F297175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 122 | 193 | 525 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10013297|Ga0157375_100132972 |
| Length | 560 |
| Sequence | VRQAILRRQTNFTKEIMKKTTTVLFLLFCLLFQSVSAVRAQTVPNQADVFANIRKEGMDNSQIMRTLHFFTDVYGPRLTGSPNLKAAGNWAVAEMTKWGFENAKLEPWDFGHPGWINERASGFITAPVQDSLVFEVLSWTPGTKKKKGVKGQAFQLILPTTPAPTENNPNAVQQPTQAELTAYFDSIKSQIKGKMVLIGKPAVIPVNINPPPKRLNDEDLKKRFDPNNPQQPFNFPQPPTPKPGTLTGQQVAEQLDQFLVDNEAAVRINDAGREHGQIRAFNNRSFDISKTVPTVVMRNEDFGRISRLMADGTAVSLEFNIKNTIIPEGTTSFNTVAEITGTDKKDEVIMLGGHLDSWHAATGATDNAVGCAVMMEAVRILKTLGVKPRRTIRVALWSGEEQGLLGSQAYVKEHFGSFEEQKPGFEKFGGYFNIDSGTGRARGMSIFGPPEAATILREALAPYSDIGFVGVINSKSRGLGGSDNTSFNQAGLPGIGVQQDPIEYGSHTWHTNLDTYERIIEDDVKKSAIVIASAVYVLAMRDELLPRYSKEQMPALPTKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 71 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 78 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 79 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 80 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 81 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 84 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 85 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 86 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 87 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 88 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 89 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 90 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 91 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 96 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 97 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 98 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 101 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 102 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 103 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 104 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 107 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 108 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 111 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 112 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 121 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 122 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 0 |
| Rhizoplane | 6.74 |
| Rhizosphere | 91.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10095055 | 3300005293 | Bacteria | 4178 |
| 2 | Ga0065715_10098804 | 3300005293 | Bacteria | 3496 |
| 3 | Ga0065707_10110445 | 3300005295 | Bacteria | 2430 |
| 4 | Ga0070676_10032138 | 3300005328 | Bacteria | 3005 |
| 5 | Ga0070683_100026769 | 3300005329 | Bacteria | 5196 |
| 6 | Ga0070690_100004973 | 3300005330 | Bacteria | 7440 |
| 7 | Ga0070670_100007167 | 3300005331 | Bacteria | 9444 |
| 8 | Ga0070666_10002763 | 3300005335 | Bacteria | 10602 |
| 9 | Ga0070682_100039675 | 3300005337 | Bacteria | 2894 |
| 10 | Ga0068868_100008037 | 3300005338 | Bacteria | 7543 |
| 11 | Ga0070689_100003330 | 3300005340 | Bacteria | 10672 |
| 12 | Ga0070689_100006724 | 3300005340 | Bacteria | 7991 |
| 13 | Ga0070661_100002753 | 3300005344 | Bacteria | 12055 |
| 14 | Ga0070668_100045864 | 3300005347 | Bacteria | 3354 |
| 15 | Ga0070669_100001326 | 3300005353 | Bacteria | 17847 |
| 16 | Ga0070675_100036754 | 3300005354 | Bacteria | 3987 |
| 17 | Ga0070675_100166989 | 3300005354 | Bacteria | 1896 |
| 18 | Ga0070659_100081461 | 3300005366 | Bacteria | 2585 |
| 19 | Ga0070659_100159272 | 3300005366 | Unclassified | 1845 |
| 20 | Ga0070667_100009447 | 3300005367 | Bacteria | 8089 |
| 21 | Ga0070709_10000033 | 3300005434 | Bacteria | 116407 |
| 22 | Ga0070700_100006429 | 3300005441 | Bacteria | 6286 |
| 23 | Ga0070678_100050545 | 3300005456 | Bacteria | 3008 |
