F297566

General Info

Members Datasets Scaffolds Average Seq Length
193 136 386 296

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0069495|Ga0466960_0069495_619_1584
Length 321
Sequence MTRVVVVGAGVVGLTCAVRLLEAGHEVGVVARDLPLETTSSAAAALWYPHRAYPFERVTAWAATTYRELAELAVDDATGVVMRTGTELFRAGRPDPWWASAVPHLAHETDVPTPYAAGLTFEAPVVEMPVYLRWLTARVEALGGTVTRIALSGLPDTAPVVVDAAGLGARLFARDGSVVPVRGQVVYVEQVGLDRWWLDGSGPTYVVPRARDIVVGGTEEEGAWDRNPDEATAKEILERARELVPALRAARVLGHRVGLRPARPTVRLEAATTAEGVRVVHCYGHGGAGVTLSWGCADEVAGLVEAQNSRSEGSSMPRSAS

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
74 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
75 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 2643221561 Nocardioides sp. Root151 Isolate Unclassified
125 2643221615 Nocardioides sp. Root224 Isolate Unclassified
126 2643221641 Nocardioides sp. Root122 Isolate Unclassified
127 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
128 2643221696 Nocardioides sp. Root140 Isolate Unclassified
129 2739367898 Nocardioides sp. CF479 Isolate Unclassified
130 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
131 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
132 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
133 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
134 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
135 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
136 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.26
Metatranscriptomes 0
Isolates 6.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.88
Nodule 0.52
Rhizoplane 7.25
Rhizosphere 75.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0069495 3300044901 Bacteria 1750
2 Ga0070658_10146791 3300005327 Bacteria 1973
3 Ga0070680_100039721 3300005336 Bacteria 3807
4 Ga0070682_100019989 3300005337 Bacteria 3935
5 Ga0068868_100073621 3300005338 Bacteria 2728
6 Ga0070691_10027470 3300005341 Bacteria 2655
7 Ga0070687_100028921 3300005343 Bacteria 2693
8 Ga0070692_10001148 3300005345 Bacteria 9309
9 Ga0070675_100060477 3300005354 Bacteria 3128
10 Ga0070659_100047290 3300005366 Bacteria 3374
11 Ga0070667_100078650 3300005367 Bacteria 2818
12 Ga0070714_100078646 3300005435 Bacteria 2867
13 Ga0070701_10011734 3300005438 Bacteria 3931
14 Ga0070700_100007023 3300005441 Bacteria 6048
15 Ga0070708_100256828 3300005445 Bacteria 1642
16 Ga0068867_100007932 3300005459 Bacteria 7499
17 Ga0070685_10038764 3300005466 Bacteria 2703
18 Ga0070707_100291659 3300005468 Bacteria 1585
19 Ga0070698_100002329 3300005471 Bacteria 21013
20 Ga0070684_100015481 3300005535 Bacteria 6211
21 Ga0068853_100022799 3300005539 Bacteria 5233
22 Ga0070672_100001435 3300005543 Bacteria 14737
23 Ga0068852_100001572 3300005616 Bacteria 15504
24 Ga0068864_100101570 3300005618 Bacteria 2551
25 Ga0068870_10014567 3300005840 Bacteria 3716
26 Ga0068870_10080807 3300005840 Bacteria 1797
27 Ga0068860_100072491 3300005843 Bacteria 3273
28 Ga0081539_10049427 3300005985 Bacteria 2386
29 Ga0075365_10001959 3300006038 Bacteria 9723
30 Ga0075365_10007337 3300006038 Bacteria 6166
31 Ga0075365_10007792 3300006038 Bacteria 6030
32 Ga0075365_10031818 3300006038 Bacteria 3386
33 Ga0075365_10035871 3300006038 Bacteria 3211
34 Ga0075365_10070823 3300006038 Bacteria 2346
35 Ga0075365_10078647 3300006038 Bacteria 2230
36 Ga0075365_10150217 3300006038 Bacteria 1620
37 Ga0075365_10208248 3300006038 Bacteria 1371
38 Ga0075363_100030852 3300006048 Bacteria 2777
39 Ga0075364_10082294 3300006051 Bacteria 2130
40 Ga0068865_100023338 3300006881 Bacteria 4050
41 Ga0105245_10047791 3300009098 Bacteria 3826
42 Ga0105245_10254876 3300009098 Bacteria 1706
43 Ga0105243_10002624 3300009148 Bacteria 14957
44 Ga0105242_10180267 3300009176 Bacteria 1863
45 Ga0105249_10008555 3300009553 Bacteria 8924
