F297397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 119 | 193 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300032005|Ga0307411_10186701|Ga0307411_101867011 |
| Length | 392 |
| Sequence | MYPVLLHFEFEIRVSRTNFSKFQVWMVCLGCAFLPHFWLNSLKKSIIQIFKIMSNSISYSDAGVSIDNANLAVEKIKNYAKRTFNERTLTEIGSFGGMFSGAFPDMAEPILVASADGVGTKLKIAFDTGIHNTIGQDLVNHCVNDILVQGARPLFFLDYFATGVLSPDVTASVVEGISIACKENGCVLLGGETAEMPGFYADGEYDLAGFIVGVVDKRRVIDGKSIKPGDVVLGLPASGLQTNGYSLARKLFFEVGGYEVDTYLDELGSTVGEALLEKHASFLKPLENLLDSGKIKGLAHITGGGFLENIPRILPENVSVEIKRGTWEEPSIFGLMQKLGNVAESEMFRTFNMGIGMIVICGETDKDFLKENLGTSFEIGRLIEGNKEVAIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 87 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 89 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 90 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 102 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 103 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 104 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 105 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 106 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 111 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 113 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 114 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 115 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 116 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.04 |
| Rhizosphere | 97.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_203960 | 2162886007 | Bacteria | 2374 |
| 2 | Ga0065704_10001172 | 3300005289 | Bacteria | 19999 |
| 3 | Ga0065704_10088713 | 3300005289 | Bacteria | 2916 |
| 4 | Ga0065715_10006849 | 3300005293 | Bacteria | 3230 |
| 5 | Ga0070658_10006915 | 3300005327 | Bacteria | 9160 |
| 6 | Ga0070690_100038512 | 3300005330 | Bacteria | 3018 |
| 7 | Ga0070670_100010176 | 3300005331 | Bacteria | 8025 |
| 8 | Ga0070670_100024537 | 3300005331 | Bacteria | 5184 |
| 9 | Ga0068869_100243715 | 3300005334 | Bacteria | 1433 |
| 10 | Ga0068869_100329492 | 3300005334 | Unclassified | 1240 |
| 11 | Ga0070682_100000051 | 3300005337 | Bacteria | 123476 |
| 12 | Ga0068868_100012158 | 3300005338 | Bacteria | 6286 |
| 13 | Ga0070689_100034476 | 3300005340 | Bacteria | 3862 |
| 14 | Ga0070689_100139758 | 3300005340 | Bacteria | 1947 |
| 15 | Ga0070661_100186215 | 3300005344 | Bacteria | 1582 |
| 16 | Ga0070668_100046988 | 3300005347 | Bacteria | 3317 |
| 17 | Ga0070675_100071761 | 3300005354 | Unclassified | 2873 |
| 18 | Ga0070671_100075353 | 3300005355 | Bacteria | 2818 |
| 19 | Ga0070671_100093145 | 3300005355 | Unclassified | 2525 |
| 20 | Ga0070671_100177917 | 3300005355 | Bacteria | 1800 |
| 21 | Ga0070673_100046978 | 3300005364 | Bacteria | 3357 |
| 22 | Ga0070667_100070382 | 3300005367 | Bacteria | 2978 |
| 23 | Ga0070700_100016391 | 3300005441 | Unclassified | 4221 |
| 24 | Ga0070662_100040882 | 3300005457 | Bacteria | 3304 |
| 25 | Ga0070662_100302601 | 3300005457 | Bacteria | 1300 |
| 26 | Ga0070681_10023466 | 3300005458 | Bacteria | 6204 |
| 27 | Ga0070706_100123990 | 3300005467 | Bacteria | 2408 |
| 28 | Ga0070679_100021306 | 3300005530 | Bacteria | 6326 |
| 29 | Ga0068853_100005720 | 3300005539 | Bacteria | 9784 |
| 30 | Ga0068853_100113715 | 3300005539 | Unclassified | 2407 |
| 31 | Ga0068853_100124788 | 3300005539 | Bacteria | 2299 |
| 32 | Ga0070672_100136522 | 3300005543 | Bacteria | 2020 |
| 33 | Ga0070672_100382651 | 3300005543 | Bacteria | 1204 |
| 34 | Ga0070704_100030530 | 3300005549 | Bacteria | 3612 |
| 35 | Ga0068855_100442647 | 3300005563 | Unclassified | 1419 |
| 36 | Ga0070664_100047450 | 3300005564 | Unclassified | 3628 |
| 37 | Ga0070664_100099550 | 3300005564 | Unclassified | 2527 |
| 38 | Ga0070664_100210769 | 3300005564 | Unclassified | 1736 |
| 39 | Ga0068854_100051427 | 3300005578 | Bacteria | 2952 |
| 40 | Ga0068854_100257881 | 3300005578 | Bacteria | 1395 |
| 41 | Ga0068852_100037633 | 3300005616 | Unclassified | 4058 |
| 42 | Ga0068859_100170570 | 3300005617 | Bacteria | 2257 |
| 43 | Ga0068864_100008627 | 3300005618 | Bacteria | 8411 |
| 44 | Ga0068864_100045558 | 3300005618 | Bacteria | 3762 |
| 45 | Ga0068864_100163720 | 3300005618 | Bacteria | 2023 |
| 46 | Ga0068870_10024772 | 3300005840 | Bacteria | 2971 |
| 47 | Ga0068863_100018391 | 3300005841 | Bacteria | 6688 |
| 48 | Ga0068860_100021363 | 3300005843 | Bacteria | 6267 |
| 49 | Ga0068860_100287646 | 3300005843 | Bacteria | 1608 |
| 50 | Ga0068860_100421446 | 3300005843 | Bacteria | 1323 |
| 51 | Ga0068862_100020183 | 3300005844 | Bacteria | 5565 |
| 52 | Ga0068862_100088469 | 3300005844 | Bacteria | 2695 |
| 53 | Ga0068862_100208329 | 3300005844 | Bacteria | 1766 |
| 54 | Ga0097621_100178220 | 3300006237 | Unclassified | 1835 |
| 55 | Ga0068871_100121557 | 3300006358 | Unclassified | 2206 |
| 56 | Ga0068871_100221044 | 3300006358 | Bacteria | 1641 |
| 57 | Ga0075433_10119052 | 3300006852 | Bacteria | 2344 |
| 58 | Ga0097620_100170559 | 3300006931 | Bacteria | 2257 |
| 59 | Ga0105240_10048127 | 3300009093 | Bacteria | 5391 |
| 60 | Ga0111539_10000931 | 3300009094 | Bacteria | 38341 |
| 61 | Ga0111539_10061785 | 3300009094 | Bacteria | 4437 |
| 62 | Ga0105247_10007593 | 3300009101 | Bacteria | 6642 |
| 63 | Ga0114129_10141382 | 3300009147 | Bacteria | 3299 |
| 64 | Ga0114129_10494950 | 3300009147 | Bacteria | 1597 |
| 65 | Ga0105241_10037068 | 3300009174 | Bacteria | 3672 |
| 66 | Ga0105248_10013748 | 3300009177 | Bacteria | 8910 |
| 67 | Ga0105248_10509317 | 3300009177 | Unclassified | 1357 |
| 68 | Ga0105249_10002101 | 3300009553 | Bacteria | 17281 |
| 69 | Ga0105249_10083013 | 3300009553 | Bacteria | 2982 |
| 70 | Ga0157373_10088057 | 3300013100 | Bacteria | 2188 |
| 71 | Ga0157370_10307008 | 3300013104 | Bacteria | 1464 |
| 72 | Ga0157378_10341766 | 3300013297 | Bacteria | 1460 |
| 73 | Ga0163162_10037755 | 3300013306 | Bacteria | 4821 |
| 74 | Ga0163162_10103433 | 3300013306 | Bacteria | 2942 |
| 75 | Ga0157372_10039630 | 3300013307 | Bacteria | 5200 |
| 76 | Ga0157372_10052750 | 3300013307 | Bacteria | 4529 |
| 77 | Ga0157372_10105099 | 3300013307 | Bacteria | 3230 |
| 78 | Ga0157372_10207889 | 3300013307 | Bacteria | 2268 |
| 79 | Ga0157375_10110099 | 3300013308 | Bacteria | 2851 |
| 80 | Ga0157375_10203456 | 3300013308 | Bacteria | 2136 |
| 81 | Ga0163163_10026126 | 3300014325 | Bacteria | 5576 |
| 82 | Ga0163163_10117940 | 3300014325 | Bacteria | 2686 |
| 83 | Ga0163163_10204365 | 3300014325 | Bacteria | 2024 |
| 84 | Ga0163163_10365739 | 3300014325 | Bacteria | 1499 |
| 85 | Ga0157380_10001887 | 3300014326 | Bacteria | 13902 |
| 86 | Ga0157380_10002797 | 3300014326 | Bacteria | 11862 |
| 87 | Ga0157380_10142897 | 3300014326 | Bacteria | 2058 |
| 88 | Ga0157379_10192080 | 3300014968 | Bacteria | 1845 |
| 89 | Ga0163161_10001586 | 3300017792 | Bacteria | 16768 |
| 90 | Ga0213876_10015863 | 3300021384 | Bacteria | 3987 |
| 91 | Ga0207710_10003668 | 3300025900 | Bacteria | 6813 |
| 92 | Ga0207643_10076113 | 3300025908 | Unclassified | 1938 |
| 93 | Ga0207705_10021849 | 3300025909 | Bacteria | 4565 |
| 94 | Ga0207654_10024675 | 3300025911 | Bacteria | 3235 |
| 95 | Ga0207649_10098824 | 3300025920 | Bacteria | 1927 |