| 24 | Ga0070662_100057961 | 3300005457 | Bacteria | 2816 |
| 25 | Ga0070707_100000065 | 3300005468 | Bacteria | 95519 |
| 26 | Ga0070699_100123220 | 3300005518 | Bacteria | 2280 |
| 27 | Ga0070684_100000236 | 3300005535 | Bacteria | 38259 |
| 28 | Ga0070672_100035709 | 3300005543 | Bacteria | 3779 |
| 29 | Ga0070672_100048216 | 3300005543 | Bacteria | 3309 |
| 30 | Ga0070665_100127876 | 3300005548 | Bacteria | 2543 |
| 31 | Ga0070664_100001147 | 3300005564 | Bacteria | 20989 |
| 32 | Ga0068852_100083991 | 3300005616 | Bacteria | 2833 |
| 33 | Ga0068859_100051678 | 3300005617 | Unclassified | 4131 |
| 34 | Ga0068864_100076669 | 3300005618 | Bacteria | 2922 |
| 35 | Ga0068861_100010474 | 3300005719 | Bacteria | 6434 |
| 36 | Ga0068870_10000938 | 3300005840 | Bacteria | 11437 |
| 37 | Ga0068870_10068948 | 3300005840 | Bacteria | 1923 |
| 38 | Ga0068860_100006516 | 3300005843 | Bacteria | 11719 |
| 39 | Ga0068862_100002460 | 3300005844 | Bacteria | 16408 |
| 40 | Ga0068862_100016861 | 3300005844 | Bacteria | 6080 |
| 41 | Ga0068862_100023483 | 3300005844 | Bacteria | 5168 |
| 42 | Ga0068862_100029417 | 3300005844 | Bacteria | 4630 |
| 43 | Ga0081455_10008419 | 3300005937 | Bacteria | 10728 |
| 44 | Ga0081539_10043053 | 3300005985 | Unclassified | 2622 |
| 45 | Ga0068871_100030996 | 3300006358 | Bacteria | 4214 |
| 46 | Ga0075428_100001564 | 3300006844 | Bacteria | 24545 |
| 47 | Ga0075428_100010091 | 3300006844 | Bacteria | 10491 |
| 48 | Ga0075428_100046065 | 3300006844 | Bacteria | 4792 |
| 49 | Ga0075428_100066360 | 3300006844 | Unclassified | 3951 |
| 50 | Ga0075431_100000898 | 3300006847 | Bacteria | 26211 |
| 51 | Ga0075431_100007792 | 3300006847 | Bacteria | 10666 |
| 52 | Ga0075431_100048563 | 3300006847 | Bacteria | 4378 |
| 53 | Ga0075431_100051691 | 3300006847 | Bacteria | 4237 |
| 54 | Ga0075433_10002620 | 3300006852 | Bacteria | 13720 |
| 55 | Ga0075433_10062747 | 3300006852 | Bacteria | 3255 |
| 56 | Ga0075434_100046496 | 3300006871 | Unclassified | 4307 |
| 57 | Ga0075429_100001568 | 3300006880 | Bacteria | 18777 |
| 58 | Ga0075429_100005144 | 3300006880 | Bacteria | 11249 |
| 59 | Ga0075429_100062586 | 3300006880 | Bacteria | 3242 |
| 60 | Ga0097620_100051676 | 3300006931 | Unclassified | 4131 |
| 61 | Ga0111539_10013258 | 3300009094 | Bacteria | 10305 |
| 62 | Ga0111539_10033523 | 3300009094 | Bacteria | 6235 |
| 63 | Ga0111539_10034144 | 3300009094 | Bacteria | 6171 |
| 64 | Ga0111539_10051826 | 3300009094 | Bacteria | 4886 |
| 65 | Ga0111539_10052150 | 3300009094 | Unclassified | 4870 |
| 66 | Ga0111539_10285236 | 3300009094 | Bacteria | 1921 |
| 67 | Ga0114129_10005741 | 3300009147 | Bacteria | 17583 |
| 68 | Ga0114129_10015893 | 3300009147 | Bacteria | 10705 |
| 69 | Ga0105243_10161508 | 3300009148 | Bacteria | 1932 |
| 70 | Ga0105248_10022838 | 3300009177 | Bacteria | 6945 |
| 71 | Ga0105248_10063413 | 3300009177 | Bacteria | 4148 |
| 72 | Ga0105248_10090882 | 3300009177 | Bacteria | 3438 |
| 73 | Ga0105248_10181213 | 3300009177 | Bacteria | 2374 |
| 74 | Ga0105249_10003347 | 3300009553 | Bacteria | 13876 |
| 75 | Ga0105249_10017166 | 3300009553 | Bacteria | 6425 |
| 76 | Ga0157375_10013297 | 3300013308 | Bacteria | 7320 |
| 77 | Ga0157375_10016872 | 3300013308 | Bacteria | 6575 |
| 78 | Ga0157375_10129958 | 3300013308 | Bacteria | 2637 |
| 79 | Ga0157380_10003913 | 3300014326 | Bacteria | 10272 |
| 80 | Ga0157380_10012533 | 3300014326 | Bacteria | 6152 |
| 81 | Ga0157380_10037469 | 3300014326 | Bacteria | 3757 |
| 82 | Ga0157380_10164832 | 3300014326 | Bacteria | 1930 |
| 83 | Ga0207697_10003453 | 3300025315 | Bacteria | 7805 |
| 84 | Ga0207680_10061236 | 3300025903 | Bacteria | 2295 |
| 85 | Ga0207699_10000002 | 3300025906 | Bacteria | 662194 |
