2842890103 | 2842888712 | Bacteria | 4279094 |
| 191 | 2855390644 | 2855386786 | Bacteria | 4752232 |
| 192 | 2891969554 | 2891968417 | Bacteria | 5821697 |
| 193 | 8054613234 | 8054609563 | Bacteria | 5170090 |
| 194 | Ga0466960_0069495 | |||
| 195 | Ga0070658_10146791 | |||
| 196 | Ga0070680_100039721 | |||
| 197 | Ga0070682_100019989 | |||
| 198 | Ga0068868_100073621 | |||
| 199 | Ga0070691_10027470 | |||
| 200 | Ga0070687_100028921 | |||
| 201 | Ga0070692_10001148 | |||
| 202 | Ga0070675_100060477 | |||
| 203 | Ga0070659_100047290 | |||
| 204 | Ga0070667_100078650 | |||
| 205 | Ga0070714_100078646 | |||
| 206 | Ga0070701_10011734 | |||
| 207 | Ga0070700_100007023 | |||
| 208 | Ga0070708_100256828 | |||
| 209 | Ga0068867_100007932 | |||
| 210 | Ga0070685_10038764 | |||
| 211 | Ga0070707_100291659 | |||
| 212 | Ga0070698_100002329 | |||
| 213 | Ga0070684_100015481 | |||
| 214 | Ga0068853_100022799 | |||
| 215 | Ga0070672_100001435 | |||
| 216 | Ga0068852_100001572 | |||
| 217 | Ga0068864_100101570 | |||
| 218 | Ga0068870_10014567 | |||
| 219 | Ga0068870_10080807 | |||
| 220 | Ga0068860_100072491 | |||
| 221 | Ga0081539_10049427 | |||
| 222 | Ga0075365_10001959 | |||
| 223 | Ga0075365_10007337 | |||
| 224 | Ga0075365_10007792 | |||
| 225 | Ga0075365_10031818 | |||
| 226 | Ga0075365_10035871 | |||
| 227 | Ga0075365_10070823 | |||
| 228 | Ga0075365_10078647 | |||
| 229 | Ga0075365_10150217 | |||
| 230 | Ga0075365_10208248 | |||
| 231 | Ga0075363_100030852 | |||
| 232 | Ga0075364_10082294 | |||
| 233 | Ga0068865_100023338 | |||
| 234 | Ga0105245_10047791 | |||
| 235 | Ga0105245_10254876 | |||
| 236 | Ga0105243_10002624 | |||
| 237 | Ga0105242_10180267 | |||
| 238 | Ga0105249_10008555 | |||
| 239 | Ga0105239_10076381 | |||
| 240 | Ga0105246_10148684 | |||
| 241 | Ga0157372_10021693 | |||
| 242 | Ga0157372_10121058 | |||
| 243 | Ga0157372_10167253 | |||
| 244 | Ga0157372_10518448 | |||
| 245 | Ga0157375_10087192 | |||
| 246 | Ga0163163_10230913 | |||
| 247 | Ga0163163_10362137 | |||
| 248 | Ga0157380_10011737 | |||
| 249 | Ga0182008_10017597 | |||
| 250 | Ga0157377_10023763 | |||
| 251 | Ga0163161_10086640 | |||
| 252 | Ga0163161_10313872 | |||
| 253 | Ga0207643_10014825 | |||
| 254 | Ga0207662_10013882 | |||
| 255 | Ga0207657_10244226 | |||
| 256 | Ga0207659_10081689 | |||
| 257 | Ga0207687_10038907 | |||
| 258 | Ga0207687_10134856 | |||
| 259 | Ga0207690_10094888 | |||
| 260 | Ga0207686_10024733 | |||
| 261 | Ga0207709_10006669 | |||
| 262 | Ga0207691_10021500 | |||
| 263 | Ga0207640_10049415 | |||
| 264 | Ga0207703_10404281 | |||
| 265 | Ga0207678_10227140 | |||
| 266 | Ga0207708_10009698 | |||
| 267 | Ga0207648_10006174 | |||
| 268 | Ga0207675_100005115 | |||
| 269 | Ga0207675_100561686 | |||
| 270 | Ga0207683_10036411 | |||