| 96 | Ga0207652_10033987 | 3300025921 | Bacteria | 4295 |
| 97 | Ga0207650_10002699 | 3300025925 | Bacteria | 12263 |
| 98 | Ga0207650_10075374 | 3300025925 | Bacteria | 2546 |
| 99 | Ga0207650_10102071 | 3300025925 | Bacteria | 2209 |
| 100 | Ga0207650_10127029 | 3300025925 | Bacteria | 1991 |
| 101 | Ga0207659_10052158 | 3300025926 | Unclassified | 2912 |
| 102 | Ga0207706_10220117 | 3300025933 | Bacteria | 1662 |
| 103 | Ga0207670_10113260 | 3300025936 | Bacteria | 1959 |
| 104 | Ga0207691_10009661 | 3300025940 | Bacteria | 9253 |
| 105 | Ga0207711_10087266 | 3300025941 | Unclassified | 2737 |
| 106 | Ga0207711_10131270 | 3300025941 | Bacteria | 2246 |
| 107 | Ga0207689_10356489 | 3300025942 | Unclassified | 1216 |
| 108 | Ga0207679_10050967 | 3300025945 | Bacteria | 3028 |
| 109 | Ga0207679_10069360 | 3300025945 | Unclassified | 2652 |
| 110 | Ga0207679_10118481 | 3300025945 | Bacteria | 2103 |
| 111 | Ga0207679_10189897 | 3300025945 | Unclassified | 1707 |
| 112 | Ga0207651_10014969 | 3300025960 | Bacteria | 4494 |
| 113 | Ga0207712_10002003 | 3300025961 | Bacteria | 13381 |
| 114 | Ga0207712_10005668 | 3300025961 | Bacteria | 7877 |
| 115 | Ga0207712_10051178 | 3300025961 | Bacteria | 2887 |
| 116 | Ga0207640_10117062 | 3300025981 | Bacteria | 1901 |
| 117 | Ga0207639_10002305 | 3300026041 | Bacteria | 12811 |
| 118 | Ga0207678_10111452 | 3300026067 | Bacteria | 2334 |
| 119 | Ga0207708_10028395 | 3300026075 | Unclassified | 4237 |
| 120 | Ga0207641_10072200 | 3300026088 | Bacteria | 2972 |
| 121 | Ga0207676_10054377 | 3300026095 | Bacteria | 3138 |
| 122 | Ga0207676_10076036 | 3300026095 | Bacteria | 2711 |
| 123 | Ga0207676_10119299 | 3300026095 | Bacteria | 2221 |
| 124 | Ga0207676_10212996 | 3300026095 | Unclassified | 1715 |
| 125 | Ga0207676_10285430 | 3300026095 | Unclassified | 1500 |
| 126 | Ga0207674_10267830 | 3300026116 | Bacteria | 1656 |
| 127 | Ga0207698_10078751 | 3300026142 | Bacteria | 2648 |
| 128 | Ga0207428_10000547 | 3300027907 | Bacteria | 44826 |
| 129 | Ga0207428_10087960 | 3300027907 | Bacteria | 2416 |
| 130 | Ga0268265_10079515 | 3300028380 | Bacteria | 2582 |
| 131 | Ga0268264_10005354 | 3300028381 | Bacteria | 10877 |
| 132 | Ga0268264_10009949 | 3300028381 | Bacteria | 7874 |
| 133 | Ga0268264_10575803 | 3300028381 | Bacteria | 1107 |
| 134 | Ga0265338_10037560 | 3300028800 | Bacteria | 4607 |
| 135 | Ga0307513_10142031 | 3300031456 | Bacteria | 2326 |
| 136 | Ga0307408_100017111 | 3300031548 | Bacteria | 4850 |
| 137 | Ga0307405_10099974 | 3300031731 | Unclassified | 1943 |
| 138 | Ga0307413_10005340 | 3300031824 | Bacteria | 5721 |
| 139 | Ga0307410_10005878 | 3300031852 | Bacteria | 6553 |
| 140 | Ga0307410_10010577 | 3300031852 | Bacteria | 5234 |
| 141 | Ga0307410_10023070 | 3300031852 | Bacteria | 3861 |
| 142 | Ga0307410_10042499 | 3300031852 | Bacteria | 3005 |
| 143 | Ga0307410_10051401 | 3300031852 | Unclassified | 2777 |
| 144 | Ga0307410_10068870 | 3300031852 | Unclassified | 2446 |
| 145 | Ga0307406_10003651 | 3300031901 | Bacteria | 8381 |
| 146 | Ga0307406_10017966 | 3300031901 | Bacteria | 4125 |
| 147 | Ga0307406_10110265 | 3300031901 | Bacteria | 1893 |
| 148 | Ga0307407_10004151 | 3300031903 | Bacteria | 6104 |
| 149 | Ga0307412_10165784 | 3300031911 | Bacteria | 1647 |
| 150 | Ga0307409_100003339 | 3300031995 | Bacteria | 8687 |
| 151 | Ga0307409_100325301 | 3300031995 | Bacteria | 1441 |
| 152 | Ga0307416_100008990 | 3300032002 | Bacteria | 6499 |
| 153 | Ga0307416_100028423 | 3300032002 | Unclassified | 4158 |
| 154 | Ga0307416_100040306 | 3300032002 | Bacteria | 3626 |
| 155 | Ga0307416_100059903 | 3300032002 | Unclassified | 3097 |
| 156 | Ga0307416_100275339 | 3300032002 | Bacteria | 1655 |
| 157 | Ga0307414_10000900 | 3300032004 | Bacteria | 15232 |
| 158 | Ga0307414_10011349 | 3300032004 | Bacteria | 5220 |
| 159 | Ga0307414_10049421 | 3300032004 | Bacteria | 2908 |
| 160 | Ga0307414_10131163 | 3300032004 | Bacteria | 1946 |
| 161 | Ga0307411_10010052 | 3300032005 | Bacteria | 5019 |
| 162 | Ga0307411_10088365 | 3300032005 | Bacteria | 2155 |
| 163 | Ga0307411_10102403 | 3300032005 | Bacteria | 2029 |
| 164 | Ga0307411_10186701 | 3300032005 | Bacteria | 1579 |
| 165 | Ga0307415_100000562 | 3300032126 | Bacteria | 16294 |
| 166 | Ga0307415_100004056 | 3300032126 | Bacteria | 7555 |
| 167 | Ga0307415_100016310 | 3300032126 | Unclassified | 4425 |
| 168 | Ga0307415_100189954 | 3300032126 | Bacteria | 1620 |
| 169 | Ga0395898_0532550 | 3300037466 | Bacteria | 1116 |
| 170 | Ga0395905_0209291 | 3300037471 | Unclassified | 1827 |
| 171 | Ga0395901_0251294 | 3300038443 | Bacteria | 1842 |
| 172 | Ga0436365_1113263 | 3300039437 | Bacteria | 5223 |
| 173 | Ga0451791_0127037 | 3300041451 | Unclassified | 1089 |
| 174 | Ga0439432_046090 | 3300042006 | Unclassified | 1370 |
| 175 | Ga0453684_0008644 | 3300044712 | Bacteria | 18132 |
| 176 | Ga0453684_0012014 | 3300044712 | Bacteria | 14399 |
| 177 | Ga0451576_0001145 | 3300045051 | Bacteria | 47877 |
| 178 | Ga0495632_0051546 | 3300046519 | Bacteria | 2025 |
| 179 | Ga0495598_0004751 | 3300046537 | Bacteria | 2964 |
| 180 | Ga0495621_0033697 | 3300046539 | Bacteria | 1767 |
| 181 | Ga0495668_0001155 | 3300046616 | Bacteria | 26983 |
| 182 | Ga0496109_0309652 | 3300048912 | Unclassified | 1490 |
| 183 | Ga0501072_0002670 | 3300049588 | Bacteria | 13372 |
| 184 | Ga0501198_002785 | 3300049649 | Unclassified | 2368 |
| 185 | Ga0501217_004661 | 3300049661 | Unclassified | 2827 |
| 186 | Ga0501221_008391 | 3300049704 | Unclassified | 1795 |
| 187 | Ga0501225_0006357 | 3300049705 | Unclassified | 3453 |
| 188 | nmdc:mga06r32_187571_c1 | 3300050510 | Bacteria | 2055 |
| 189 | nmdc:mga06r32_306593_c1 | 3300050510 | Bacteria | 1573 |
| 190 | nmdc:mga08y16_170598_c1 | 3300050511 | Bacteria | 2260 |
| 191 | nmdc:mga08y16_5249_c1 | 3300050511 | Bacteria | 13531 |
| 192 | nmdc:mga0a205_29859_c1 | 3300050515 | Bacteria | 2335 |
| 193 | Ga0495601_0173640 | 3300053077 | Unclassified | 1409 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10061785 | Ga0111539_100617853 | 325 |
| 2 | 3300027907 | Ga0207428_10087960 | Ga0207428_100879602 | 325 |
| 3 | 3300050511 | nmdc:mga08y16_170598_c1 | nmdc:mga08y16_170598_c1_715_1731 | 325 |
| 4 | 3300009177 | Ga0105248_10509317 | Ga0105248_105093171 | 328 |
| 5 | 3300025941 | Ga0207711_10087266 | Ga0207711_100872664 | 328 |
| 6 | 3300026095 | Ga0207676_10212996 | Ga0207676_102129963 | 328 |
| 7 | 3300005338 | Ga0068868_100012158 | Ga0068868_1000121587 | 329 |
| 8 | 3300005355 | Ga0070671_100075353 | Ga0070671_1000753534 | 329 |
| 9 | 3300006237 | Ga0097621_100178220 | Ga0097621_1001782202 | 329 |
| 10 | 3300014325 | Ga0163163_10026126 | Ga0163163_100261262 | 329 |
| 11 | 3300026095 | Ga0207676_10285430 | Ga0207676_102854301 | 329 |
| 12 | 3300005347 | Ga0070668_100046988 | Ga0070668_1000469883 | 330 |
| 13 | 3300005843 | Ga0068860_100021363 | Ga0068860_1000213638 | 330 |
| 14 | 3300005844 | Ga0068862_100020183 | Ga0068862_1000201833 | 330 |
| 15 | 3300009101 | Ga0105247_10007593 | Ga0105247_100075935 | 330 |
| 16 | 3300014968 | Ga0157379_10192080 | Ga0157379_101920802 | 330 |
| 17 | 3300025900 | Ga0207710_10003668 | Ga0207710_100036688 | 330 |