| 86 | Ga0207645_10047134 | 3300025907 | Bacteria | 2752 |
| 87 | Ga0207645_10059453 | 3300025907 | Bacteria | 2441 |
| 88 | Ga0207643_10000364 | 3300025908 | Bacteria | 30402 |
| 89 | Ga0207643_10065518 | 3300025908 | Bacteria | 2081 |
| 90 | Ga0207663_10104692 | 3300025916 | Bacteria | 1908 |
| 91 | Ga0207649_10051678 | 3300025920 | Unclassified | 2546 |
| 92 | Ga0207646_10000162 | 3300025922 | Bacteria | 90943 |
| 93 | Ga0207681_10008308 | 3300025923 | Bacteria | 6348 |
| 94 | Ga0207650_10084664 | 3300025925 | Bacteria | 2411 |
| 95 | Ga0207659_10119203 | 3300025926 | Bacteria | 2020 |
| 96 | Ga0207700_10113359 | 3300025928 | Unclassified | 2186 |
| 97 | Ga0207690_10057498 | 3300025932 | Bacteria | 2628 |
| 98 | Ga0207706_10005012 | 3300025933 | Bacteria | 12367 |
| 99 | Ga0207706_10057729 | 3300025933 | Bacteria | 3419 |
| 100 | Ga0207691_10014023 | 3300025940 | Bacteria | 7646 |
| 101 | Ga0207691_10063846 | 3300025940 | Bacteria | 3338 |
| 102 | Ga0207711_10024738 | 3300025941 | Bacteria | 5036 |
| 103 | Ga0207712_10050250 | 3300025961 | Unclassified | 2910 |
| 104 | Ga0207675_100104249 | 3300026118 | Bacteria | 2673 |
| 105 | Ga0207683_10019867 | 3300026121 | Bacteria | 5740 |
| 106 | Ga0207683_10075752 | 3300026121 | Bacteria | 2979 |
| 107 | Ga0207698_10036736 | 3300026142 | Bacteria | 3599 |
| 108 | Ga0207428_10005021 | 3300027907 | Bacteria | 12444 |
| 109 | Ga0207428_10006419 | 3300027907 | Bacteria | 10861 |
| 110 | Ga0207428_10019561 | 3300027907 | Bacteria | 5769 |
| 111 | Ga0207428_10021850 | 3300027907 | Bacteria | 5412 |
| 112 | Ga0268265_10062900 | 3300028380 | Bacteria | 2853 |
| 113 | Ga0268264_10058753 | 3300028381 | Bacteria | 3221 |
| 114 | Ga0265316_10036082 | 3300031344 | Bacteria | 3999 |
| 115 | Ga0265316_10070474 | 3300031344 | Bacteria | 2696 |
| 116 | Ga0307513_10063447 | 3300031456 | Bacteria | 3899 |
| 117 | Ga0307408_100016371 | 3300031548 | Bacteria | 4948 |
| 118 | Ga0307408_100035414 | 3300031548 | Bacteria | 3503 |
| 119 | Ga0307405_10068828 | 3300031731 | Bacteria | 2267 |
| 120 | Ga0307405_10122711 | 3300031731 | Bacteria | 1780 |
| 121 | Ga0307413_10001523 | 3300031824 | Bacteria | 8884 |
| 122 | Ga0307413_10006673 | 3300031824 | Bacteria | 5294 |
| 123 | Ga0307410_10037561 | 3300031852 | Bacteria | 3164 |
| 124 | Ga0307410_10052179 | 3300031852 | Bacteria | 2761 |
| 125 | Ga0307406_10015255 | 3300031901 | Unclassified | 4442 |
| 126 | Ga0307406_10022408 | 3300031901 | Bacteria | 3747 |
| 127 | Ga0307406_10098100 | 3300031901 | Bacteria | 1989 |
| 128 | Ga0307407_10012027 | 3300031903 | Bacteria | 4146 |
| 129 | Ga0307407_10014114 | 3300031903 | Bacteria | 3901 |
| 130 | Ga0307407_10017224 | 3300031903 | Bacteria | 3618 |
| 131 | Ga0307412_10013191 | 3300031911 | Bacteria | 4837 |
| 132 | Ga0307409_100008621 | 3300031995 | Bacteria | 6200 |
| 133 | Ga0307409_100038286 | 3300031995 | Bacteria | 3545 |
| 134 | Ga0307409_100054028 | 3300031995 | Bacteria | 3090 |
| 135 | Ga0307416_100001390 | 3300032002 | Bacteria | 13111 |
| 136 | Ga0307416_100006657 | 3300032002 | Bacteria | 7250 |
| 137 | Ga0307414_10009302 | 3300032004 | Bacteria | 5635 |
| 138 | Ga0307414_10017153 | 3300032004 | Bacteria | 4424 |
| 139 | Ga0307411_10006922 | 3300032005 | Bacteria | 5719 |
| 140 | Ga0307411_10014199 | 3300032005 | Bacteria | 4425 |
| 141 | Ga0307415_100010305 | 3300032126 | Bacteria | 5286 |
| 142 | Ga0307415_100018503 | 3300032126 | Bacteria | 4209 |
| 143 | Ga0373939_0012690 | 3300035114 | Bacteria | 2153 |
| 144 | Ga0451853_0860631 | 3300041512 | Bacteria | 2519 |
| 145 | Ga0450923_004737 | 3300042125 | Unclassified | 2152 |
| 146 | Ga0451576_0082415 | 3300045051 | Bacteria | 3345 |
| 147 | Ga0495621_0006484 | 3300046539 | Bacteria | 3421 |