| 271 | Ga0207683_10191562 | |||
| 272 | Ga0207428_10077513 | |||
| 273 | Ga0268264_10059428 | |||
| 274 | Ga0307405_10107426 | |||
| 275 | Ga0307406_10170103 | |||
| 276 | Ga0307407_10011542 | |||
| 277 | Ga0307409_100104244 | |||
| 278 | Ga0307416_100022786 | |||
| 279 | Ga0307414_10283687 | |||
| 280 | Ga0307411_10091216 | |||
| 281 | Ga0307415_100420945 | |||
| 282 | Ga0395905_0222819 | |||
| 283 | Ga0395901_0023720 | |||
| 284 | Ga0451791_1704911 | |||
| 285 | Ga0439445_0017354 | |||
| 286 | Ga0439446_0007896 | |||
| 287 | Ga0466969_0116606 | |||
| 288 | Ga0466965_0013526 | |||
| 289 | Ga0466961_0020674 | |||
| 290 | Ga0466961_0094065 | |||
| 291 | Ga0466961_0125616 | |||
| 292 | Ga0466963_0217561 | |||
| 293 | Ga0466963_0244586 | |||
| 294 | Ga0466964_0008244 | |||
| 295 | Ga0466971_0068042 | |||
| 296 | Ga0466968_0121802 | |||
| 297 | Ga0466970_0002049 | |||
| 298 | Ga0466970_0048239 | |||
| 299 | Ga0466970_0108146 | |||
| 300 | Ga0466957_0013501 | |||
| 301 | Ga0466957_0185899 | |||
| 302 | Ga0466960_0000363 | |||
| 303 | Ga0466960_0001952 | |||
| 304 | Ga0466960_0016463 | |||
| 305 | Ga0466960_0181893 | |||
| 306 | Ga0466967_0089842 | |||
| 307 | Ga0466967_0135551 | |||
| 308 | Ga0495674_0375513 | |||
| 309 | Ga0496100_0090606 | |||
| 310 | Ga0496103_0041392 | |||
| 311 | Ga0496107_0150423 | |||
| 312 | Ga0496108_0109476 | |||
| 313 | Ga0496109_0157361 | |||
| 314 | Ga0496109_0423909 | |||
| 315 | Ga0496110_0208183 | |||
| 316 | Ga0496111_0078557 | |||
| 317 | Ga0496113_0091633 | |||
| 318 | Ga0496114_0186389 | |||
| 319 | Ga0496114_0248094 | |||
| 320 | Ga0496114_0519621 | |||
| 321 | Ga0496115_0023003 | |||
| 322 | Ga0501031_0083631 | |||
| 323 | Ga0501031_0123132 | |||
| 324 | Ga0501031_0136109 | |||
| 325 | Ga0501032_0284473 | |||
| 326 | Ga0501036_0018835 | |||
| 327 | Ga0501036_0072883 | |||
| 328 | Ga0501036_0134247 | |||
| 329 | Ga0501039_0034667 | |||
| 330 | Ga0501039_0066420 | |||
| 331 | Ga0501039_0097277 | |||
| 332 | Ga0501039_0128497 | |||
| 333 | Ga0501040_0063722 | |||
| 334 | Ga0501041_0053168 | |||
| 335 | Ga0501042_0070238 | |||
| 336 | Ga0501048_0179269 | |||
| 337 | Ga0501067_0019765 | |||
| 338 | Ga0501067_0034291 | |||
| 339 | Ga0501067_0117493 | |||
| 340 | Ga0501068_0037327 | |||
| 341 | Ga0501068_0224104 | |||
| 342 | Ga0501069_0068010 | |||
| 343 | Ga0501069_0194628 | |||
| 344 | Ga0501070_0377556 | |||
| 345 | Ga0501071_0041650 | |||
| 346 | Ga0501071_0061306 | |||
| 347 | Ga0501071_0158860 | |||
| 348 | Ga0501072_0133316 | |||
| 349 | Ga0501072_0189461 | |||
| 350 | Ga0501075_0314652 | |||
| 351 | Ga0501076_0064922 | |||
| 352 | Ga0501076_0179326 | |||
| 353 | Ga0501076_0305880 | |||
| 354 | Ga0501077_0156675 | |||
| 355 | Ga0501045_0153389 | |||
| 356 | Ga0501045_0175131 | |||