46 Ga0105239_10076381 3300010375 Bacteria 3684
47 Ga0105246_10148684 3300011119 Bacteria 1771
48 Ga0157372_10021693 3300013307 Bacteria 6942
49 Ga0157372_10121058 3300013307 Bacteria 3006
50 Ga0157372_10167253 3300013307 Bacteria 2543
51 Ga0157372_10518448 3300013307 Bacteria 1390
52 Ga0157375_10087192 3300013308 Bacteria 3173
53 Ga0163163_10230913 3300014325 Bacteria 1899
54 Ga0163163_10362137 3300014325 Bacteria 1507
55 Ga0157380_10011737 3300014326 Bacteria 6335
56 Ga0182008_10017597 3300014497 Bacteria 3706
57 Ga0157377_10023763 3300014745 Bacteria 3252
58 Ga0163161_10086640 3300017792 Bacteria 2312
59 Ga0163161_10313872 3300017792 Bacteria 1238
60 Ga0207643_10014825 3300025908 Bacteria 4239
61 Ga0207662_10013882 3300025918 Bacteria 4509
62 Ga0207657_10244226 3300025919 Bacteria 1433
63 Ga0207659_10081689 3300025926 Bacteria 2390
64 Ga0207687_10038907 3300025927 Bacteria 3253
65 Ga0207687_10134856 3300025927 Bacteria 1866
66 Ga0207690_10094888 3300025932 Bacteria 2118
67 Ga0207686_10024733 3300025934 Bacteria 3484
68 Ga0207709_10006669 3300025935 Bacteria 6474
69 Ga0207691_10021500 3300025940 Bacteria 6091
70 Ga0207640_10049415 3300025981 Bacteria 2723
71 Ga0207703_10404281 3300026035 Bacteria 1267
72 Ga0207678_10227140 3300026067 Bacteria 1598
73 Ga0207708_10009698 3300026075 Bacteria 7145
74 Ga0207648_10006174 3300026089 Bacteria 11936
75 Ga0207675_100005115 3300026118 Bacteria 12627
76 Ga0207675_100561686 3300026118 Bacteria 1141
77 Ga0207683_10036411 3300026121 Bacteria 4285
78 Ga0207683_10191562 3300026121 Bacteria 1857
79 Ga0207428_10077513 3300027907 Bacteria 2602
80 Ga0268264_10059428 3300028381 Bacteria 3203
81 Ga0307405_10107426 3300031731 Bacteria 1884
82 Ga0307406_10170103 3300031901 Bacteria 1576
83 Ga0307407_10011542 3300031903 Bacteria 4209
84 Ga0307409_100104244 3300031995 Bacteria 2361
85 Ga0307416_100022786 3300032002 Bacteria 4530
86 Ga0307414_10283687 3300032004 Bacteria 1393
87 Ga0307411_10091216 3300032005 Bacteria 2128
88 Ga0307415_100420945 3300032126 Bacteria 1146
89 Ga0395905_0222819 3300037471 Bacteria 1765
90 Ga0395901_0023720 3300038443 Bacteria 6291
91 Ga0451791_1704911 3300041451 Bacteria 1924
92 Ga0439445_0017354 3300042004 Bacteria 1779
93 Ga0439446_0007896 3300042156 Bacteria 2810
94 Ga0466969_0116606 3300044656 Bacteria 1246
95 Ga0466965_0013526 3300044683 Bacteria 3852
96 Ga0466961_0020674 3300044693 Bacteria 4236
97 Ga0466961_0094065 3300044693 Bacteria 1891
98 Ga0466961_0125616 3300044693 Bacteria 1610
99 Ga0466963_0217561 3300044694 Bacteria 1337
100 Ga0466963_0244586 3300044694 Bacteria 1258
101 Ga0466964_0008244 3300044706 Bacteria 3910
102 Ga0466971_0068042 3300044719 Bacteria 1615
103 Ga0466968_0121802 3300044735 Bacteria 1181
104 Ga0466970_0002049 3300044765 Bacteria 9758
105 Ga0466970_0048239 3300044765 Bacteria 2270
106 Ga0466970_0108146 3300044765 Bacteria 1518
107 Ga0466957_0013501 3300044842 Bacteria 4738
108 Ga0466957_0185899 3300044842 Bacteria 1359
109 Ga0466960_0000363 3300044901 Bacteria 15482
110 Ga0466960_0001952 3300044901 Bacteria 7623
111 Ga0466960_0016463 3300044901 Bacteria 3209
112 Ga0466960_0181893 3300044901 Bacteria 1140
113 Ga0466967_0089842 3300045976 Bacteria 2789
114 Ga0466967_0135551 3300045976 Bacteria 2289
115 Ga0495674_0375513 3300047319 Bacteria 1151
116 Ga0496100_0090606 3300048903 Bacteria 2085
117 Ga0496103_0041392 3300048906 Bacteria 2832
118 Ga0496107_0150423 3300048910 Bacteria 1722
119 Ga0496108_0109476 3300048911 Bacteria 2361
120 Ga0496109_0157361 3300048912 Bacteria 2128
121 Ga0496109_0423909 3300048912 Bacteria 1257
122 Ga0496110_0208183 3300048913 Bacteria 1777
123 Ga0496111_0078557 3300048914 Bacteria 2407
124 Ga0496113_0091633 3300048916 Bacteria 2343
125 Ga0496114_0186389 3300048917 Bacteria 1814
126 Ga0496114_0248094 3300048917 Bacteria 1566
127 Ga0496114_0519621 3300048917 Bacteria 1053
128 Ga0496115_0023003 3300048918 Bacteria 4834
129 Ga0501031_0083631 3300049568 Bacteria 2080
130 Ga0501031_0123132 3300049568 Bacteria 1694
131 Ga0501031_0136109 3300049568 Bacteria 1605
132 Ga0501032_0284473 3300049569 Bacteria 1070
133 Ga0501036_0018835 3300049572 Bacteria 5790
134 Ga0501036_0072883 3300049572 Bacteria 2903
135 Ga0501036_0134247 3300049572 Bacteria 2089
136 Ga0501039_0034667 3300049575 Bacteria 3894
137 Ga0501039_0066420 3300049575 Bacteria 2800
138 Ga0501039_0097277 3300049575 Bacteria 2295
139 Ga0501039_0128497 3300049575 Bacteria 1988
140 Ga0501040_0063722 3300049576 Bacteria 2537
141 Ga0501041_0053168 3300049577 Bacteria 2470
142 Ga0501042_0070238 3300049578 Bacteria 2505
143 Ga0501048_0179269 3300049582 Bacteria 1502
144 Ga0501067_0019765 3300049583 Bacteria 3728
145 Ga0501067_0034291 3300049583 Bacteria 2817
146 Ga0501067_0117493 3300049583 Bacteria 1479
147 Ga0501068_0037327 3300049584 Bacteria 2909
148 Ga0501068_0224104 3300049584 Bacteria 1195
149 Ga0501069_0068010 3300049585 Bacteria 1993
150 Ga0501069_0194628 3300049585 Bacteria 1174
151 Ga0501070_0377556 3300049586 Bacteria 1148
152 Ga0501071_0041650 3300049587 Bacteria 3289
153 Ga0501071_0061306 3300049587 Bacteria 2724
154 Ga0501071_0158860 3300049587 Bacteria 1689
155 Ga0501072_0133316 3300049588 Bacteria 1981
156 Ga0501072_0189461 3300049588 Bacteria 1641
157 Ga0501075_0314652 3300049591 Bacteria 1193
158 Ga0501076_0064922 3300049592 Bacteria 2910
159 Ga0501076_0179326 3300049592 Bacteria 1727
160 Ga0501076_0305880 3300049592 Bacteria 1304
161 Ga0501077_0156675 3300049593 Bacteria 1445
162 Ga0501045_0153389 3300049824 Bacteria 1714
163 Ga0501045_0175131 3300049824 Bacteria 1598
164 Ga0501045_0295670 3300049824 Bacteria 1205
165 Ga0501045_0326536 3300049824 Bacteria 1142
166 nmdc:mga03683_29225_c1 3300050489 Bacteria 2196
167 nmdc:mga00v17_61631_c1 3300050491 Bacteria 2306
168 nmdc:mga0yw44_104684_c1 3300050492 Bacteria 1807
169 nmdc:mga0yw44_10948_c1 3300050492 Bacteria 4653
170 nmdc:mga0yw44_1351_c1 3300050492 Bacteria 9723
171 nmdc:mga0yw44_149384_c1 3300050492 Bacteria 1523
172 nmdc:mga0yw44_33419_c1 3300050492 Bacteria 3005
173 nmdc:mga0yw44_90260_c1 3300050492 Bacteria 1935
174 nmdc:mga08y16_123694_c1 3300050511 Bacteria 2692
175 nmdc:mga08y16_400303_c1 3300050511 Bacteria 1405
176 Ga0500556_0000573 3300053104 Bacteria 24462
177 Ga0500593_000129 3300053117 Bacteria 29908
178 Ga0501084_0260715 3300054114 Bacteria 1463
179 Ga0466962_0058829 3300061719 Bacteria 1834
180 Ga0530510_0175167 3300061734 Bacteria 1590
181 2643828334 2643221561 Bacteria 4984412
182 2644090631 2643221615 Bacteria 5487866
183 2644230699 2643221641 Bacteria 4490190
184 2644320435 2643221657 Bacteria 5490246
185 2644535149 2643221696 Bacteria 5431823
186 2740167668 2739367898 Bacteria 4367674
187 2774396852 2773857762 Bacteria 5971770
188 2809198492 2808606439 Bacteria 5952208
189 2812349713 2811994878 Bacteria 5992952
190 2842890103 2842888712 Bacteria 4279094
191 2855390644 2855386786 Bacteria 4752232
192 2891969554 2891968417 Bacteria 5821697
193 8054613234 8054609563 Bacteria 5170090
194 Ga0466960_0069495
195 Ga0070658_10146791
196 Ga0070680_100039721
197 Ga0070682_100019989
198 Ga0068868_100073621
199 Ga0070691_10027470
200 Ga0070687_100028921
201 Ga0070692_10001148
202 Ga0070675_100060477
203 Ga0070659_100047290
204 Ga0070667_100078650
205 Ga0070714_100078646
206 Ga0070701_10011734
207 Ga0070700_100007023
208 Ga0070708_100256828
209 Ga0068867_100007932
210 Ga0070685_10038764
211 Ga0070707_100291659
212 Ga0070698_100002329
213 Ga0070684_100015481
214 Ga0068853_100022799
215 Ga0070672_100001435
216 Ga0068852_100001572
217 Ga0068864_100101570
218 Ga0068870_10014567
219 Ga0068870_10080807
220 Ga0068860_100072491
221 Ga0081539_10049427
222 Ga0075365_10001959
223 Ga0075365_10007337
224 Ga0075365_10007792
225 Ga0075365_10031818
226 Ga0075365_10035871
227 Ga0075365_10070823
228 Ga0075365_10078647
229 Ga0075365_10150217
230 Ga0075365_10208248
231 Ga0075363_100030852
232 Ga0075364_10082294
233 Ga0068865_100023338
234 Ga0105245_10047791
235 Ga0105245_10254876
236 Ga0105243_10002624
237 Ga0105242_10180267
238 Ga0105249_10008555
239 Ga0105239_10076381
240 Ga0105246_10148684
241 Ga0157372_10021693
242 Ga0157372_10121058
243 Ga0157372_10167253
244 Ga0157372_10518448
245 Ga0157375_10087192
246 Ga0163163_10230913
247 Ga0163163_10362137
248 Ga0157380_10011737
249 Ga0182008_10017597
250 Ga0157377_10023763
251 Ga0163161_10086640
252 Ga0163161_10313872
253 Ga0207643_10014825
254 Ga0207662_10013882
255 Ga0207657_10244226
256 Ga0207659_10081689
257 Ga0207687_10038907
258 Ga0207687_10134856
259 Ga0207690_10094888
260 Ga0207686_10024733
261 Ga0207709_10006669
262 Ga0207691_10021500
263 Ga0207640_10049415
264 Ga0207703_10404281
265 Ga0207678_10227140
266 Ga0207708_10009698
267 Ga0207648_10006174
268 Ga0207675_100005115
269 Ga0207675_100561686
270 Ga0207683_10036411
271 Ga0207683_10191562
272 Ga0207428_10077513
273 Ga0268264_10059428
274 Ga0307405_10107426
275 Ga0307406_10170103
276 Ga0307407_10011542
277 Ga0307409_100104244
278 Ga0307416_100022786
279 Ga0307414_10283687
280 Ga0307411_10091216
281 Ga0307415_100420945
282 Ga0395905_0222819
283 Ga0395901_0023720
284 Ga0451791_1704911
285 Ga0439445_0017354
286 Ga0439446_0007896
287 Ga0466969_0116606
288 Ga0466965_0013526
289 Ga0466961_0020674
290 Ga0466961_0094065
291 Ga0466961_0125616
292 Ga0466963_0217561
293 Ga0466963_0244586
294 Ga0466964_0008244
295 Ga0466971_0068042
296 Ga0466968_0121802
297 Ga0466970_0002049
298 Ga0466970_0048239
299 Ga0466970_0108146
300 Ga0466957_0013501
301 Ga0466957_0185899
302 Ga0466960_0000363
303 Ga0466960_0001952
304 Ga0466960_0016463
305 Ga0466960_0181893
306 Ga0466967_0089842
307 Ga0466967_0135551
308 Ga0495674_0375513
309 Ga0496100_0090606
310 Ga0496103_0041392
311 Ga0496107_0150423
312 Ga0496108_0109476
313 Ga0496109_0157361
314 Ga0496109_0423909
315 Ga0496110_0208183
316 Ga0496111_0078557
317 Ga0496113_0091633
318 Ga0496114_0186389
319 Ga0496114_0248094
320 Ga0496114_0519621
321 Ga0496115_0023003
322 Ga0501031_0083631
323 Ga0501031_0123132
324 Ga0501031_0136109
325 Ga0501032_0284473
326 Ga0501036_0018835
327 Ga0501036_0072883
328 Ga0501036_0134247
329 Ga0501039_0034667
330 Ga0501039_0066420
331 Ga0501039_0097277
332 Ga0501039_0128497
333 Ga0501040_0063722
334 Ga0501041_0053168
335 Ga0501042_0070238
336 Ga0501048_0179269
337 Ga0501067_0019765
338 Ga0501067_0034291
339 Ga0501067_0117493
340 Ga0501068_0037327
341 Ga0501068_0224104
342 Ga0501069_0068010
343 Ga0501069_0194628
344 Ga0501070_0377556
345 Ga0501071_0041650
346 Ga0501071_0061306
347 Ga0501071_0158860
348 Ga0501072_0133316
349 Ga0501072_0189461
350 Ga0501075_0314652
351 Ga0501076_0064922
352 Ga0501076_0179326
353 Ga0501076_0305880
354 Ga0501077_0156675
355 Ga0501045_0153389
356 Ga0501045_0175131
357 Ga0501045_0295670
358 Ga0501045_0326536
359 nmdc:mga03683_29225_c1
360 nmdc:mga00v17_61631_c1
361 nmdc:mga0yw44_104684_c1
362 nmdc:mga0yw44_10948_c1
363 nmdc:mga0yw44_1351_c1
364 nmdc:mga0yw44_149384_c1
365 nmdc:mga0yw44_33419_c1
366 nmdc:mga0yw44_90260_c1
367 nmdc:mga08y16_123694_c1
368 nmdc:mga08y16_400303_c1
369 Ga0500556_0000573
370 Ga0500593_000129
371 Ga0501084_0260715
372 Ga0466962_0058829
373 Ga0530510_0175167
374 2643828334
375 2644090631
376 2644230699
377 2644320435
378 2644535149
379 2740167668
380 2774396852
381 2809198492
382 2812349713
383 2842890103
384 2855390644
385 2891969554
386 8054613234