| 148 | Ga0495668_0000976 | 3300046616 | Bacteria | 31469 |
| 149 | Ga0495588_0029191 | 3300046674 | Unclassified | 2766 |
| 150 | Ga0495674_0069228 | 3300047319 | Bacteria | 3052 |
| 151 | Ga0496102_0231311 | 3300048905 | Bacteria | 1743 |
| 152 | Ga0496104_0037318 | 3300048907 | Bacteria | 4544 |
| 153 | Ga0496105_0080670 | 3300048908 | Unclassified | 2688 |
| 154 | Ga0496108_0005059 | 3300048911 | Bacteria | 10651 |
| 155 | Ga0496108_0015332 | 3300048911 | Bacteria | 6252 |
| 156 | Ga0496108_0094137 | 3300048911 | Unclassified | 2550 |
| 157 | Ga0496109_0000125 | 3300048912 | Bacteria | 78217 |
| 158 | Ga0496109_0015210 | 3300048912 | Bacteria | 6699 |
| 159 | Ga0496110_0007256 | 3300048913 | Bacteria | 8836 |
| 160 | Ga0496112_0009365 | 3300048915 | Bacteria | 8819 |
| 161 | Ga0496112_0013697 | 3300048915 | Bacteria | 7496 |
| 162 | Ga0496114_0175302 | 3300048917 | Unclassified | 1871 |
| 163 | Ga0496115_0009976 | 3300048918 | Bacteria | 7076 |
| 164 | Ga0501073_0008675 | 3300049589 | Bacteria | 7529 |
| 165 | Ga0501075_0052291 | 3300049591 | Unclassified | 3072 |
| 166 | Ga0501247_000216 | 3300049677 | Bacteria | 3890 |
| 167 | Ga0501221_009987 | 3300049704 | Bacteria | 1676 |
| 168 | Ga0501079_0140097 | 3300049741 | Bacteria | 1884 |
| 169 | Ga0501079_0150882 | 3300049741 | Bacteria | 1812 |
| 170 | Ga0501081_0021409 | 3300049743 | Bacteria | 4314 |
| 171 | Ga0501268_000395 | 3300049765 | Bacteria | 4650 |
| 172 | Ga0501272_000714 | 3300049769 | Bacteria | 2989 |
| 173 | nmdc:mga05p37_13170_c1 | 3300050507 | Bacteria | 9900 |
| 174 | nmdc:mga05p37_24558_c1 | 3300050507 | Bacteria | 7326 |
| 175 | nmdc:mga09592_354_c1 | 3300050508 | Bacteria | 33681 |
| 176 | nmdc:mga06r32_10947_c1 | 3300050510 | Bacteria | 8167 |
| 177 | nmdc:mga06r32_16041_c1 | 3300050510 | Bacteria | 6819 |
| 178 | nmdc:mga06r32_59202_c1 | 3300050510 | Bacteria | 3683 |
| 179 | nmdc:mga08y16_144955_c1 | 3300050511 | Bacteria | 2469 |
| 180 | nmdc:mga08y16_14624_c1 | 3300050511 | Bacteria | 8254 |
| 181 | nmdc:mga08y16_16300_c1 | 3300050511 | Bacteria | 7814 |
| 182 | nmdc:mga08y16_185346_c1 | 3300050511 | Unclassified | 2160 |
| 183 | nmdc:mga08y16_43407_c1 | 3300050511 | Bacteria | 4712 |
| 184 | nmdc:mga0n895_113716_c1 | 3300050512 | Bacteria | 2724 |
| 185 | nmdc:mga0n895_91085_c1 | 3300050512 | Unclassified | 3051 |
| 186 | nmdc:mga0a205_11831_c1 | 3300050515 | Bacteria | 8054 |
| 187 | nmdc:mga0a205_30666_c1 | 3300050515 | Bacteria | 5150 |
| 188 | nmdc:mga0a205_6473_c1 | 3300050515 | Bacteria | 10588 |
| 189 | Ga0495601_0011566 | 3300053077 | Bacteria | 5287 |
| 190 | Ga0495619_0048844 | 3300053085 | Bacteria | 2789 |
| 191 | Ga0500555_009364 | 3300053103 | Bacteria | 2802 |
| 192 | Ga0500616_0004754 | 3300053153 | Bacteria | 9546 |
| 193 | Ga0501082_0003411 | 3300060353 | Bacteria | 13872 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025928 | Ga0207700_10113359 | Ga0207700_101133591 | 444 |
| 2 | 3300035114 | Ga0373939_0012690 | Ga0373939_0012690_710_2128 | 446 |
| 3 | 3300050511 | nmdc:mga08y16_16300_c1 | nmdc:mga08y16_16300_c1_38_1468 | 458 |
| 4 | 3300042125 | Ga0450923_004737 | Ga0450923_004737_636_2132 | 482 |
| 5 | 3300009177 | Ga0105248_10181213 | Ga0105248_101812132 | 488 |
| 6 | 3300005985 | Ga0081539_10043053 | Ga0081539_100430533 | 493 |
| 7 | 3300014326 | Ga0157380_10012533 | Ga0157380_100125332 | 493 |
| 8 | 3300060353 | Ga0501082_0003411 | Ga0501082_0003411_6833_8434 | 495 |
| 9 | 3300005295 | Ga0065707_10110445 | Ga0065707_101104453 | 497 |
| 10 | 3300025925 | Ga0207650_10084664 | Ga0207650_100846642 | 497 |
| 11 | 3300006847 | Ga0075431_100007792 | Ga0075431_1000077924 | 499 |
| 12 | 3300009094 | Ga0111539_10051826 | Ga0111539_100518263 | 500 |
| 13 | 3300027907 | Ga0207428_10019561 | Ga0207428_100195614 | 500 |
| 14 | 3300050511 | nmdc:mga08y16_14624_c1 | nmdc:mga08y16_14624_c1_2694_4394 | 500 |
| 15 | 3300050510 | nmdc:mga06r32_10947_c1 | nmdc:mga06r32_10947_c1_3749_5416 | 501 |
| 16 | 3300031824 | Ga0307413_10001523 | Ga0307413_100015234 | 502 |
| 17 | 3300049743 | Ga0501081_0021409 | Ga0501081_0021409_2145_3782 | 503 |
| 18 | 3300005354 | Ga0070675_100166989 | Ga0070675_1001669891 | 504 |
| 19 | 3300025926 | Ga0207659_10119203 | Ga0207659_101192031 | 504 |
| 20 | 3300027907 | Ga0207428_10021850 | Ga0207428_100218503 | 505 |
| 21 | 3300050511 | nmdc:mga08y16_43407_c1 | nmdc:mga08y16_43407_c1_1714_3363 | 505 |
| 22 | 3300006844 | Ga0075428_100066360 | Ga0075428_1000663602 | 506 |
| 23 | 3300032002 | Ga0307416_100001390 | Ga0307416_1000013904 | 506 |
| 24 | 3300050510 | nmdc:mga06r32_59202_c1 | nmdc:mga06r32_59202_c1_1065_2696 | 506 |
| 25 | 3300031456 | Ga0307513_10063447 | Ga0307513_100634474 | 507 |
| 26 | 3300005468 | Ga0070707_100000065 | Ga0070707_10000006551 | 509 |
| 27 | 3300005518 | Ga0070699_100123220 | Ga0070699_1001232201 | 509 |
| 28 | 3300009148 | Ga0105243_10161508 | Ga0105243_101615081 | 509 |
| 29 | 3300025922 | Ga0207646_10000162 | Ga0207646_1000016223 | 509 |
| 30 | 3300005340 | Ga0070689_100006724 | Ga0070689_1000067242 | 510 |
| 31 | 3300006847 | Ga0075431_100051691 | Ga0075431_1000516914 | 510 |
| 32 | 3300025916 | Ga0207663_10104692 | Ga0207663_101046921 | 510 |
| 33 | 3300031548 | Ga0307408_100035414 | Ga0307408_1000354142 | 510 |
| 34 | 3300031731 | Ga0307405_10122711 | Ga0307405_101227111 | 510 |
| 35 | 3300031852 | Ga0307410_10037561 | Ga0307410_100375612 | 510 |
| 36 | 3300031901 | Ga0307406_10015255 | Ga0307406_100152554 | 510 |
| 37 | 3300031911 | Ga0307412_10013191 | Ga0307412_100131913 | 510 |
| 38 | 3300031995 | Ga0307409_100054028 | Ga0307409_1000540282 | 510 |
| 39 | 3300032002 | Ga0307416_100006657 | Ga0307416_1000066574 | 510 |
| 40 | 3300032004 | Ga0307414_10017153 | Ga0307414_100171533 | 510 |
| 41 | 3300046539 | Ga0495621_0006484 | Ga0495621_0006484_425_2008 | 510 |
| 42 | 3300013308 | Ga0157375_10129958 | Ga0157375_101299582 | 511 |
| 43 | 3300005548 | Ga0070665_100127876 | Ga0070665_1001278762 | 512 |
| 44 | 3300005844 | Ga0068862_100029417 | Ga0068862_1000294174 | 512 |
| 45 | 3300009177 | Ga0105248_10063413 | Ga0105248_100634133 | 512 |
| 46 | 3300009177 | Ga0105248_10090882 | Ga0105248_100908823 | 512 |
| 47 | 3300009553 | Ga0105249_10017166 | Ga0105249_100171663 | 512 |
| 48 | 3300025907 | Ga0207645_10047134 | Ga0207645_100471342 | 512 |
| 49 | 3300026121 | Ga0207683_10075752 | Ga0207683_100757522 | 512 |
| 50 | 3300031344 | Ga0265316_10036082 | Ga0265316_100360822 | 512 |
| 51 | 3300031344 | Ga0265316_10070474 | Ga0265316_100704741 | 512 |
| 52 | 3300031824 | Ga0307413_10006673 | Ga0307413_100066733 | 512 |
| 53 | 3300031903 | Ga0307407_10012027 | Ga0307407_100120272 | 512 |
| 54 | 3300031995 | Ga0307409_100008621 | Ga0307409_1000086213 | 512 |
| 55 | 3300032005 | Ga0307411_10006922 | Ga0307411_100069223 | 512 |
| 56 | 3300048908 | Ga0496105_0080670 | Ga0496105_0080670_938_2536 | 512 |
| 57 | 3300048911 | Ga0496108_0015332 | Ga0496108_0015332_2842_4530 | 512 |
| 58 | 3300048912 | Ga0496109_0000125 | Ga0496109_0000125_62341_63987 | 512 |
| 59 | 3300048912 | Ga0496109_0015210 | Ga0496109_0015210_1843_3522 | 512 |
| 60 | 3300048915 | Ga0496112_0013697 | Ga0496112_0013697_2089_3768 | 512 |
| 61 | 3300048917 | Ga0496114_0175302 | Ga0496114_0175302_274_1857 | 512 |
| 62 | 3300053153 | Ga0500616_0004754 | Ga0500616_0004754_5370_7055 | 512 |
| 63 | 3300005331 | Ga0070670_100007167 | Ga0070670_1000071673 | 513 |
| 64 | 3300031901 | Ga0307406_10098100 | Ga0307406_100981001 | 513 |
| 65 | 3300049589 | Ga0501073_0008675 | Ga0501073_0008675_3505_5088 | 513 |
| 66 | 3300006844 | Ga0075428_100010091 | Ga0075428_1000100913 | 514 |
| 67 | 3300006847 | Ga0075431_100048563 | Ga0075431_1000485632 | 514 |
| 68 | 3300006880 | Ga0075429_100062586 | Ga0075429_1000625862 | 514 |
| 69 | 3300009094 | Ga0111539_10034144 | Ga0111539_100341443 | 514 |
| 70 | 3300009147 | Ga0114129_10005741 | Ga0114129_1000574119 | 514 |
| 71 | 3300031548 | Ga0307408_100016371 | Ga0307408_1000163712 | 514 |
| 72 | 3300031731 | Ga0307405_10068828 | Ga0307405_100688282 | 514 |
| 73 | 3300031852 | Ga0307410_10052179 | Ga0307410_100521791 | 514 |
| 74 | 3300031903 | Ga0307407_10014114 | Ga0307407_100141142 | 514 |
| 75 | 3300032005 | Ga0307411_10014199 | Ga0307411_100141992 | 514 |
| 76 | 3300032126 | Ga0307415_100010305 | Ga0307415_1000103055 | 514 |
| 77 | 3300049591 | Ga0501075_0052291 | Ga0501075_0052291_959_2542 | 514 |
| 78 | 3300049741 | Ga0501079_0150882 | Ga0501079_0150882_143_1726 | 514 |
| 79 | 3300050510 | nmdc:mga06r32_16041_c1 | nmdc:mga06r32_16041_c1_2278_3885 | 514 |
| 80 | 3300005353 | Ga0070669_100001326 | Ga0070669_1000013265 | 515 |
| 81 | 3300009094 | Ga0111539_10013258 | Ga0111539_100132583 | 515 |
| 82 | 3300009094 | Ga0111539_10285236 | Ga0111539_102852361 | 515 |
| 83 | 3300009553 | Ga0105249_10003347 | Ga0105249_100033477 | 515 |
| 84 | 3300014326 | Ga0157380_10164832 | Ga0157380_101648322 | 515 |
| 85 | 3300025923 | Ga0207681_10008308 | Ga0207681_100083082 | 515 |
| 86 | 3300027907 | Ga0207428_10006419 | Ga0207428_100064194 | 515 |
| 87 | 3300031901 | Ga0307406_10022408 | Ga0307406_100224083 | 515 |
| 88 | 3300031903 | Ga0307407_10017224 | Ga0307407_100172242 | 515 |
| 89 | 3300031995 | Ga0307409_100038286 | Ga0307409_1000382863 | 515 |
| 90 | 3300032004 | Ga0307414_10009302 | Ga0307414_100093023 | 515 |
| 91 | 3300032126 | Ga0307415_100018503 | Ga0307415_1000185032 | 515 |
| 92 | 3300050511 | nmdc:mga08y16_185346_c1 | nmdc:mga08y16_185346_c1_330_1934 | 515 |
| 93 | 3300050512 | nmdc:mga0n895_113716_c1 | nmdc:mga0n895_113716_c1_674_2254 | 515 |
| 94 | 3300005844 | Ga0068862_100023483 | Ga0068862_1000234834 | 516 |
| 95 | 3300006844 | Ga0075428_100046065 | Ga0075428_1000460652 | 516 |
| 96 | 3300009094 | Ga0111539_10033523 | Ga0111539_100335235 | 516 |
| 97 | 3300027907 | Ga0207428_10005021 | Ga0207428_100050218 | 516 |
| 98 | 3300048911 | Ga0496108_0094137 | Ga0496108_0094137_610_2202 | 516 |
| 99 | 3300050511 | nmdc:mga08y16_144955_c1 | nmdc:mga08y16_144955_c1_516_2099 | 516 |
| 100 | 3300005328 | Ga0070676_10032138 | Ga0070676_100321382 | 517 |
| 101 | 3300005329 | Ga0070683_100026769 | Ga0070683_1000267691 | 517 |
| 102 | 3300005335 | Ga0070666_10002763 | Ga0070666_100027632 | 517 |
| 103 | 3300005337 | Ga0070682_100039675 | Ga0070682_1000396752 | 517 |
| 104 | 3300005344 | Ga0070661_100002753 | Ga0070661_1000027532 | 517 |
| 105 | 3300005366 | Ga0070659_100159272 | Ga0070659_1001592721 | 517 |
| 106 | 3300005535 | Ga0070684_100000236 | Ga0070684_10000023630 | 517 |
| 107 | 3300005543 | Ga0070672_100035709 | Ga0070672_1000357092 | 517 |
| 108 | 3300005564 | Ga0070664_100001147 | Ga0070664_10000114725 | 517 |
| 109 | 3300005616 | Ga0068852_100083991 | Ga0068852_1000839912 | 517 |
| 110 | 3300005844 | Ga0068862_100016861 | Ga0068862_1000168616 | 517 |
| 111 | 3300006358 | Ga0068871_100030996 | Ga0068871_1000309964 | 517 |
| 112 | 3300006844 | Ga0075428_100001564 | Ga0075428_10000156417 | 517 |
| 113 | 3300006847 | Ga0075431_100000898 | Ga0075431_1000008988 | 517 |
| 114 | 3300006880 | Ga0075429_100001568 | Ga0075429_1000015686 | 517 |
| 115 | 3300009177 | Ga0105248_10022838 | Ga0105248_100228382 | 517 |
| 116 | 3300013308 | Ga0157375_10013297 | Ga0157375_100132972 | 517 |
| 117 | 3300014326 | Ga0157380_10037469 | Ga0157380_100374691 | 517 |
| 118 | 3300025903 | Ga0207680_10061236 | Ga0207680_100612361 | 517 |
| 119 | 3300025920 | Ga0207649_10051678 | Ga0207649_100516782 | 517 |
| 120 | 3300025933 | Ga0207706_10057729 | Ga0207706_100577292 | 517 |
| 121 | 3300025941 | Ga0207711_10024738 | Ga0207711_100247382 | 517 |
| 122 | 3300026118 | Ga0207675_100104249 | Ga0207675_1001042492 | 517 |
| 123 | 3300026142 | Ga0207698_10036736 | Ga0207698_100367364 | 517 |
| 124 | 3300046616 | Ga0495668_0000976 | Ga0495668_0000976_26023_27696 | 517 |
| 125 | 3300047319 | Ga0495674_0069228 | Ga0495674_0069228_74_1702 | 517 |
| 126 | 3300048905 | Ga0496102_0231311 | Ga0496102_0231311_78_1685 | 517 |
| 127 | 3300048907 | Ga0496104_0037318 | Ga0496104_0037318_2629_4227 | 517 |
| 128 | 3300048911 | Ga0496108_0005059 | Ga0496108_0005059_4924_6522 | 517 |
| 129 | 3300048913 | Ga0496110_0007256 | Ga0496110_0007256_3734_5332 | 517 |
| 130 | 3300048915 | Ga0496112_0009365 | Ga0496112_0009365_4557_6155 | 517 |
| 131 | 3300048918 | Ga0496115_0009976 | Ga0496115_0009976_1076_2704 | 517 |
| 132 | 3300050507 | nmdc:mga05p37_24558_c1 | nmdc:mga05p37_24558_c1_1191_2819 | 517 |
| 133 | 3300050508 | nmdc:mga09592_354_c1 | nmdc:mga09592_354_c1_17411_19039 | 517 |
| 134 | 3300053077 | Ga0495601_0011566 | Ga0495601_0011566_1045_2673 | 517 |
| 135 | 3300053085 | Ga0495619_0048844 | Ga0495619_0048844_567_2195 | 517 |
| 136 | 3300005434 | Ga0070709_10000033 | Ga0070709_1000003380 | 518 |
| 137 | 3300005937 | Ga0081455_10008419 | Ga0081455_100084199 | 518 |
| 138 | 3300006852 | Ga0075433_10062747 | Ga0075433_100627473 | 518 |
| 139 | 3300009147 | Ga0114129_10015893 | Ga0114129_100158933 | 518 |
| 140 | 3300025906 | Ga0207699_10000002 | Ga0207699_10000002512 | 518 |
| 141 | 3300025907 | Ga0207645_10059453 | Ga0207645_100594532 | 518 |
| 142 | 3300025940 | Ga0207691_10063846 | Ga0207691_100638462 | 518 |
| 143 | 3300046674 | Ga0495588_0029191 | Ga0495588_0029191_1124_2722 | 518 |
| 144 | 3300049677 | Ga0501247_000216 | Ga0501247_000216_1667_3274 | 518 |
| 145 | 3300049704 | Ga0501221_009987 | Ga0501221_009987_48_1655 | 518 |
| 146 | 3300049741 | Ga0501079_0140097 | Ga0501079_0140097_145_1737 | 518 |
| 147 | 3300049765 | Ga0501268_000395 | Ga0501268_000395_56_1663 | 518 |
| 148 | 3300049769 | Ga0501272_000714 | Ga0501272_000714_1234_2841 | 518 |
| 149 | 3300050507 | nmdc:mga05p37_13170_c1 | nmdc:mga05p37_13170_c1_6383_8032 | 518 |
| 150 | 3300050515 | nmdc:mga0a205_30666_c1 | nmdc:mga0a205_30666_c1_2391_4040 | 518 |
| 151 | 3300005354 | Ga0070675_100036754 | Ga0070675_1000367544 | 519 |
| 152 | 3300005618 | Ga0068864_100076669 | Ga0068864_1000766691 | 519 |
| 153 | 3300005840 | Ga0068870_10068948 | Ga0068870_100689482 | 519 |
| 154 | 3300025908 | Ga0207643_10065518 | Ga0207643_100655182 | 519 |
| 155 | 3300041512 | Ga0451853_0860631 | Ga0451853_0860631_327_1940 | 519 |
| 156 | 3300053103 | Ga0500555_009364 | Ga0500555_009364_1010_2641 | 519 |
| 157 | 3300005293 | Ga0065715_10098804 | Ga0065715_100988041 | 520 |
| 158 | 3300050512 | nmdc:mga0n895_91085_c1 | nmdc:mga0n895_91085_c1_1423_3024 | 520 |
| 159 | 3300050515 | nmdc:mga0a205_11831_c1 | nmdc:mga0a205_11831_c1_597_2198 | 520 |
| 160 | 3300005293 | Ga0065715_10095055 | Ga0065715_100950553 | 521 |
| 161 | 3300005330 | Ga0070690_100004973 | Ga0070690_1000049735 | 521 |
| 162 | 3300005338 | Ga0068868_100008037 | Ga0068868_1000080375 | 521 |
| 163 | 3300005340 | Ga0070689_100003330 | Ga0070689_1000033304 | 521 |
| 164 | 3300005347 | Ga0070668_100045864 | Ga0070668_1000458642 | 521 |
| 165 | 3300005366 | Ga0070659_100081461 | Ga0070659_1000814612 | 521 |
| 166 | 3300005367 | Ga0070667_100009447 | Ga0070667_1000094476 | 521 |
| 167 | 3300005441 | Ga0070700_100006429 | Ga0070700_1000064296 | 521 |
| 168 | 3300005456 | Ga0070678_100050545 | Ga0070678_1000505452 | 521 |
| 169 | 3300005457 | Ga0070662_100057961 | Ga0070662_1000579612 | 521 |
| 170 | 3300005543 | Ga0070672_100048216 | Ga0070672_1000482162 | 521 |
| 171 | 3300005617 | Ga0068859_100051678 | Ga0068859_1000516783 | 521 |
| 172 | 3300005719 | Ga0068861_100010474 | Ga0068861_1000104742 | 521 |
| 173 | 3300005840 | Ga0068870_10000938 | Ga0068870_100009386 | 521 |
| 174 | 3300005843 | Ga0068860_100006516 | Ga0068860_1000065169 | 521 |
| 175 | 3300005844 | Ga0068862_100002460 | Ga0068862_1000024604 | 521 |
| 176 | 3300006852 | Ga0075433_10002620 | Ga0075433_1000262012 | 521 |
| 177 | 3300006871 | Ga0075434_100046496 | Ga0075434_1000464963 | 521 |
| 178 | 3300006880 | Ga0075429_100005144 | Ga0075429_1000051442 | 521 |
| 179 | 3300006931 | Ga0097620_100051676 | Ga0097620_1000516763 | 521 |
| 180 | 3300009094 | Ga0111539_10052150 | Ga0111539_100521503 | 521 |
| 181 | 3300013308 | Ga0157375_10016872 | Ga0157375_100168722 | 521 |
| 182 | 3300014326 | Ga0157380_10003913 | Ga0157380_100039132 | 521 |
| 183 | 3300025315 | Ga0207697_10003453 | Ga0207697_100034536 | 521 |
| 184 | 3300025908 | Ga0207643_10000364 | Ga0207643_1000036421 | 521 |
| 185 | 3300025932 | Ga0207690_10057498 | Ga0207690_100574982 | 521 |
| 186 | 3300025933 | Ga0207706_10005012 | Ga0207706_100050122 | 521 |
| 187 | 3300025940 | Ga0207691_10014023 | Ga0207691_100140232 | 521 |
| 188 | 3300025961 | Ga0207712_10050250 | Ga0207712_100502502 | 521 |
| 189 | 3300026121 | Ga0207683_10019867 | Ga0207683_100198673 | 521 |
| 190 | 3300028380 | Ga0268265_10062900 | Ga0268265_100629002 | 521 |
| 191 | 3300028381 | Ga0268264_10058753 | Ga0268264_100587532 | 521 |
| 192 | 3300045051 | Ga0451576_0082415 | Ga0451576_0082415_1648_3291 | 521 |
| 193 | 3300050515 | nmdc:mga0a205_6473_c1 | nmdc:mga0a205_6473_c1_7362_9005 | 521 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gne-assembly2.cif.gz_B | crystal structure of lapb from legionella pneumophila | 0.791 | 289 | 498 |
| 3b3s-assembly1.cif.gz_A | crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine | 0.788 | 289 | 500 |
| 6esl-assembly1.cif.gz_B | crystal structure of the legionella pneumoppila lapa | 0.7785 | 289 | 498 |
| 6ica-assembly1.cif.gz_A | the crystal structure of legionella pneumophila lapa aminopeptidase | 0.7757 | 289 | 500 |
| 3iib-assembly1.cif.gz_A-2 | crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution | 0.7738 | 29 | 515 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8489 | 29 | 515 | 3.40.630.10 |
| 3iibA01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8295 | 29 | 515 | 3.40.630.10 |
| af_Q55DP8_2_191_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8098 | 289 | 368 | 3.40.630.10 |
| af_B6TIJ2_17_198_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8035 | 290 | 358 | 3.40.630.10 |
| 5ib9A02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.7981 | 99 | 279 | 3.50.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2IXV5-F1-model_v4 | M28 family peptidase | 0.9803 | 373 | 515 |
|
| AF-A0A2V8QWT3-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9745 | 343 | 521 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A7V8NQC5-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9707 | 318 | 521 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A2V8VUS4-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9689 | 286 | 521 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
| AF-A0A2V8XRQ8-F1-model_v4 | Carboxypeptidase Q (Plasma glutamate carboxypeptidase) | 0.9599 | 281 | 521 |
GO:0004180
GO:0005576 GO:0005764 GO:0070573 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar