F297397

General Info

Members Datasets Scaffolds Average Seq Length
193 119 193 341

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10186701|Ga0307411_101867011
Length 392
Sequence MYPVLLHFEFEIRVSRTNFSKFQVWMVCLGCAFLPHFWLNSLKKSIIQIFKIMSNSISYSDAGVSIDNANLAVEKIKNYAKRTFNERTLTEIGSFGGMFSGAFPDMAEPILVASADGVGTKLKIAFDTGIHNTIGQDLVNHCVNDILVQGARPLFFLDYFATGVLSPDVTASVVEGISIACKENGCVLLGGETAEMPGFYADGEYDLAGFIVGVVDKRRVIDGKSIKPGDVVLGLPASGLQTNGYSLARKLFFEVGGYEVDTYLDELGSTVGEALLEKHASFLKPLENLLDSGKIKGLAHITGGGFLENIPRILPENVSVEIKRGTWEEPSIFGLMQKLGNVAESEMFRTFNMGIGMIVICGETDKDFLKENLGTSFEIGRLIEGNKEVAIV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
114 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
115 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_203960 2162886007 Bacteria 2374
2 Ga0065704_10001172 3300005289 Bacteria 19999
3 Ga0065704_10088713 3300005289 Bacteria 2916
4 Ga0065715_10006849 3300005293 Bacteria 3230
5 Ga0070658_10006915 3300005327 Bacteria 9160
6 Ga0070690_100038512 3300005330 Bacteria 3018
7 Ga0070670_100010176 3300005331 Bacteria 8025
8 Ga0070670_100024537 3300005331 Bacteria 5184
9 Ga0068869_100243715 3300005334 Bacteria 1433
10 Ga0068869_100329492 3300005334 Unclassified 1240
11 Ga0070682_100000051 3300005337 Bacteria 123476
12 Ga0068868_100012158 3300005338 Bacteria 6286
13 Ga0070689_100034476 3300005340 Bacteria 3862
14 Ga0070689_100139758 3300005340 Bacteria 1947
15 Ga0070661_100186215 3300005344 Bacteria 1582
16 Ga0070668_100046988 3300005347 Bacteria 3317
17 Ga0070675_100071761 3300005354 Unclassified 2873
18 Ga0070671_100075353 3300005355 Bacteria 2818
19 Ga0070671_100093145 3300005355 Unclassified 2525
20 Ga0070671_100177917 3300005355 Bacteria 1800
21 Ga0070673_100046978 3300005364 Bacteria 3357
22 Ga0070667_100070382 3300005367 Bacteria 2978
23 Ga0070700_100016391 3300005441 Unclassified 4221
24 Ga0070662_100040882 3300005457 Bacteria 3304
25 Ga0070662_100302601 3300005457 Bacteria 1300
26 Ga0070681_10023466 3300005458 Bacteria 6204
27 Ga0070706_100123990 3300005467 Bacteria 2408
28 Ga0070679_100021306 3300005530 Bacteria 6326
29 Ga0068853_100005720 3300005539 Bacteria 9784
30 Ga0068853_100113715 3300005539 Unclassified 2407
31 Ga0068853_100124788 3300005539 Bacteria 2299
32 Ga0070672_100136522 3300005543 Bacteria 2020
33 Ga0070672_100382651 3300005543 Bacteria 1204
34 Ga0070704_100030530 3300005549 Bacteria 3612
35 Ga0068855_100442647 3300005563 Unclassified 1419
36 Ga0070664_100047450 3300005564 Unclassified 3628
37 Ga0070664_100099550 3300005564 Unclassified 2527
38 Ga0070664_100210769 3300005564 Unclassified 1736
39 Ga0068854_100051427 3300005578 Bacteria 2952
40 Ga0068854_100257881 3300005578 Bacteria 1395
41 Ga0068852_100037633 3300005616 Unclassified 4058
42 Ga0068859_100170570 3300005617 Bacteria 2257
43 Ga0068864_100008627 3300005618 Bacteria 8411
44 Ga0068864_100045558 3300005618 Bacteria 3762
45 Ga0068864_100163720 3300005618 Bacteria 2023
46 Ga0068870_10024772 3300005840 Bacteria 2971
47 Ga0068863_100018391 3300005841 Bacteria 6688
48 Ga0068860_100021363 3300005843 Bacteria 6267
49 Ga0068860_100287646 3300005843 Bacteria 1608
50 Ga0068860_100421446 3300005843 Bacteria 1323
51 Ga0068862_100020183 3300005844 Bacteria 5565
52 Ga0068862_100088469 3300005844 Bacteria 2695
53 Ga0068862_100208329 3300005844 Bacteria 1766
54 Ga0097621_100178220 3300006237 Unclassified 1835
55 Ga0068871_100121557 3300006358 Unclassified 2206
56 Ga0068871_100221044 3300006358 Bacteria 1641
57 Ga0075433_10119052 3300006852 Bacteria 2344
58 Ga0097620_100170559 3300006931 Bacteria 2257
59 Ga0105240_10048127 3300009093 Bacteria 5391
60 Ga0111539_10000931 3300009094 Bacteria 38341
61 Ga0111539_10061785 3300009094 Bacteria 4437
62 Ga0105247_10007593 3300009101 Bacteria 6642
63 Ga0114129_10141382 3300009147 Bacteria 3299
64 Ga0114129_10494950 3300009147 Bacteria 1597
65 Ga0105241_10037068 3300009174 Bacteria 3672
66 Ga0105248_10013748 3300009177 Bacteria 8910
67 Ga0105248_10509317 3300009177 Unclassified 1357
68 Ga0105249_10002101 3300009553 Bacteria 17281
69 Ga0105249_10083013 3300009553 Bacteria 2982
70 Ga0157373_10088057 3300013100 Bacteria 2188
71 Ga0157370_10307008 3300013104 Bacteria 1464
72 Ga0157378_10341766 3300013297 Bacteria 1460
73 Ga0163162_10037755 3300013306 Bacteria 4821
74 Ga0163162_10103433 3300013306 Bacteria 2942
75 Ga0157372_10039630 3300013307 Bacteria 5200
76 Ga0157372_10052750 3300013307 Bacteria 4529
77 Ga0157372_10105099 3300013307 Bacteria 3230
78 Ga0157372_10207889 3300013307 Bacteria 2268
79 Ga0157375_10110099 3300013308 Bacteria 2851
80 Ga0157375_10203456 3300013308 Bacteria 2136
81 Ga0163163_10026126 3300014325 Bacteria 5576
82 Ga0163163_10117940 3300014325 Bacteria 2686
83 Ga0163163_10204365 3300014325 Bacteria 2024
84 Ga0163163_10365739 3300014325 Bacteria 1499
85 Ga0157380_10001887 3300014326 Bacteria 13902
86 Ga0157380_10002797 3300014326 Bacteria 11862
87 Ga0157380_10142897 3300014326 Bacteria 2058
88 Ga0157379_10192080 3300014968 Bacteria 1845
89 Ga0163161_10001586 3300017792 Bacteria 16768
90 Ga0213876_10015863 3300021384 Bacteria 3987
91 Ga0207710_10003668 3300025900 Bacteria 6813
92 Ga0207643_10076113 3300025908 Unclassified 1938
93 Ga0207705_10021849 3300025909 Bacteria 4565
94 Ga0207654_10024675 3300025911 Bacteria 3235
95 Ga0207649_10098824 3300025920 Bacteria 1927
96 Ga0207652_10033987 3300025921 Bacteria 4295
97 Ga0207650_10002699 3300025925 Bacteria 12263
98 Ga0207650_10075374 3300025925 Bacteria 2546
99 Ga0207650_10102071 3300025925 Bacteria 2209
100 Ga0207650_10127029 3300025925 Bacteria 1991
101 Ga0207659_10052158 3300025926 Unclassified 2912
102 Ga0207706_10220117 3300025933 Bacteria 1662
103 Ga0207670_10113260 3300025936 Bacteria 1959
104 Ga0207691_10009661 3300025940 Bacteria 9253
105 Ga0207711_10087266 3300025941 Unclassified 2737
106 Ga0207711_10131270 3300025941 Bacteria 2246
107 Ga0207689_10356489 3300025942 Unclassified 1216
108 Ga0207679_10050967 3300025945 Bacteria 3028
109 Ga0207679_10069360 3300025945 Unclassified 2652
110 Ga0207679_10118481 3300025945 Bacteria 2103
111 Ga0207679_10189897 3300025945 Unclassified 1707
112 Ga0207651_10014969 3300025960 Bacteria 4494
113 Ga0207712_10002003 3300025961 Bacteria 13381
114 Ga0207712_10005668 3300025961 Bacteria 7877
115 Ga0207712_10051178 3300025961 Bacteria 2887
116 Ga0207640_10117062 3300025981 Bacteria 1901
117 Ga0207639_10002305 3300026041 Bacteria 12811
118 Ga0207678_10111452 3300026067 Bacteria 2334
119 Ga0207708_10028395 3300026075 Unclassified 4237
120 Ga0207641_10072200 3300026088 Bacteria 2972
121 Ga0207676_10054377 3300026095 Bacteria 3138
122 Ga0207676_10076036 3300026095 Bacteria 2711
123 Ga0207676_10119299 3300026095 Bacteria 2221
124 Ga0207676_10212996 3300026095 Unclassified 1715
125 Ga0207676_10285430 3300026095 Unclassified 1500
126 Ga0207674_10267830 3300026116 Bacteria 1656
127 Ga0207698_10078751 3300026142 Bacteria 2648
128 Ga0207428_10000547 3300027907 Bacteria 44826
129 Ga0207428_10087960 3300027907 Bacteria 2416
130 Ga0268265_10079515 3300028380 Bacteria 2582
131 Ga0268264_10005354 3300028381 Bacteria 10877
132 Ga0268264_10009949 3300028381 Bacteria 7874
133 Ga0268264_10575803 3300028381 Bacteria 1107
134 Ga0265338_10037560 3300028800 Bacteria 4607
135 Ga0307513_10142031 3300031456 Bacteria 2326
136 Ga0307408_100017111 3300031548 Bacteria 4850
137 Ga0307405_10099974 3300031731 Unclassified 1943
138 Ga0307413_10005340 3300031824 Bacteria 5721
139 Ga0307410_10005878 3300031852 Bacteria 6553
140 Ga0307410_10010577 3300031852 Bacteria 5234
141 Ga0307410_10023070 3300031852 Bacteria 3861
142 Ga0307410_10042499 3300031852 Bacteria 3005
143 Ga0307410_10051401 3300031852 Unclassified 2777
144 Ga0307410_10068870 3300031852 Unclassified 2446
145 Ga0307406_10003651 3300031901 Bacteria 8381
146 Ga0307406_10017966 3300031901 Bacteria 4125
147 Ga0307406_10110265 3300031901 Bacteria 1893
148 Ga0307407_10004151 3300031903 Bacteria 6104
149 Ga0307412_10165784 3300031911 Bacteria 1647
150 Ga0307409_100003339 3300031995 Bacteria 8687
151 Ga0307409_100325301 3300031995 Bacteria 1441
152 Ga0307416_100008990 3300032002 Bacteria 6499
153 Ga0307416_100028423 3300032002 Unclassified 4158
154 Ga0307416_100040306 3300032002 Bacteria 3626
155 Ga0307416_100059903 3300032002 Unclassified 3097
156 Ga0307416_100275339 3300032002 Bacteria 1655
157 Ga0307414_10000900 3300032004 Bacteria 15232
158 Ga0307414_10011349 3300032004 Bacteria 5220
159 Ga0307414_10049421 3300032004 Bacteria 2908
160 Ga0307414_10131163 3300032004 Bacteria 1946
161 Ga0307411_10010052 3300032005 Bacteria 5019
162 Ga0307411_10088365 3300032005 Bacteria 2155
163 Ga0307411_10102403 3300032005 Bacteria 2029
164 Ga0307411_10186701 3300032005 Bacteria 1579
165 Ga0307415_100000562 3300032126 Bacteria 16294
166 Ga0307415_100004056 3300032126 Bacteria 7555
167 Ga0307415_100016310 3300032126 Unclassified 4425
168 Ga0307415_100189954 3300032126 Bacteria 1620
169 Ga0395898_0532550 3300037466 Bacteria 1116
170 Ga0395905_0209291 3300037471 Unclassified 1827
171 Ga0395901_0251294 3300038443 Bacteria 1842
172 Ga0436365_1113263 3300039437 Bacteria 5223
173 Ga0451791_0127037 3300041451 Unclassified 1089
174 Ga0439432_046090 3300042006 Unclassified 1370
175 Ga0453684_0008644 3300044712 Bacteria 18132
176 Ga0453684_0012014 3300044712 Bacteria 14399
177 Ga0451576_0001145 3300045051 Bacteria 47877
178 Ga0495632_0051546 3300046519 Bacteria 2025
179 Ga0495598_0004751 3300046537 Bacteria 2964
180 Ga0495621_0033697 3300046539 Bacteria 1767
181 Ga0495668_0001155 3300046616 Bacteria 26983
182 Ga0496109_0309652 3300048912 Unclassified 1490
183 Ga0501072_0002670 3300049588 Bacteria 13372
184 Ga0501198_002785 3300049649 Unclassified 2368
185 Ga0501217_004661 3300049661 Unclassified 2827
186 Ga0501221_008391 3300049704 Unclassified 1795
187 Ga0501225_0006357 3300049705 Unclassified 3453
188 nmdc:mga06r32_187571_c1 3300050510 Bacteria 2055
189 nmdc:mga06r32_306593_c1 3300050510 Bacteria 1573
190 nmdc:mga08y16_170598_c1 3300050511 Bacteria 2260
191 nmdc:mga08y16_5249_c1 3300050511 Bacteria 13531
192 nmdc:mga0a205_29859_c1 3300050515 Bacteria 2335
193 Ga0495601_0173640 3300053077 Unclassified 1409

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10061785 Ga0111539_100617853 325
2 3300027907 Ga0207428_10087960 Ga0207428_100879602 325
3 3300050511 nmdc:mga08y16_170598_c1 nmdc:mga08y16_170598_c1_715_1731 325
4 3300009177 Ga0105248_10509317 Ga0105248_105093171 328
5 3300025941 Ga0207711_10087266 Ga0207711_100872664 328
6 3300026095 Ga0207676_10212996 Ga0207676_102129963 328
7 3300005338 Ga0068868_100012158 Ga0068868_1000121587 329
8 3300005355 Ga0070671_100075353 Ga0070671_1000753534 329
9 3300006237 Ga0097621_100178220 Ga0097621_1001782202 329
10 3300014325 Ga0163163_10026126 Ga0163163_100261262 329
11 3300026095 Ga0207676_10285430 Ga0207676_102854301 329
12 3300005347 Ga0070668_100046988 Ga0070668_1000469883 330
13 3300005843 Ga0068860_100021363 Ga0068860_1000213638 330
14 3300005844 Ga0068862_100020183 Ga0068862_1000201833 330
15 3300009101 Ga0105247_10007593 Ga0105247_100075935 330
16 3300014968 Ga0157379_10192080 Ga0157379_101920802 330
17 3300025900 Ga0207710_10003668 Ga0207710_100036688 330
18 3300025911 Ga0207654_10024675 Ga0207654_100246753 330
19 3300025961 Ga0207712_10002003 Ga0207712_1000200310 330
20 3300025961 Ga0207712_10005668 Ga0207712_100056686 330
21 3300028381 Ga0268264_10005354 Ga0268264_100053545 330
22 3300048912 Ga0496109_0309652 Ga0496109_0309652_212_1255 330
23 3300013308 Ga0157375_10110099 Ga0157375_101100993 333
24 3300009177 Ga0105248_10013748 Ga0105248_100137483 334
25 3300025941 Ga0207711_10131270 Ga0207711_101312702 334
26 3300013297 Ga0157378_10341766 Ga0157378_103417662 336
27 3300014326 Ga0157380_10142897 Ga0157380_101428974 337
28 3300005458 Ga0070681_10023466 Ga0070681_100234664 338
29 3300005530 Ga0070679_100021306 Ga0070679_1000213065 338
30 3300009093 Ga0105240_10048127 Ga0105240_100481273 338
31 3300025921 Ga0207652_10033987 Ga0207652_100339872 338
32 3300042006 Ga0439432_046090 Ga0439432_046090_40_1065 338
33 3300005327 Ga0070658_10006915 Ga0070658_100069158 339
34 3300005331 Ga0070670_100010176 Ga0070670_1000101764 339
35 3300005331 Ga0070670_100024537 Ga0070670_1000245374 339
36 3300005340 Ga0070689_100034476 Ga0070689_1000344764 339
37 3300005340 Ga0070689_100139758 Ga0070689_1001397582 339
38 3300005344 Ga0070661_100186215 Ga0070661_1001862152 339
39 3300005354 Ga0070675_100071761 Ga0070675_1000717613 339
40 3300005355 Ga0070671_100093145 Ga0070671_1000931452 339
41 3300005355 Ga0070671_100177917 Ga0070671_1001779172 339
42 3300005367 Ga0070667_100070382 Ga0070667_1000703822 339
43 3300005457 Ga0070662_100040882 Ga0070662_1000408822 339
44 3300005457 Ga0070662_100302601 Ga0070662_1003026012 339
45 3300005539 Ga0068853_100005720 Ga0068853_1000057202 339
46 3300005539 Ga0068853_100113715 Ga0068853_1001137152 339
47 3300005539 Ga0068853_100124788 Ga0068853_1001247883 339
48 3300005543 Ga0070672_100382651 Ga0070672_1003826512 339
49 3300005563 Ga0068855_100442647 Ga0068855_1004426471 339
50 3300005564 Ga0070664_100047450 Ga0070664_1000474503 339
51 3300005564 Ga0070664_100099550 Ga0070664_1000995502 339
52 3300005564 Ga0070664_100210769 Ga0070664_1002107692 339
53 3300005578 Ga0068854_100051427 Ga0068854_1000514272 339
54 3300005616 Ga0068852_100037633 Ga0068852_1000376332 339
55 3300005618 Ga0068864_100008627 Ga0068864_1000086272 339
56 3300005618 Ga0068864_100045558 Ga0068864_1000455583 339
57 3300005618 Ga0068864_100163720 Ga0068864_1001637202 339
58 3300005841 Ga0068863_100018391 Ga0068863_1000183916 339
59 3300005843 Ga0068860_100287646 Ga0068860_1002876461 339
60 3300005843 Ga0068860_100421446 Ga0068860_1004214462 339
61 3300006358 Ga0068871_100121557 Ga0068871_1001215572 339
62 3300006358 Ga0068871_100221044 Ga0068871_1002210442 339
63 3300009174 Ga0105241_10037068 Ga0105241_100370685 339
64 3300009553 Ga0105249_10002101 Ga0105249_100021016 339
65 3300013104 Ga0157370_10307008 Ga0157370_103070081 339
66 3300013306 Ga0163162_10037755 Ga0163162_100377555 339
67 3300013306 Ga0163162_10103433 Ga0163162_101034332 339
68 3300013307 Ga0157372_10039630 Ga0157372_100396307 339
69 3300013307 Ga0157372_10052750 Ga0157372_100527505 339
70 3300013307 Ga0157372_10105099 Ga0157372_101050992 339
71 3300013307 Ga0157372_10207889 Ga0157372_102078893 339
72 3300013308 Ga0157375_10203456 Ga0157375_102034563 339
73 3300014325 Ga0163163_10117940 Ga0163163_101179402 339
74 3300014325 Ga0163163_10204365 Ga0163163_102043652 339
75 3300014325 Ga0163163_10365739 Ga0163163_103657392 339
76 3300017792 Ga0163161_10001586 Ga0163161_1000158612 339
77 3300025909 Ga0207705_10021849 Ga0207705_100218494 339
78 3300025920 Ga0207649_10098824 Ga0207649_100988242 339
79 3300025925 Ga0207650_10002699 Ga0207650_100026992 339
80 3300025925 Ga0207650_10102071 Ga0207650_101020712 339
81 3300025926 Ga0207659_10052158 Ga0207659_100521582 339
82 3300025933 Ga0207706_10220117 Ga0207706_102201172 339
83 3300025936 Ga0207670_10113260 Ga0207670_101132602 339
84 3300025940 Ga0207691_10009661 Ga0207691_100096619 339
85 3300025945 Ga0207679_10050967 Ga0207679_100509673 339
86 3300025945 Ga0207679_10069360 Ga0207679_100693602 339
87 3300025945 Ga0207679_10118481 Ga0207679_101184812 339
88 3300025945 Ga0207679_10189897 Ga0207679_101898972 339
89 3300025981 Ga0207640_10117062 Ga0207640_101170622 339
90 3300026041 Ga0207639_10002305 Ga0207639_1000230513 339
91 3300026067 Ga0207678_10111452 Ga0207678_101114522 339
92 3300026088 Ga0207641_10072200 Ga0207641_100722002 339
93 3300026095 Ga0207676_10054377 Ga0207676_100543771 339
94 3300026095 Ga0207676_10076036 Ga0207676_100760361 339
95 3300026095 Ga0207676_10119299 Ga0207676_101192993 339
96 3300026116 Ga0207674_10267830 Ga0207674_102678302 339
97 3300026142 Ga0207698_10078751 Ga0207698_100787513 339
98 3300028381 Ga0268264_10009949 Ga0268264_100099492 339
99 3300028381 Ga0268264_10575803 Ga0268264_105758031 339
100 3300028800 Ga0265338_10037560 Ga0265338_100375603 339
101 3300031548 Ga0307408_100017111 Ga0307408_1000171112 339
102 3300031731 Ga0307405_10099974 Ga0307405_100999742 339
103 3300031824 Ga0307413_10005340 Ga0307413_100053404 339
104 3300031852 Ga0307410_10005878 Ga0307410_100058787 339
105 3300031852 Ga0307410_10010577 Ga0307410_100105772 339
106 3300031852 Ga0307410_10023070 Ga0307410_100230704 339
107 3300031852 Ga0307410_10042499 Ga0307410_100424994 339
108 3300031852 Ga0307410_10051401 Ga0307410_100514012 339
109 3300031852 Ga0307410_10068870 Ga0307410_100688702 339
110 3300031901 Ga0307406_10003651 Ga0307406_100036516 339
111 3300031901 Ga0307406_10017966 Ga0307406_100179664 339
112 3300031901 Ga0307406_10110265 Ga0307406_101102652 339
113 3300031903 Ga0307407_10004151 Ga0307407_100041516 339
114 3300031995 Ga0307409_100003339 Ga0307409_1000033395 339
115 3300031995 Ga0307409_100325301 Ga0307409_1003253012 339
116 3300032002 Ga0307416_100008990 Ga0307416_1000089905 339
117 3300032002 Ga0307416_100028423 Ga0307416_1000284235 339
118 3300032002 Ga0307416_100040306 Ga0307416_1000403064 339
119 3300032002 Ga0307416_100275339 Ga0307416_1002753391 339
120 3300032004 Ga0307414_10000900 Ga0307414_1000090012 339
121 3300032004 Ga0307414_10011349 Ga0307414_100113495 339
122 3300032004 Ga0307414_10049421 Ga0307414_100494213 339
123 3300032004 Ga0307414_10131163 Ga0307414_101311632 339
124 3300032005 Ga0307411_10010052 Ga0307411_100100523 339
125 3300032005 Ga0307411_10088365 Ga0307411_100883652 339
126 3300032005 Ga0307411_10102403 Ga0307411_101024032 339
127 3300032005 Ga0307411_10186701 Ga0307411_101867011 339
128 3300032126 Ga0307415_100000562 Ga0307415_10000056211 339
129 3300032126 Ga0307415_100004056 Ga0307415_1000040567 339
130 3300032126 Ga0307415_100016310 Ga0307415_1000163105 339
131 3300032126 Ga0307415_100189954 Ga0307415_1001899542 339
132 3300037471 Ga0395905_0209291 Ga0395905_0209291_430_1452 339
133 3300041451 Ga0451791_0127037 Ga0451791_0127037_45_1067 339
134 3300046537 Ga0495598_0004751 Ga0495598_0004751_379_1401 339
135 3300046539 Ga0495621_0033697 Ga0495621_0033697_527_1564 339
136 3300046616 Ga0495668_0001155 Ga0495668_0001155_14170_15192 339
137 3300049588 Ga0501072_0002670 Ga0501072_0002670_10353_11375 339
138 3300049649 Ga0501198_002785 Ga0501198_002785_1155_2174 339
139 3300049661 Ga0501217_004661 Ga0501217_004661_806_1825 339
140 3300049704 Ga0501221_008391 Ga0501221_008391_222_1241 339
141 3300049705 Ga0501225_0006357 Ga0501225_0006357_1264_2283 339
142 3300050510 nmdc:mga06r32_187571_c1 nmdc:mga06r32_187571_c1_393_1415 339
143 3300053077 Ga0495601_0173640 Ga0495601_0173640_151_1179 339
144 3300009147 Ga0114129_10141382 Ga0114129_101413823 340
145 3300025908 Ga0207643_10076113 Ga0207643_100761131 342
146 2162886007 SwRhRL2b_contig_203960 SwRhRL2b_0130.00007220 343
147 3300005289 Ga0065704_10001172 Ga0065704_100011727 343
148 3300005289 Ga0065704_10088713 Ga0065704_100887132 343
149 3300005293 Ga0065715_10006849 Ga0065715_100068494 343
150 3300005330 Ga0070690_100038512 Ga0070690_1000385122 343
151 3300005334 Ga0068869_100243715 Ga0068869_1002437152 343
152 3300005334 Ga0068869_100329492 Ga0068869_1003294921 343
153 3300005337 Ga0070682_100000051 Ga0070682_10000005184 343
154 3300005364 Ga0070673_100046978 Ga0070673_1000469783 343
155 3300005441 Ga0070700_100016391 Ga0070700_1000163914 343
156 3300005467 Ga0070706_100123990 Ga0070706_1001239902 343
157 3300005543 Ga0070672_100136522 Ga0070672_1001365222 343
158 3300005549 Ga0070704_100030530 Ga0070704_1000305303 343
159 3300005578 Ga0068854_100257881 Ga0068854_1002578812 343
160 3300005617 Ga0068859_100170570 Ga0068859_1001705702 343
161 3300005840 Ga0068870_10024772 Ga0068870_100247723 343
162 3300005844 Ga0068862_100088469 Ga0068862_1000884692 343
163 3300005844 Ga0068862_100208329 Ga0068862_1002083292 343
164 3300006852 Ga0075433_10119052 Ga0075433_101190522 343
165 3300006931 Ga0097620_100170559 Ga0097620_1001705592 343
166 3300009094 Ga0111539_10000931 Ga0111539_1000093112 343
167 3300009147 Ga0114129_10494950 Ga0114129_104949502 343
168 3300009553 Ga0105249_10083013 Ga0105249_100830132 343
169 3300013100 Ga0157373_10088057 Ga0157373_100880572 343
170 3300014326 Ga0157380_10001887 Ga0157380_100018877 343
171 3300014326 Ga0157380_10002797 Ga0157380_100027978 343
172 3300021384 Ga0213876_10015863 Ga0213876_100158631 343
173 3300025925 Ga0207650_10075374 Ga0207650_100753744 343
174 3300025925 Ga0207650_10127029 Ga0207650_101270292 343
175 3300025942 Ga0207689_10356489 Ga0207689_103564891 343
176 3300025960 Ga0207651_10014969 Ga0207651_100149693 343
177 3300025961 Ga0207712_10051178 Ga0207712_100511782 343
178 3300026075 Ga0207708_10028395 Ga0207708_100283955 343
179 3300027907 Ga0207428_10000547 Ga0207428_1000054720 343
180 3300028380 Ga0268265_10079515 Ga0268265_100795152 343
181 3300031456 Ga0307513_10142031 Ga0307513_101420312 343
182 3300031911 Ga0307412_10165784 Ga0307412_101657842 343
183 3300032002 Ga0307416_100059903 Ga0307416_1000599032 343
184 3300037466 Ga0395898_0532550 Ga0395898_0532550_38_1072 343
185 3300038443 Ga0395901_0251294 Ga0395901_0251294_215_1249 343
186 3300039437 Ga0436365_1113263 Ga0436365_1113263_180_1214 343
187 3300044712 Ga0453684_0008644 Ga0453684_0008644_17049_18122 343
188 3300044712 Ga0453684_0012014 Ga0453684_0012014_1479_2549 343
189 3300045051 Ga0451576_0001145 Ga0451576_0001145_28630_29700 343
190 3300046519 Ga0495632_0051546 Ga0495632_0051546_864_1898 343
191 3300050510 nmdc:mga06r32_306593_c1 nmdc:mga06r32_306593_c1_323_1354 343
192 3300050511 nmdc:mga08y16_5249_c1 nmdc:mga08y16_5249_c1_9033_10064 343
193 3300050515 nmdc:mga0a205_29859_c1 nmdc:mga0a205_29859_c1_863_1894 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

105

215

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

227

392

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9656 20 341
2v9y-assembly1.cif.gz_A human aminoimidazole ribonucleotide synthetase 0.9565 45 342
1cli-assembly2.cif.gz_C x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution 0.9522 3 343
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9496 15 341
2btu-assembly1.cif.gz_A crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. 0.9495 16 342
ID Description Score Start End Superfamily
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9553 173 337 3.90.650.10
af_Q54GJ2_634_814_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9521 172 343 3.90.650.10
af_P00967_819_956_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9512 31 168 3.30.1330.10
af_G3V918_434_598_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9499 4 166 3.30.1330.10
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9476 20 169 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A7V9UJX9-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9908 177 342 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A533RRQ1-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9876 242 342 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A2V7XHW2-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9843 163 342 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A2D7KPL3-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9834 245 341 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A7X9BES8-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.982 84 343 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084

Feature Viewer

pLDDT pTM Quality
91.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map