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

3

303

0.76

PF00890

FAD_binding_2

FAD binding domain

3

90

0.7

PF13241

NAD_binding_7

Putative NAD(P)-binding

1

88

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kmy-assembly4.cif.gz_M structure of mtb lpd bound to 010705 1.003 2 27
7bke-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodisulfide reductase core and mobile arm in conformational state 2, composite structure) 0.9877 2 29
6de6-assembly1.cif.gz_B 2.1 a resolution structure of histamine dehydrogenase from rhizobium sp. 4-9 0.986 2 29
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 0.9858 2 27
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9847 2 29
ID Description Score Start End Superfamily
af_Q2G1C9_1_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.008 2 28 3.40.50.720
af_Q2FYF3_156_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.006 2 29 3.50.50.60
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.005 2 29 3.50.50.60
2bc1B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9982 2 28 3.50.50.60
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9975 2 28 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2G6DU87-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.951 131 269 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A6J8D6N3-F1-model_v4 DDO (EC 1.4.3.1) 0.9485 149 269 GO:0005782
GO:0008445
GO:0019478
GO:0071949
AF-A0A7R8VM23-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9463 149 269 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A3D5DXS9-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9447 48 269 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A7R9LU67-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9441 132 269 GO:0003884
GO:0005737
GO:0019478
GO:0071949

Map