| 357 | Ga0501045_0295670 | |||
| 358 | Ga0501045_0326536 | |||
| 359 | nmdc:mga03683_29225_c1 | |||
| 360 | nmdc:mga00v17_61631_c1 | |||
| 361 | nmdc:mga0yw44_104684_c1 | |||
| 362 | nmdc:mga0yw44_10948_c1 | |||
| 363 | nmdc:mga0yw44_1351_c1 | |||
| 364 | nmdc:mga0yw44_149384_c1 | |||
| 365 | nmdc:mga0yw44_33419_c1 | |||
| 366 | nmdc:mga0yw44_90260_c1 | |||
| 367 | nmdc:mga08y16_123694_c1 | |||
| 368 | nmdc:mga08y16_400303_c1 | |||
| 369 | Ga0500556_0000573 | |||
| 370 | Ga0500593_000129 | |||
| 371 | Ga0501084_0260715 | |||
| 372 | Ga0466962_0058829 | |||
| 373 | Ga0530510_0175167 | |||
| 374 | 2643828334 | |||
| 375 | 2644090631 | |||
| 376 | 2644230699 | |||
| 377 | 2644320435 | |||
| 378 | 2644535149 | |||
| 379 | 2740167668 | |||
| 380 | 2774396852 | |||
| 381 | 2809198492 | |||
| 382 | 2812349713 | |||
| 383 | 2842890103 | |||
| 384 | 2855390644 | |||
| 385 | 2891969554 | |||
| 386 | 8054613234 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kmy-assembly4.cif.gz_M | structure of mtb lpd bound to 010705 | 1.003 | 2 | 27 |
| 7bke-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodisulfide reductase core and mobile arm in conformational state 2, composite structure) | 0.9877 | 2 | 29 |
| 6de6-assembly1.cif.gz_B | 2.1 a resolution structure of histamine dehydrogenase from rhizobium sp. 4-9 | 0.986 | 2 | 29 |
| 6aa8-assembly1.cif.gz_F | crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ | 0.9858 | 2 | 27 |
| 7bkd-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) | 0.9847 | 2 | 29 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1C9_1_191_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 1.008 | 2 | 28 | 3.40.50.720 |
| af_Q2FYF3_156_325_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 1.006 | 2 | 29 | 3.50.50.60 |
| af_Q2FYF3_1_146_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 1.005 | 2 | 29 | 3.50.50.60 |
| 2bc1B02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9982 | 2 | 28 | 3.50.50.60 |
| 3rp8A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9975 | 2 | 28 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G6DU87-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.951 | 131 | 269 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A6J8D6N3-F1-model_v4 | DDO (EC 1.4.3.1) | 0.9485 | 149 | 269 |
GO:0005782
GO:0008445 GO:0019478 GO:0071949 |
| AF-A0A7R8VM23-F1-model_v4 | FAD dependent oxidoreductase domain-containing protein | 0.9463 | 149 | 269 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A3D5DXS9-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9447 | 48 | 269 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A7R9LU67-F1-model_v4 | FAD dependent oxidoreductase domain-containing protein | 0.9441 | 132 | 269 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |