F297175

General Info

Members Datasets Scaffolds Average Seq Length
193 122 193 525

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10013297|Ga0157375_100132972
Length 560
Sequence VRQAILRRQTNFTKEIMKKTTTVLFLLFCLLFQSVSAVRAQTVPNQADVFANIRKEGMDNSQIMRTLHFFTDVYGPRLTGSPNLKAAGNWAVAEMTKWGFENAKLEPWDFGHPGWINERASGFITAPVQDSLVFEVLSWTPGTKKKKGVKGQAFQLILPTTPAPTENNPNAVQQPTQAELTAYFDSIKSQIKGKMVLIGKPAVIPVNINPPPKRLNDEDLKKRFDPNNPQQPFNFPQPPTPKPGTLTGQQVAEQLDQFLVDNEAAVRINDAGREHGQIRAFNNRSFDISKTVPTVVMRNEDFGRISRLMADGTAVSLEFNIKNTIIPEGTTSFNTVAEITGTDKKDEVIMLGGHLDSWHAATGATDNAVGCAVMMEAVRILKTLGVKPRRTIRVALWSGEEQGLLGSQAYVKEHFGSFEEQKPGFEKFGGYFNIDSGTGRARGMSIFGPPEAATILREALAPYSDIGFVGVINSKSRGLGGSDNTSFNQAGLPGIGVQQDPIEYGSHTWHTNLDTYERIIEDDVKKSAIVIASAVYVLAMRDELLPRYSKEQMPALPTKK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
107 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
111 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 6.74
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10095055 3300005293 Bacteria 4178
2 Ga0065715_10098804 3300005293 Bacteria 3496
3 Ga0065707_10110445 3300005295 Bacteria 2430
4 Ga0070676_10032138 3300005328 Bacteria 3005
5 Ga0070683_100026769 3300005329 Bacteria 5196
6 Ga0070690_100004973 3300005330 Bacteria 7440
7 Ga0070670_100007167 3300005331 Bacteria 9444
8 Ga0070666_10002763 3300005335 Bacteria 10602
9 Ga0070682_100039675 3300005337 Bacteria 2894
10 Ga0068868_100008037 3300005338 Bacteria 7543
11 Ga0070689_100003330 3300005340 Bacteria 10672
12 Ga0070689_100006724 3300005340 Bacteria 7991
13 Ga0070661_100002753 3300005344 Bacteria 12055
14 Ga0070668_100045864 3300005347 Bacteria 3354
15 Ga0070669_100001326 3300005353 Bacteria 17847
16 Ga0070675_100036754 3300005354 Bacteria 3987
17 Ga0070675_100166989 3300005354 Bacteria 1896
18 Ga0070659_100081461 3300005366 Bacteria 2585
19 Ga0070659_100159272 3300005366 Unclassified 1845
20 Ga0070667_100009447 3300005367 Bacteria 8089
21 Ga0070709_10000033 3300005434 Bacteria 116407
22 Ga0070700_100006429 3300005441 Bacteria 6286
23 Ga0070678_100050545 3300005456 Bacteria 3008
24 Ga0070662_100057961 3300005457 Bacteria 2816
25 Ga0070707_100000065 3300005468 Bacteria 95519
26 Ga0070699_100123220 3300005518 Bacteria 2280
27 Ga0070684_100000236 3300005535 Bacteria 38259
28 Ga0070672_100035709 3300005543 Bacteria 3779
29 Ga0070672_100048216 3300005543 Bacteria 3309
30 Ga0070665_100127876 3300005548 Bacteria 2543
31 Ga0070664_100001147 3300005564 Bacteria 20989
32 Ga0068852_100083991 3300005616 Bacteria 2833
33 Ga0068859_100051678 3300005617 Unclassified 4131
34 Ga0068864_100076669 3300005618 Bacteria 2922
35 Ga0068861_100010474 3300005719 Bacteria 6434
36 Ga0068870_10000938 3300005840 Bacteria 11437
37 Ga0068870_10068948 3300005840 Bacteria 1923
38 Ga0068860_100006516 3300005843 Bacteria 11719
39 Ga0068862_100002460 3300005844 Bacteria 16408
40 Ga0068862_100016861 3300005844 Bacteria 6080
41 Ga0068862_100023483 3300005844 Bacteria 5168
42 Ga0068862_100029417 3300005844 Bacteria 4630
43 Ga0081455_10008419 3300005937 Bacteria 10728
44 Ga0081539_10043053 3300005985 Unclassified 2622
45 Ga0068871_100030996 3300006358 Bacteria 4214
46 Ga0075428_100001564 3300006844 Bacteria 24545
47 Ga0075428_100010091 3300006844 Bacteria 10491
48 Ga0075428_100046065 3300006844 Bacteria 4792
49 Ga0075428_100066360 3300006844 Unclassified 3951
50 Ga0075431_100000898 3300006847 Bacteria 26211
51 Ga0075431_100007792 3300006847 Bacteria 10666
52 Ga0075431_100048563 3300006847 Bacteria 4378
53 Ga0075431_100051691 3300006847 Bacteria 4237
54 Ga0075433_10002620 3300006852 Bacteria 13720
55 Ga0075433_10062747 3300006852 Bacteria 3255
56 Ga0075434_100046496 3300006871 Unclassified 4307
57 Ga0075429_100001568 3300006880 Bacteria 18777
58 Ga0075429_100005144 3300006880 Bacteria 11249
59 Ga0075429_100062586 3300006880 Bacteria 3242
60 Ga0097620_100051676 3300006931 Unclassified 4131
61 Ga0111539_10013258 3300009094 Bacteria 10305
62 Ga0111539_10033523 3300009094 Bacteria 6235
63 Ga0111539_10034144 3300009094 Bacteria 6171
64 Ga0111539_10051826 3300009094 Bacteria 4886
65 Ga0111539_10052150 3300009094 Unclassified 4870
66 Ga0111539_10285236 3300009094 Bacteria 1921
67 Ga0114129_10005741 3300009147 Bacteria 17583
68 Ga0114129_10015893 3300009147 Bacteria 10705
69 Ga0105243_10161508 3300009148 Bacteria 1932
70 Ga0105248_10022838 3300009177 Bacteria 6945
71 Ga0105248_10063413 3300009177 Bacteria 4148
72 Ga0105248_10090882 3300009177 Bacteria 3438
73 Ga0105248_10181213 3300009177 Bacteria 2374
74 Ga0105249_10003347 3300009553 Bacteria 13876
75 Ga0105249_10017166 3300009553 Bacteria 6425
76 Ga0157375_10013297 3300013308 Bacteria 7320
77 Ga0157375_10016872 3300013308 Bacteria 6575
78 Ga0157375_10129958 3300013308 Bacteria 2637
79 Ga0157380_10003913 3300014326 Bacteria 10272
80 Ga0157380_10012533 3300014326 Bacteria 6152
81 Ga0157380_10037469 3300014326 Bacteria 3757
82 Ga0157380_10164832 3300014326 Bacteria 1930
83 Ga0207697_10003453 3300025315 Bacteria 7805
84 Ga0207680_10061236 3300025903 Bacteria 2295
85 Ga0207699_10000002 3300025906 Bacteria 662194
86 Ga0207645_10047134 3300025907 Bacteria 2752
87 Ga0207645_10059453 3300025907 Bacteria 2441
88 Ga0207643_10000364 3300025908 Bacteria 30402
89 Ga0207643_10065518 3300025908 Bacteria 2081
90 Ga0207663_10104692 3300025916 Bacteria 1908
91 Ga0207649_10051678 3300025920 Unclassified 2546
92 Ga0207646_10000162 3300025922 Bacteria 90943
93 Ga0207681_10008308 3300025923 Bacteria 6348
94 Ga0207650_10084664 3300025925 Bacteria 2411
95 Ga0207659_10119203 3300025926 Bacteria 2020
96 Ga0207700_10113359 3300025928 Unclassified 2186
97 Ga0207690_10057498 3300025932 Bacteria 2628
98 Ga0207706_10005012 3300025933 Bacteria 12367
99 Ga0207706_10057729 3300025933 Bacteria 3419
100 Ga0207691_10014023 3300025940 Bacteria 7646
101 Ga0207691_10063846 3300025940 Bacteria 3338
102 Ga0207711_10024738 3300025941 Bacteria 5036
103 Ga0207712_10050250 3300025961 Unclassified 2910
104 Ga0207675_100104249 3300026118 Bacteria 2673
105 Ga0207683_10019867 3300026121 Bacteria 5740
106 Ga0207683_10075752 3300026121 Bacteria 2979
107 Ga0207698_10036736 3300026142 Bacteria 3599
108 Ga0207428_10005021 3300027907 Bacteria 12444
109 Ga0207428_10006419 3300027907 Bacteria 10861
110 Ga0207428_10019561 3300027907 Bacteria 5769
111 Ga0207428_10021850 3300027907 Bacteria 5412
112 Ga0268265_10062900 3300028380 Bacteria 2853
113 Ga0268264_10058753 3300028381 Bacteria 3221
114 Ga0265316_10036082 3300031344 Bacteria 3999
115 Ga0265316_10070474 3300031344 Bacteria 2696
116 Ga0307513_10063447 3300031456 Bacteria 3899
117 Ga0307408_100016371 3300031548 Bacteria 4948
118 Ga0307408_100035414 3300031548 Bacteria 3503
119 Ga0307405_10068828 3300031731 Bacteria 2267
120 Ga0307405_10122711 3300031731 Bacteria 1780
121 Ga0307413_10001523 3300031824 Bacteria 8884
122 Ga0307413_10006673 3300031824 Bacteria 5294
123 Ga0307410_10037561 3300031852 Bacteria 3164
124 Ga0307410_10052179 3300031852 Bacteria 2761
125 Ga0307406_10015255 3300031901 Unclassified 4442
126 Ga0307406_10022408 3300031901 Bacteria 3747
127 Ga0307406_10098100 3300031901 Bacteria 1989
128 Ga0307407_10012027 3300031903 Bacteria 4146
129 Ga0307407_10014114 3300031903 Bacteria 3901
130 Ga0307407_10017224 3300031903 Bacteria 3618
131 Ga0307412_10013191 3300031911 Bacteria 4837
132 Ga0307409_100008621 3300031995 Bacteria 6200
133 Ga0307409_100038286 3300031995 Bacteria 3545
134 Ga0307409_100054028 3300031995 Bacteria 3090
135 Ga0307416_100001390 3300032002 Bacteria 13111
136 Ga0307416_100006657 3300032002 Bacteria 7250
137 Ga0307414_10009302 3300032004 Bacteria 5635
138 Ga0307414_10017153 3300032004 Bacteria 4424
139 Ga0307411_10006922 3300032005 Bacteria 5719
140 Ga0307411_10014199 3300032005 Bacteria 4425
141 Ga0307415_100010305 3300032126 Bacteria 5286
142 Ga0307415_100018503 3300032126 Bacteria 4209
143 Ga0373939_0012690 3300035114 Bacteria 2153
144 Ga0451853_0860631 3300041512 Bacteria 2519
145 Ga0450923_004737 3300042125 Unclassified 2152
146 Ga0451576_0082415 3300045051 Bacteria 3345
147 Ga0495621_0006484 3300046539 Bacteria 3421
148 Ga0495668_0000976 3300046616 Bacteria 31469
149 Ga0495588_0029191 3300046674 Unclassified 2766
150 Ga0495674_0069228 3300047319 Bacteria 3052
151 Ga0496102_0231311 3300048905 Bacteria 1743
152 Ga0496104_0037318 3300048907 Bacteria 4544
153 Ga0496105_0080670 3300048908 Unclassified 2688
154 Ga0496108_0005059 3300048911 Bacteria 10651
155 Ga0496108_0015332 3300048911 Bacteria 6252
156 Ga0496108_0094137 3300048911 Unclassified 2550
157 Ga0496109_0000125 3300048912 Bacteria 78217
158 Ga0496109_0015210 3300048912 Bacteria 6699
159 Ga0496110_0007256 3300048913 Bacteria 8836
160 Ga0496112_0009365 3300048915 Bacteria 8819
161 Ga0496112_0013697 3300048915 Bacteria 7496
162 Ga0496114_0175302 3300048917 Unclassified 1871
163 Ga0496115_0009976 3300048918 Bacteria 7076
164 Ga0501073_0008675 3300049589 Bacteria 7529
165 Ga0501075_0052291 3300049591 Unclassified 3072
166 Ga0501247_000216 3300049677 Bacteria 3890
167 Ga0501221_009987 3300049704 Bacteria 1676
168 Ga0501079_0140097 3300049741 Bacteria 1884
169 Ga0501079_0150882 3300049741 Bacteria 1812
170 Ga0501081_0021409 3300049743 Bacteria 4314
171 Ga0501268_000395 3300049765 Bacteria 4650
172 Ga0501272_000714 3300049769 Bacteria 2989
173 nmdc:mga05p37_13170_c1 3300050507 Bacteria 9900
174 nmdc:mga05p37_24558_c1 3300050507 Bacteria 7326
175 nmdc:mga09592_354_c1 3300050508 Bacteria 33681
176 nmdc:mga06r32_10947_c1 3300050510 Bacteria 8167
177 nmdc:mga06r32_16041_c1 3300050510 Bacteria 6819
178 nmdc:mga06r32_59202_c1 3300050510 Bacteria 3683
179 nmdc:mga08y16_144955_c1 3300050511 Bacteria 2469
180 nmdc:mga08y16_14624_c1 3300050511 Bacteria 8254
181 nmdc:mga08y16_16300_c1 3300050511 Bacteria 7814
182 nmdc:mga08y16_185346_c1 3300050511 Unclassified 2160
183 nmdc:mga08y16_43407_c1 3300050511 Bacteria 4712
184 nmdc:mga0n895_113716_c1 3300050512 Bacteria 2724
185 nmdc:mga0n895_91085_c1 3300050512 Unclassified 3051
186 nmdc:mga0a205_11831_c1 3300050515 Bacteria 8054
187 nmdc:mga0a205_30666_c1 3300050515 Bacteria 5150
188 nmdc:mga0a205_6473_c1 3300050515 Bacteria 10588
189 Ga0495601_0011566 3300053077 Bacteria 5287
190 Ga0495619_0048844 3300053085 Bacteria 2789
191 Ga0500555_009364 3300053103 Bacteria 2802
192 Ga0500616_0004754 3300053153 Bacteria 9546
193 Ga0501082_0003411 3300060353 Bacteria 13872

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10113359 Ga0207700_101133591 444
2 3300035114 Ga0373939_0012690 Ga0373939_0012690_710_2128 446
3 3300050511 nmdc:mga08y16_16300_c1 nmdc:mga08y16_16300_c1_38_1468 458
4 3300042125 Ga0450923_004737 Ga0450923_004737_636_2132 482
5 3300009177 Ga0105248_10181213 Ga0105248_101812132 488
6 3300005985 Ga0081539_10043053 Ga0081539_100430533 493
7 3300014326 Ga0157380_10012533 Ga0157380_100125332 493
8 3300060353 Ga0501082_0003411 Ga0501082_0003411_6833_8434 495
9 3300005295 Ga0065707_10110445 Ga0065707_101104453 497
10 3300025925 Ga0207650_10084664 Ga0207650_100846642 497
11 3300006847 Ga0075431_100007792 Ga0075431_1000077924 499
12 3300009094 Ga0111539_10051826 Ga0111539_100518263 500
13 3300027907 Ga0207428_10019561 Ga0207428_100195614 500
14 3300050511 nmdc:mga08y16_14624_c1 nmdc:mga08y16_14624_c1_2694_4394 500
15 3300050510 nmdc:mga06r32_10947_c1 nmdc:mga06r32_10947_c1_3749_5416 501
16 3300031824 Ga0307413_10001523 Ga0307413_100015234 502
17 3300049743 Ga0501081_0021409 Ga0501081_0021409_2145_3782 503
18 3300005354 Ga0070675_100166989 Ga0070675_1001669891 504
19 3300025926 Ga0207659_10119203 Ga0207659_101192031 504
20 3300027907 Ga0207428_10021850 Ga0207428_100218503 505
21 3300050511 nmdc:mga08y16_43407_c1 nmdc:mga08y16_43407_c1_1714_3363 505
22 3300006844 Ga0075428_100066360 Ga0075428_1000663602 506
23 3300032002 Ga0307416_100001390 Ga0307416_1000013904 506
24 3300050510 nmdc:mga06r32_59202_c1 nmdc:mga06r32_59202_c1_1065_2696 506
25 3300031456 Ga0307513_10063447 Ga0307513_100634474 507
26 3300005468 Ga0070707_100000065 Ga0070707_10000006551 509
27 3300005518 Ga0070699_100123220 Ga0070699_1001232201 509
28 3300009148 Ga0105243_10161508 Ga0105243_101615081 509
29 3300025922 Ga0207646_10000162 Ga0207646_1000016223 509
30 3300005340 Ga0070689_100006724 Ga0070689_1000067242 510
31 3300006847 Ga0075431_100051691 Ga0075431_1000516914 510
32 3300025916 Ga0207663_10104692 Ga0207663_101046921 510
33 3300031548 Ga0307408_100035414 Ga0307408_1000354142 510
34 3300031731 Ga0307405_10122711 Ga0307405_101227111 510
35 3300031852 Ga0307410_10037561 Ga0307410_100375612 510
36 3300031901 Ga0307406_10015255 Ga0307406_100152554 510
37 3300031911 Ga0307412_10013191 Ga0307412_100131913 510
38 3300031995 Ga0307409_100054028 Ga0307409_1000540282 510
39 3300032002 Ga0307416_100006657 Ga0307416_1000066574 510
40 3300032004 Ga0307414_10017153 Ga0307414_100171533 510
41 3300046539 Ga0495621_0006484 Ga0495621_0006484_425_2008 510
42 3300013308 Ga0157375_10129958 Ga0157375_101299582 511
43 3300005548 Ga0070665_100127876 Ga0070665_1001278762 512
44 3300005844 Ga0068862_100029417 Ga0068862_1000294174 512
45 3300009177 Ga0105248_10063413 Ga0105248_100634133 512
46 3300009177 Ga0105248_10090882 Ga0105248_100908823 512
47 3300009553 Ga0105249_10017166 Ga0105249_100171663 512
48 3300025907 Ga0207645_10047134 Ga0207645_100471342 512
49 3300026121 Ga0207683_10075752 Ga0207683_100757522 512
50 3300031344 Ga0265316_10036082 Ga0265316_100360822 512
51 3300031344 Ga0265316_10070474 Ga0265316_100704741 512
52 3300031824 Ga0307413_10006673 Ga0307413_100066733 512
53 3300031903 Ga0307407_10012027 Ga0307407_100120272 512
54 3300031995 Ga0307409_100008621 Ga0307409_1000086213 512
55 3300032005 Ga0307411_10006922 Ga0307411_100069223 512
56 3300048908 Ga0496105_0080670 Ga0496105_0080670_938_2536 512
57 3300048911 Ga0496108_0015332 Ga0496108_0015332_2842_4530 512
58 3300048912 Ga0496109_0000125 Ga0496109_0000125_62341_63987 512
59 3300048912 Ga0496109_0015210 Ga0496109_0015210_1843_3522 512
60 3300048915 Ga0496112_0013697 Ga0496112_0013697_2089_3768 512
61 3300048917 Ga0496114_0175302 Ga0496114_0175302_274_1857 512
62 3300053153 Ga0500616_0004754 Ga0500616_0004754_5370_7055 512
63 3300005331 Ga0070670_100007167 Ga0070670_1000071673 513
64 3300031901 Ga0307406_10098100 Ga0307406_100981001 513
65 3300049589 Ga0501073_0008675 Ga0501073_0008675_3505_5088 513
66 3300006844 Ga0075428_100010091 Ga0075428_1000100913 514
67 3300006847 Ga0075431_100048563 Ga0075431_1000485632 514
68 3300006880 Ga0075429_100062586 Ga0075429_1000625862 514
69 3300009094 Ga0111539_10034144 Ga0111539_100341443 514
70 3300009147 Ga0114129_10005741 Ga0114129_1000574119 514
71 3300031548 Ga0307408_100016371 Ga0307408_1000163712 514
72 3300031731 Ga0307405_10068828 Ga0307405_100688282 514
73 3300031852 Ga0307410_10052179 Ga0307410_100521791 514
74 3300031903 Ga0307407_10014114 Ga0307407_100141142 514
75 3300032005 Ga0307411_10014199 Ga0307411_100141992 514
76 3300032126 Ga0307415_100010305 Ga0307415_1000103055 514
77 3300049591 Ga0501075_0052291 Ga0501075_0052291_959_2542 514
78 3300049741 Ga0501079_0150882 Ga0501079_0150882_143_1726 514
79 3300050510 nmdc:mga06r32_16041_c1 nmdc:mga06r32_16041_c1_2278_3885 514
80 3300005353 Ga0070669_100001326 Ga0070669_1000013265 515
81 3300009094 Ga0111539_10013258 Ga0111539_100132583 515
82 3300009094 Ga0111539_10285236 Ga0111539_102852361 515
83 3300009553 Ga0105249_10003347 Ga0105249_100033477 515
84 3300014326 Ga0157380_10164832 Ga0157380_101648322 515
85 3300025923 Ga0207681_10008308 Ga0207681_100083082 515
86 3300027907 Ga0207428_10006419 Ga0207428_100064194 515
87 3300031901 Ga0307406_10022408 Ga0307406_100224083 515
88 3300031903 Ga0307407_10017224 Ga0307407_100172242 515
89 3300031995 Ga0307409_100038286 Ga0307409_1000382863 515
90 3300032004 Ga0307414_10009302 Ga0307414_100093023 515
91 3300032126 Ga0307415_100018503 Ga0307415_1000185032 515
92 3300050511 nmdc:mga08y16_185346_c1 nmdc:mga08y16_185346_c1_330_1934 515
93 3300050512 nmdc:mga0n895_113716_c1 nmdc:mga0n895_113716_c1_674_2254 515
94 3300005844 Ga0068862_100023483 Ga0068862_1000234834 516
95 3300006844 Ga0075428_100046065 Ga0075428_1000460652 516
96 3300009094 Ga0111539_10033523 Ga0111539_100335235 516
97 3300027907 Ga0207428_10005021 Ga0207428_100050218 516
98 3300048911 Ga0496108_0094137 Ga0496108_0094137_610_2202 516
99 3300050511 nmdc:mga08y16_144955_c1 nmdc:mga08y16_144955_c1_516_2099 516
100 3300005328 Ga0070676_10032138 Ga0070676_100321382 517
101 3300005329 Ga0070683_100026769 Ga0070683_1000267691 517
102 3300005335 Ga0070666_10002763 Ga0070666_100027632 517
103 3300005337 Ga0070682_100039675 Ga0070682_1000396752 517
104 3300005344 Ga0070661_100002753 Ga0070661_1000027532 517
105 3300005366 Ga0070659_100159272 Ga0070659_1001592721 517
106 3300005535 Ga0070684_100000236 Ga0070684_10000023630 517
107 3300005543 Ga0070672_100035709 Ga0070672_1000357092 517
108 3300005564 Ga0070664_100001147 Ga0070664_10000114725 517
109 3300005616 Ga0068852_100083991 Ga0068852_1000839912 517
110 3300005844 Ga0068862_100016861 Ga0068862_1000168616 517
111 3300006358 Ga0068871_100030996 Ga0068871_1000309964 517
112 3300006844 Ga0075428_100001564 Ga0075428_10000156417 517
113 3300006847 Ga0075431_100000898 Ga0075431_1000008988 517
114 3300006880 Ga0075429_100001568 Ga0075429_1000015686 517
115 3300009177 Ga0105248_10022838 Ga0105248_100228382 517
116 3300013308 Ga0157375_10013297 Ga0157375_100132972 517
117 3300014326 Ga0157380_10037469 Ga0157380_100374691 517
118 3300025903 Ga0207680_10061236 Ga0207680_100612361 517
119 3300025920 Ga0207649_10051678 Ga0207649_100516782 517
120 3300025933 Ga0207706_10057729 Ga0207706_100577292 517
121 3300025941 Ga0207711_10024738 Ga0207711_100247382 517
122 3300026118 Ga0207675_100104249 Ga0207675_1001042492 517
123 3300026142 Ga0207698_10036736 Ga0207698_100367364 517
124 3300046616 Ga0495668_0000976 Ga0495668_0000976_26023_27696 517
125 3300047319 Ga0495674_0069228 Ga0495674_0069228_74_1702 517
126 3300048905 Ga0496102_0231311 Ga0496102_0231311_78_1685 517
127 3300048907 Ga0496104_0037318 Ga0496104_0037318_2629_4227 517
128 3300048911 Ga0496108_0005059 Ga0496108_0005059_4924_6522 517
129 3300048913 Ga0496110_0007256 Ga0496110_0007256_3734_5332 517
130 3300048915 Ga0496112_0009365 Ga0496112_0009365_4557_6155 517
131 3300048918 Ga0496115_0009976 Ga0496115_0009976_1076_2704 517
132 3300050507 nmdc:mga05p37_24558_c1 nmdc:mga05p37_24558_c1_1191_2819 517
133 3300050508 nmdc:mga09592_354_c1 nmdc:mga09592_354_c1_17411_19039 517
134 3300053077 Ga0495601_0011566 Ga0495601_0011566_1045_2673 517
135 3300053085 Ga0495619_0048844 Ga0495619_0048844_567_2195 517
136 3300005434 Ga0070709_10000033 Ga0070709_1000003380 518
137 3300005937 Ga0081455_10008419 Ga0081455_100084199 518
138 3300006852 Ga0075433_10062747 Ga0075433_100627473 518
139 3300009147 Ga0114129_10015893 Ga0114129_100158933 518
140 3300025906 Ga0207699_10000002 Ga0207699_10000002512 518
141 3300025907 Ga0207645_10059453 Ga0207645_100594532 518
142 3300025940 Ga0207691_10063846 Ga0207691_100638462 518
143 3300046674 Ga0495588_0029191 Ga0495588_0029191_1124_2722 518
144 3300049677 Ga0501247_000216 Ga0501247_000216_1667_3274 518
145 3300049704 Ga0501221_009987 Ga0501221_009987_48_1655 518
146 3300049741 Ga0501079_0140097 Ga0501079_0140097_145_1737 518
147 3300049765 Ga0501268_000395 Ga0501268_000395_56_1663 518
148 3300049769 Ga0501272_000714 Ga0501272_000714_1234_2841 518
149 3300050507 nmdc:mga05p37_13170_c1 nmdc:mga05p37_13170_c1_6383_8032 518
150 3300050515 nmdc:mga0a205_30666_c1 nmdc:mga0a205_30666_c1_2391_4040 518
151 3300005354 Ga0070675_100036754 Ga0070675_1000367544 519
152 3300005618 Ga0068864_100076669 Ga0068864_1000766691 519
153 3300005840 Ga0068870_10068948 Ga0068870_100689482 519
154 3300025908 Ga0207643_10065518 Ga0207643_100655182 519
155 3300041512 Ga0451853_0860631 Ga0451853_0860631_327_1940 519
156 3300053103 Ga0500555_009364 Ga0500555_009364_1010_2641 519
157 3300005293 Ga0065715_10098804 Ga0065715_100988041 520
158 3300050512 nmdc:mga0n895_91085_c1 nmdc:mga0n895_91085_c1_1423_3024 520
159 3300050515 nmdc:mga0a205_11831_c1 nmdc:mga0a205_11831_c1_597_2198 520
160 3300005293 Ga0065715_10095055 Ga0065715_100950553 521
161 3300005330 Ga0070690_100004973 Ga0070690_1000049735 521
162 3300005338 Ga0068868_100008037 Ga0068868_1000080375 521
163 3300005340 Ga0070689_100003330 Ga0070689_1000033304 521
164 3300005347 Ga0070668_100045864 Ga0070668_1000458642 521
165 3300005366 Ga0070659_100081461 Ga0070659_1000814612 521
166 3300005367 Ga0070667_100009447 Ga0070667_1000094476 521
167 3300005441 Ga0070700_100006429 Ga0070700_1000064296 521
168 3300005456 Ga0070678_100050545 Ga0070678_1000505452 521
169 3300005457 Ga0070662_100057961 Ga0070662_1000579612 521
170 3300005543 Ga0070672_100048216 Ga0070672_1000482162 521
171 3300005617 Ga0068859_100051678 Ga0068859_1000516783 521
172 3300005719 Ga0068861_100010474 Ga0068861_1000104742 521
173 3300005840 Ga0068870_10000938 Ga0068870_100009386 521
174 3300005843 Ga0068860_100006516 Ga0068860_1000065169 521
175 3300005844 Ga0068862_100002460 Ga0068862_1000024604 521
176 3300006852 Ga0075433_10002620 Ga0075433_1000262012 521
177 3300006871 Ga0075434_100046496 Ga0075434_1000464963 521
178 3300006880 Ga0075429_100005144 Ga0075429_1000051442 521
179 3300006931 Ga0097620_100051676 Ga0097620_1000516763 521
180 3300009094 Ga0111539_10052150 Ga0111539_100521503 521
181 3300013308 Ga0157375_10016872 Ga0157375_100168722 521
182 3300014326 Ga0157380_10003913 Ga0157380_100039132 521
183 3300025315 Ga0207697_10003453 Ga0207697_100034536 521
184 3300025908 Ga0207643_10000364 Ga0207643_1000036421 521
185 3300025932 Ga0207690_10057498 Ga0207690_100574982 521
186 3300025933 Ga0207706_10005012 Ga0207706_100050122 521
187 3300025940 Ga0207691_10014023 Ga0207691_100140232 521
188 3300025961 Ga0207712_10050250 Ga0207712_100502502 521
189 3300026121 Ga0207683_10019867 Ga0207683_100198673 521
190 3300028380 Ga0268265_10062900 Ga0268265_100629002 521
191 3300028381 Ga0268264_10058753 Ga0268264_100587532 521
192 3300045051 Ga0451576_0082415 Ga0451576_0082415_1648_3291 521
193 3300050515 nmdc:mga0a205_6473_c1 nmdc:mga0a205_6473_c1_7362_9005 521

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

334

535

0.86

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

354

536

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gne-assembly2.cif.gz_B crystal structure of lapb from legionella pneumophila 0.791 289 498
3b3s-assembly1.cif.gz_A crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine 0.788 289 500
6esl-assembly1.cif.gz_B crystal structure of the legionella pneumoppila lapa 0.7785 289 498
6ica-assembly1.cif.gz_A the crystal structure of legionella pneumophila lapa aminopeptidase 0.7757 289 500
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.7738 29 515
ID Description Score Start End Superfamily
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8489 29 515 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8295 29 515 3.40.630.10
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8098 289 368 3.40.630.10
af_B6TIJ2_17_198_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8035 290 358 3.40.630.10
5ib9A02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.7981 99 279 3.50.30.30
ID Description Score Start End GO Terms
AF-A0A7C2IXV5-F1-model_v4 M28 family peptidase 0.9803 373 515
AF-A0A2V8QWT3-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9745 343 521 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7V8NQC5-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9707 318 521 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A2V8VUS4-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9689 286 521 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A2V8XRQ8-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9599 281 521 GO:0004180
GO:0005576
GO:0005764
GO:0070573

Feature Viewer

pLDDT pTM Quality
85.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map