| 18 | 3300025911 | Ga0207654_10024675 | Ga0207654_100246753 | 330 |
| 19 | 3300025961 | Ga0207712_10002003 | Ga0207712_1000200310 | 330 |
| 20 | 3300025961 | Ga0207712_10005668 | Ga0207712_100056686 | 330 |
| 21 | 3300028381 | Ga0268264_10005354 | Ga0268264_100053545 | 330 |
| 22 | 3300048912 | Ga0496109_0309652 | Ga0496109_0309652_212_1255 | 330 |
| 23 | 3300013308 | Ga0157375_10110099 | Ga0157375_101100993 | 333 |
| 24 | 3300009177 | Ga0105248_10013748 | Ga0105248_100137483 | 334 |
| 25 | 3300025941 | Ga0207711_10131270 | Ga0207711_101312702 | 334 |
| 26 | 3300013297 | Ga0157378_10341766 | Ga0157378_103417662 | 336 |
| 27 | 3300014326 | Ga0157380_10142897 | Ga0157380_101428974 | 337 |
| 28 | 3300005458 | Ga0070681_10023466 | Ga0070681_100234664 | 338 |
| 29 | 3300005530 | Ga0070679_100021306 | Ga0070679_1000213065 | 338 |
| 30 | 3300009093 | Ga0105240_10048127 | Ga0105240_100481273 | 338 |
| 31 | 3300025921 | Ga0207652_10033987 | Ga0207652_100339872 | 338 |
| 32 | 3300042006 | Ga0439432_046090 | Ga0439432_046090_40_1065 | 338 |
| 33 | 3300005327 | Ga0070658_10006915 | Ga0070658_100069158 | 339 |
| 34 | 3300005331 | Ga0070670_100010176 | Ga0070670_1000101764 | 339 |
| 35 | 3300005331 | Ga0070670_100024537 | Ga0070670_1000245374 | 339 |
| 36 | 3300005340 | Ga0070689_100034476 | Ga0070689_1000344764 | 339 |
| 37 | 3300005340 | Ga0070689_100139758 | Ga0070689_1001397582 | 339 |
| 38 | 3300005344 | Ga0070661_100186215 | Ga0070661_1001862152 | 339 |
| 39 | 3300005354 | Ga0070675_100071761 | Ga0070675_1000717613 | 339 |
| 40 | 3300005355 | Ga0070671_100093145 | Ga0070671_1000931452 | 339 |
| 41 | 3300005355 | Ga0070671_100177917 | Ga0070671_1001779172 | 339 |
| 42 | 3300005367 | Ga0070667_100070382 | Ga0070667_1000703822 | 339 |
| 43 | 3300005457 | Ga0070662_100040882 | Ga0070662_1000408822 | 339 |
| 44 | 3300005457 | Ga0070662_100302601 | Ga0070662_1003026012 | 339 |
| 45 | 3300005539 | Ga0068853_100005720 | Ga0068853_1000057202 | 339 |
| 46 | 3300005539 | Ga0068853_100113715 | Ga0068853_1001137152 | 339 |
| 47 | 3300005539 | Ga0068853_100124788 | Ga0068853_1001247883 | 339 |
| 48 | 3300005543 | Ga0070672_100382651 | Ga0070672_1003826512 | 339 |
| 49 | 3300005563 | Ga0068855_100442647 | Ga0068855_1004426471 | 339 |
| 50 | 3300005564 | Ga0070664_100047450 | Ga0070664_1000474503 | 339 |
| 51 | 3300005564 | Ga0070664_100099550 | Ga0070664_1000995502 | 339 |
| 52 | 3300005564 | Ga0070664_100210769 | Ga0070664_1002107692 | 339 |
| 53 | 3300005578 | Ga0068854_100051427 | Ga0068854_1000514272 | 339 |
| 54 | 3300005616 | Ga0068852_100037633 | Ga0068852_1000376332 | 339 |
| 55 | 3300005618 | Ga0068864_100008627 | Ga0068864_1000086272 | 339 |
| 56 | 3300005618 | Ga0068864_100045558 | Ga0068864_1000455583 | 339 |
| 57 | 3300005618 | Ga0068864_100163720 | Ga0068864_1001637202 | 339 |
| 58 | 3300005841 | Ga0068863_100018391 | Ga0068863_1000183916 | 339 |
| 59 | 3300005843 | Ga0068860_100287646 | Ga0068860_1002876461 | 339 |
| 60 | 3300005843 | Ga0068860_100421446 | Ga0068860_1004214462 | 339 |
| 61 | 3300006358 | Ga0068871_100121557 | Ga0068871_1001215572 | 339 |
| 62 | 3300006358 | Ga0068871_100221044 | Ga0068871_1002210442 | 339 |
| 63 | 3300009174 | Ga0105241_10037068 | Ga0105241_100370685 | 339 |
| 64 | 3300009553 | Ga0105249_10002101 | Ga0105249_100021016 | 339 |
| 65 | 3300013104 | Ga0157370_10307008 | Ga0157370_103070081 | 339 |
| 66 | 3300013306 | Ga0163162_10037755 | Ga0163162_100377555 | 339 |
| 67 | 3300013306 | Ga0163162_10103433 | Ga0163162_101034332 | 339 |
| 68 | 3300013307 | Ga0157372_10039630 | Ga0157372_100396307 | 339 |
| 69 | 3300013307 | Ga0157372_10052750 | Ga0157372_100527505 | 339 |
| 70 | 3300013307 | Ga0157372_10105099 | Ga0157372_101050992 | 339 |
| 71 | 3300013307 | Ga0157372_10207889 | Ga0157372_102078893 | 339 |
| 72 | 3300013308 | Ga0157375_10203456 | Ga0157375_102034563 | 339 |
| 73 | 3300014325 | Ga0163163_10117940 | Ga0163163_101179402 | 339 |
| 74 | 3300014325 | Ga0163163_10204365 | Ga0163163_102043652 | 339 |
| 75 | 3300014325 | Ga0163163_10365739 | Ga0163163_103657392 | 339 |
| 76 | 3300017792 | Ga0163161_10001586 | Ga0163161_1000158612 | 339 |
| 77 | 3300025909 | Ga0207705_10021849 | Ga0207705_100218494 | 339 |
| 78 | 3300025920 | Ga0207649_10098824 | Ga0207649_100988242 | 339 |
| 79 | 3300025925 | Ga0207650_10002699 | Ga0207650_100026992 | 339 |
| 80 | 3300025925 | Ga0207650_10102071 | Ga0207650_101020712 | 339 |
| 81 | 3300025926 | Ga0207659_10052158 | Ga0207659_100521582 | 339 |
| 82 | 3300025933 | Ga0207706_10220117 | Ga0207706_102201172 | 339 |
| 83 | 3300025936 | Ga0207670_10113260 | Ga0207670_101132602 | 339 |
| 84 | 3300025940 | Ga0207691_10009661 | Ga0207691_100096619 | 339 |
| 85 | 3300025945 | Ga0207679_10050967 | Ga0207679_100509673 | 339 |
| 86 | 3300025945 | Ga0207679_10069360 | Ga0207679_100693602 | 339 |
| 87 | 3300025945 | Ga0207679_10118481 | Ga0207679_101184812 | 339 |
| 88 | 3300025945 | Ga0207679_10189897 | Ga0207679_101898972 | 339 |
| 89 | 3300025981 | Ga0207640_10117062 | Ga0207640_101170622 | 339 |
| 90 | 3300026041 | Ga0207639_10002305 | Ga0207639_1000230513 | 339 |
| 91 | 3300026067 | Ga0207678_10111452 | Ga0207678_101114522 | 339 |
| 92 | 3300026088 | Ga0207641_10072200 | Ga0207641_100722002 | 339 |
| 93 | 3300026095 | Ga0207676_10054377 | Ga0207676_100543771 | 339 |
| 94 | 3300026095 | Ga0207676_10076036 | Ga0207676_100760361 | 339 |
| 95 | 3300026095 | Ga0207676_10119299 | Ga0207676_101192993 | 339 |
| 96 | 3300026116 | Ga0207674_10267830 | Ga0207674_102678302 | 339 |
| 97 | 3300026142 | Ga0207698_10078751 | Ga0207698_100787513 | 339 |
| 98 | 3300028381 | Ga0268264_10009949 | Ga0268264_100099492 | 339 |
| 99 | 3300028381 | Ga0268264_10575803 | Ga0268264_105758031 | 339 |
| 100 | 3300028800 | Ga0265338_10037560 | Ga0265338_100375603 | 339 |
| 101 | 3300031548 | Ga0307408_100017111 | Ga0307408_1000171112 | 339 |
| 102 | 3300031731 | Ga0307405_10099974 | Ga0307405_100999742 | 339 |
| 103 | 3300031824 | Ga0307413_10005340 | Ga0307413_100053404 | 339 |
| 104 | 3300031852 | Ga0307410_10005878 | Ga0307410_100058787 | 339 |
| 105 | 3300031852 | Ga0307410_10010577 | Ga0307410_100105772 | 339 |
| 106 | 3300031852 | Ga0307410_10023070 | Ga0307410_100230704 | 339 |
| 107 | 3300031852 | Ga0307410_10042499 | Ga0307410_100424994 | 339 |
| 108 | 3300031852 | Ga0307410_10051401 | Ga0307410_100514012 | 339 |
| 109 | 3300031852 | Ga0307410_10068870 | Ga0307410_100688702 | 339 |
| 110 | 3300031901 | Ga0307406_10003651 | Ga0307406_100036516 | 339 |
| 111 | 3300031901 | Ga0307406_10017966 | Ga0307406_100179664 | 339 |
| 112 | 3300031901 | Ga0307406_10110265 | Ga0307406_101102652 | 339 |
| 113 | 3300031903 | Ga0307407_10004151 | Ga0307407_100041516 | 339 |
| 114 | 3300031995 | Ga0307409_100003339 | Ga0307409_1000033395 | 339 |
| 115 | 3300031995 | Ga0307409_100325301 | Ga0307409_1003253012 | 339 |
| 116 | 3300032002 | Ga0307416_100008990 | Ga0307416_1000089905 | 339 |
| 117 | 3300032002 | Ga0307416_100028423 | Ga0307416_1000284235 | 339 |
| 118 | 3300032002 | Ga0307416_100040306 | Ga0307416_1000403064 | 339 |
| 119 | 3300032002 | Ga0307416_100275339 | Ga0307416_1002753391 | 339 |
| 120 | 3300032004 | Ga0307414_10000900 | Ga0307414_1000090012 | 339 |
| 121 | 3300032004 | Ga0307414_10011349 | Ga0307414_100113495 | 339 |
| 122 | 3300032004 | Ga0307414_10049421 | Ga0307414_100494213 | 339 |
| 123 | 3300032004 | Ga0307414_10131163 | Ga0307414_101311632 | 339 |
| 124 | 3300032005 | Ga0307411_10010052 | Ga0307411_100100523 | 339 |
| 125 | 3300032005 | Ga0307411_10088365 | Ga0307411_100883652 | 339 |
| 126 | 3300032005 | Ga0307411_10102403 | Ga0307411_101024032 | 339 |
| 127 | 3300032005 | Ga0307411_10186701 | Ga0307411_101867011 | 339 |
| 128 | 3300032126 | Ga0307415_100000562 | Ga0307415_10000056211 | 339 |
| 129 | 3300032126 | Ga0307415_100004056 | Ga0307415_1000040567 | 339 |
| 130 | 3300032126 | Ga0307415_100016310 | Ga0307415_1000163105 | 339 |
| 131 | 3300032126 | Ga0307415_100189954 | Ga0307415_1001899542 | 339 |
| 132 | 3300037471 | Ga0395905_0209291 | Ga0395905_0209291_430_1452 | 339 |
| 133 | 3300041451 | Ga0451791_0127037 | Ga0451791_0127037_45_1067 | 339 |
| 134 | 3300046537 | Ga0495598_0004751 | Ga0495598_0004751_379_1401 | 339 |
| 135 | 3300046539 | Ga0495621_0033697 | Ga0495621_0033697_527_1564 | 339 |
| 136 | 3300046616 | Ga0495668_0001155 | Ga0495668_0001155_14170_15192 | 339 |
| 137 | 3300049588 | Ga0501072_0002670 | Ga0501072_0002670_10353_11375 | 339 |
| 138 | 3300049649 | Ga0501198_002785 | Ga0501198_002785_1155_2174 | 339 |
| 139 | 3300049661 | Ga0501217_004661 | Ga0501217_004661_806_1825 | 339 |
| 140 | 3300049704 | Ga0501221_008391 | Ga0501221_008391_222_1241 | 339 |
| 141 | 3300049705 | Ga0501225_0006357 | Ga0501225_0006357_1264_2283 | 339 |
| 142 | 3300050510 | nmdc:mga06r32_187571_c1 | nmdc:mga06r32_187571_c1_393_1415 | 339 |
| 143 | 3300053077 | Ga0495601_0173640 | Ga0495601_0173640_151_1179 | 339 |
| 144 | 3300009147 | Ga0114129_10141382 | Ga0114129_101413823 | 340 |
| 145 | 3300025908 | Ga0207643_10076113 | Ga0207643_100761131 | 342 |
| 146 | 2162886007 | SwRhRL2b_contig_203960 | SwRhRL2b_0130.00007220 | 343 |
| 147 | 3300005289 | Ga0065704_10001172 | Ga0065704_100011727 | 343 |
| 148 | 3300005289 | Ga0065704_10088713 | Ga0065704_100887132 | 343 |
| 149 | 3300005293 | Ga0065715_10006849 | Ga0065715_100068494 | 343 |
| 150 | 3300005330 | Ga0070690_100038512 | Ga0070690_1000385122 | 343 |
| 151 | 3300005334 | Ga0068869_100243715 | Ga0068869_1002437152 | 343 |
| 152 | 3300005334 | Ga0068869_100329492 | Ga0068869_1003294921 | 343 |
| 153 | 3300005337 | Ga0070682_100000051 | Ga0070682_10000005184 | 343 |
| 154 | 3300005364 | Ga0070673_100046978 | Ga0070673_1000469783 | 343 |
| 155 | 3300005441 | Ga0070700_100016391 | Ga0070700_1000163914 | 343 |
| 156 | 3300005467 | Ga0070706_100123990 | Ga0070706_1001239902 | 343 |
| 157 | 3300005543 | Ga0070672_100136522 | Ga0070672_1001365222 | 343 |
| 158 | 3300005549 | Ga0070704_100030530 | Ga0070704_1000305303 | 343 |
| 159 | 3300005578 | Ga0068854_100257881 | Ga0068854_1002578812 | 343 |
| 160 | 3300005617 | Ga0068859_100170570 | Ga0068859_1001705702 | 343 |
| 161 | 3300005840 | Ga0068870_10024772 | Ga0068870_100247723 | 343 |
| 162 | 3300005844 | Ga0068862_100088469 | Ga0068862_1000884692 | 343 |
| 163 | 3300005844 | Ga0068862_100208329 | Ga0068862_1002083292 | 343 |
| 164 | 3300006852 | Ga0075433_10119052 | Ga0075433_101190522 | 343 |
| 165 | 3300006931 | Ga0097620_100170559 | Ga0097620_1001705592 | 343 |
| 166 | 3300009094 | Ga0111539_10000931 | Ga0111539_1000093112 | 343 |
| 167 | 3300009147 | Ga0114129_10494950 | Ga0114129_104949502 | 343 |
| 168 | 3300009553 | Ga0105249_10083013 | Ga0105249_100830132 | 343 |
| 169 | 3300013100 | Ga0157373_10088057 | Ga0157373_100880572 | 343 |
| 170 | 3300014326 | Ga0157380_10001887 | Ga0157380_100018877 | 343 |
| 171 | 3300014326 | Ga0157380_10002797 | Ga0157380_100027978 | 343 |
| 172 | 3300021384 | Ga0213876_10015863 | Ga0213876_100158631 | 343 |
| 173 | 3300025925 | Ga0207650_10075374 | Ga0207650_100753744 | 343 |
| 174 | 3300025925 | Ga0207650_10127029 | Ga0207650_101270292 | 343 |
| 175 | 3300025942 | Ga0207689_10356489 | Ga0207689_103564891 | 343 |
| 176 | 3300025960 | Ga0207651_10014969 | Ga0207651_100149693 | 343 |
| 177 | 3300025961 | Ga0207712_10051178 | Ga0207712_100511782 | 343 |
| 178 | 3300026075 | Ga0207708_10028395 | Ga0207708_100283955 | 343 |
| 179 | 3300027907 | Ga0207428_10000547 | Ga0207428_1000054720 | 343 |
| 180 | 3300028380 | Ga0268265_10079515 | Ga0268265_100795152 | 343 |
| 181 | 3300031456 | Ga0307513_10142031 | Ga0307513_101420312 | 343 |
| 182 | 3300031911 | Ga0307412_10165784 | Ga0307412_101657842 | 343 |
| 183 | 3300032002 | Ga0307416_100059903 | Ga0307416_1000599032 | 343 |
| 184 | 3300037466 | Ga0395898_0532550 | Ga0395898_0532550_38_1072 | 343 |
| 185 | 3300038443 | Ga0395901_0251294 | Ga0395901_0251294_215_1249 | 343 |
| 186 | 3300039437 | Ga0436365_1113263 | Ga0436365_1113263_180_1214 | 343 |
| 187 | 3300044712 | Ga0453684_0008644 | Ga0453684_0008644_17049_18122 | 343 |
| 188 | 3300044712 | Ga0453684_0012014 | Ga0453684_0012014_1479_2549 | 343 |
| 189 | 3300045051 | Ga0451576_0001145 | Ga0451576_0001145_28630_29700 | 343 |
| 190 | 3300046519 | Ga0495632_0051546 | Ga0495632_0051546_864_1898 | 343 |
| 191 | 3300050510 | nmdc:mga06r32_306593_c1 | nmdc:mga06r32_306593_c1_323_1354 | 343 |
| 192 | 3300050511 | nmdc:mga08y16_5249_c1 | nmdc:mga08y16_5249_c1_9033_10064 | 343 |
| 193 | 3300050515 | nmdc:mga0a205_29859_c1 | nmdc:mga0a205_29859_c1_863_1894 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z01-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus | 0.9656 | 20 | 341 |
| 2v9y-assembly1.cif.gz_A | human aminoimidazole ribonucleotide synthetase | 0.9565 | 45 | 342 |
| 1cli-assembly2.cif.gz_C | x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution | 0.9522 | 3 | 343 |
| 5vk4-assembly1.cif.gz_A | crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium | 0.9496 | 15 | 341 |
| 2btu-assembly1.cif.gz_A | crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. | 0.9495 | 16 | 342 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07244_618_801_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9553 | 173 | 337 | 3.90.650.10 |
| af_Q54GJ2_634_814_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9521 | 172 | 343 | 3.90.650.10 |
| af_P00967_819_956_3.30.1330.10 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9512 | 31 | 168 | 3.30.1330.10 |
| af_G3V918_434_598_3.30.1330.10 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9499 | 4 | 166 | 3.30.1330.10 |
| 2z01A01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9476 | 20 | 169 | 3.30.1330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9UJX9-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9908 | 177 | 342 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A533RRQ1-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9876 | 242 | 342 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A2V7XHW2-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9843 | 163 | 342 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A2D7KPL3-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9834 | 245 | 341 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A7X9BES8-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) | 0.982 | 84 | 343 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar