F296913

General Info

Members Datasets Scaffolds Average Seq Length
193 150 386 112

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100066720|Ga0068864_1000667205
Length 134
Sequence MPPDPQMQFRQADRTDIPFHQARDPMAFDEKLATRVRAHLSRRKGVAERKMFGGIIFMLHGNMCCGVHRDALIARVGPEEAGQALKEPHTRVFDLTGRPMKAWVLVEPSALAAGAQLEKWVRRAAKYASSLPPK

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
140 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.81
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 35.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100066720 3300005618 Bacteria 3124
2 Ga0070690_100270037 3300005330 Unclassified 1209
3 Ga0068869_100079452 3300005334 Bacteria 2445
4 Ga0068868_100374319 3300005338 Bacteria 1224
5 Ga0070660_100018627 3300005339 Bacteria 5076
6 Ga0070689_102057629 3300005340 Unclassified 522
7 Ga0070687_100423661 3300005343 Bacteria 879
8 Ga0070692_10300813 3300005345 Unclassified 979
9 Ga0070669_100997817 3300005353 Bacteria 718
10 Ga0070675_100251724 3300005354 Unclassified 1546
11 Ga0070671_102029133 3300005355 Bacteria 512
12 Ga0070673_101268671 3300005364 Unclassified 691
13 Ga0070688_101602444 3300005365 Unclassified 531
14 Ga0070713_100507076 3300005436 Bacteria 1139
15 Ga0070708_100600383 3300005445 Unclassified 1038
16 Ga0070662_100534610 3300005457 Unclassified 981
17 Ga0070681_10534869 3300005458 Bacteria 1085
18 Ga0070707_100456014 3300005468 Bacteria 1239
19 Ga0070707_100577357 3300005468 Unclassified 1087
20 Ga0070698_100701596 3300005471 Bacteria 954
21 Ga0070699_100001899 3300005518 Bacteria 18859
22 Ga0070699_100254744 3300005518 Bacteria 1569
23 Ga0070684_100173660 3300005535 Bacteria 1958
24 Ga0070697_100008005 3300005536 Bacteria 8243
25 Ga0070697_100954338 3300005536 Unclassified 762
26 Ga0070686_100114976 3300005544 Bacteria 1839
27 Ga0070686_100293124 3300005544 Unclassified 1204
28 Ga0070695_100029924 3300005545 Unclassified 3387
29 Ga0070695_101575424 3300005545 Bacteria 548
30 Ga0070696_100000839 3300005546 Bacteria 19825
31 Ga0070704_100269373 3300005549 Unclassified 1406
32 Ga0070704_100549875 3300005549 Unclassified 1008
33 Ga0070704_101063681 3300005549 Unclassified 734
34 Ga0070704_101756493 3300005549 Bacteria 574
35 Ga0068857_100406770 3300005577 Unclassified 1267
36 Ga0068857_101209135 3300005577 Unclassified 732
37 Ga0068854_100613303 3300005578 Bacteria 930
38 Ga0068852_100048803 3300005616 Bacteria 3619
39 Ga0068859_100003072 3300005617 Bacteria 16926
40 Ga0068864_101932983 3300005618 Unclassified 596
41 Ga0068866_11025607 3300005718 Bacteria 587
42 Ga0068861_100045725 3300005719 Unclassified 3298
43 Ga0068870_10263718 3300005840 Unclassified 1073
44 Ga0068863_100321608 3300005841 Unclassified 1503
45 Ga0068860_101498984 3300005843 Bacteria 696
46 Ga0068860_102235087 3300005843 Unclassified 568
47 Ga0068862_100000645 3300005844 Bacteria 36018
48 Ga0068862_100294629 3300005844 Bacteria 1491
49 Ga0068862_100827131 3300005844 Bacteria 906
50 Ga0081455_10020975 3300005937 Bacteria 6139
51 Ga0081455_10082678 3300005937 Bacteria 2626
52 Ga0081455_10094978 3300005937 Bacteria 2407
53 Ga0081539_10119370 3300005985 Bacteria 1312
54 Ga0070715_10535985 3300006163 Unclassified 676
55 Ga0070716_100005181 3300006173 Bacteria 6303
56 Ga0075428_101040513 3300006844 Bacteria 866
57 Ga0075428_102164673 3300006844 Unclassified 574
58 Ga0075433_10155029 3300006852 Unclassified 2038
59 Ga0075434_100622306 3300006871 Bacteria 1098
60 Ga0068865_101703891 3300006881 Unclassified 568
61 Ga0097620_100003072 3300006931 Bacteria 16926
62 Ga0075435_100197025 3300007076 Unclassified 1706
63 Ga0075435_100257105 3300007076 Bacteria 1487
64 Ga0075435_100632921 3300007076 Unclassified 928
65 Ga0075435_101266727 3300007076 Bacteria 645
66 Ga0099794_10342941 3300007265 Unclassified 776
67 Ga0105240_10011817 3300009093 Bacteria 12124
68 Ga0105245_11353734 3300009098 Unclassified 761
69 Ga0105247_11038969 3300009101 Bacteria 642
70 Ga0105249_10122523 3300009553 Bacteria 2473
71 Ga0105249_10491833 3300009553 Unclassified 1271
72 Ga0157370_10015738 3300013104 Bacteria 7680
73 Ga0157369_10017467 3300013105 Bacteria 8062
74 Ga0163162_10772677 3300013306 Unclassified 1079
75 Ga0157372_12326863 3300013307 Bacteria 615
76 Ga0157375_10045342 3300013308 Bacteria 4278
77 Ga0157375_12892611 3300013308 Bacteria 574
78 Ga0163163_10248281 3300014325 Unclassified 1830
79 Ga0157380_10636587 3300014326 Unclassified 1061
80 Ga0157377_10964207 3300014745 Unclassified 643
81 Ga0157379_11530256 3300014968 Unclassified 650
82 Ga0207710_10463123 3300025900 Bacteria 655
83 Ga0207685_10231325 3300025905 Unclassified 884
84 Ga0207643_10252185 3300025908 Unclassified 1087
85 Ga0207695_10051042 3300025913 Bacteria 4346
86 Ga0207662_10007786 3300025918 Bacteria 5841
87 Ga0207646_11212428 3300025922 Unclassified 661
88 Ga0207681_10017799 3300025923 Unclassified 4468
89 Ga0207700_10483943 3300025928 Bacteria 1094
90 Ga0207670_10050978 3300025936 Bacteria 2777
91 Ga0207665_10005734 3300025939 Bacteria 8265
92 Ga0207665_11122893 3300025939 Unclassified 627
93 Ga0207689_10033025 3300025942 Bacteria 4302
94 Ga0207667_10205712 3300025949 Bacteria 2018
95 Ga0207651_10906735 3300025960 Unclassified 785
96 Ga0207712_10140888 3300025961 Bacteria 1850
97 Ga0207712_10528126 3300025961 Unclassified 1012
98 Ga0207640_10555734 3300025981 Bacteria 965
99 Ga0207708_10740982 3300026075 Bacteria 843
100 Ga0207641_10020884 3300026088 Bacteria 5382
101 Ga0207676_10053290 3300026095 Bacteria 3166
102 Ga0207676_10544392 3300026095 Unclassified 1108
103 Ga0207674_12026747 3300026116 Unclassified 540
104 Ga0207675_100049133 3300026118 Bacteria 3938
105 Ga0209969_1015965 3300027360 Bacteria 1099
106 Ga0209981_1038713 3300027378 Bacteria 710
107 Ga0210000_1004032 3300027462 Bacteria 2124
108 Ga0209999_1022000 3300027543 Bacteria 1172
109 Ga0207428_11099903 3300027907 Bacteria 555
110 Ga0268265_10000893 3300028380 Bacteria 27775
111 Ga0268265_10942695 3300028380 Bacteria 850
112 Ga0268264_12515765 3300028381 Unclassified 520
113 Ga0265327_10004083 3300031251 Bacteria 13208
114 Ga0307408_100183535 3300031548 Bacteria 1680
115 Ga0307413_10031892 3300031824 Bacteria 2979
116 Ga0307410_10228285 3300031852 Bacteria 1436
117 Ga0307407_10021616 3300031903 Bacteria 3323
118 Ga0307409_100321221 3300031995 Bacteria 1449
119 Ga0307416_100835112 3300032002 Bacteria 1019
120 Ga0307411_10193086 3300032005 Unclassified 1556
121 Ga0373944_0310403 3300035089 Unclassified 594
122 Ga0373923_0637782 3300035111 Bacteria 526
123 Ga0373942_0072716 3300035207 Unclassified 1007
124 Ga0395899_0156747 3300037312 Bacteria 1611
125 Ga0395900_0407781 3300037418 Bacteria 1322
126 Ga0395898_0191430 3300037466 Bacteria 1954
127 Ga0395898_0431034 3300037466 Bacteria 1256
128 Ga0395905_0290276 3300037471 Bacteria 1522
129 Ga0395901_0083727 3300038443 Bacteria 3334
130 Ga0395901_0143758 3300038443 Bacteria 2507
131 Ga0395901_0661212 3300038443 Bacteria 1047
132 Ga0242420_101225 3300038996 Bacteria 613
133 Ga0436363_0592638 3300039450 Unclassified 511
134 Ga0451800_0488302 3300041459 Bacteria 750
135 Ga0451800_1054359 3300041459 Bacteria 593
136 Ga0439446_0209415 3300042156 Unclassified 661
137 Ga0451577_0522689 3300042876 Unclassified 1078
138 Ga0453683_0469823 3300044673 Unclassified 815
139 Ga0453684_0749049 3300044712 Bacteria 1058
140 Ga0466960_0770569 3300044901 Bacteria 581
141 Ga0451576_0034156 3300045051 Bacteria 5401
142 Ga0451576_0039677 3300045051 Bacteria 4984
143 Ga0451576_0734008 3300045051 Bacteria 1037
144 Ga0466967_1677105 3300045976 Bacteria 633
145 Ga0495641_0246845 3300046461 Unclassified 802
146 Ga0495582_0054851 3300046473 Bacteria 2197
147 Ga0495640_0316769 3300046533 Bacteria 967
148 Ga0495645_0000088 3300046543 Bacteria 63785
149 Ga0495645_0003582 3300046543 Bacteria 10524
150 Ga0495634_0056571 3300046642 Bacteria 2620
151 Ga0495611_0488050 3300046648 Bacteria 560
152 Ga0495657_0727018 3300046675 Bacteria 570
153 Ga0495613_0012725 3300046689 Bacteria 6257
154 Ga0495600_0801604 3300046809 Bacteria 561
155 Ga0495636_0010739 3300047318 Bacteria 3621
156 Ga0495680_0143519 3300047322 Bacteria 1745
157 Ga0495684_0616721 3300047471 Bacteria 730
158 Ga0495593_0558911 3300047673 Bacteria 574
159 Ga0496102_0034404 3300048905 Bacteria 4557
160 Ga0496102_0038865 3300048905 Unclassified 4298
161 Ga0496104_0012587 3300048907 Bacteria 7613
162 Ga0496105_0087717 3300048908 Unclassified 2571
163 Ga0496105_0501396 3300048908 Bacteria 953
164 Ga0496108_0010025 3300048911 Bacteria 7682
165 Ga0496109_0002737 3300048912 Bacteria 14780
166 Ga0496110_0014312 3300048913 Bacteria 6583
167 Ga0496111_0002703 3300048914 Bacteria 10770
168 Ga0496112_0007893 3300048915 Bacteria 9482
169 Ga0496112_0281326 3300048915 Bacteria 1611
170 Ga0496112_0404886 3300048915 Bacteria 1304
171 Ga0496113_0000284 3300048916 Bacteria 23973
172 Ga0496114_0093260 3300048917 Bacteria 2560
173 Ga0496115_0098488 3300048918 Bacteria 2395
174 Ga0501034_0017680 3300049571 Bacteria 7311
175 Ga0501233_235481 3300049668 Unclassified 546
176 Ga0501257_201132 3300049686 Unclassified 573
177 Ga0501081_1488461 3300049743 Unclassified 514
178 nmdc:mga05p37_2040867_c1 3300050507 Unclassified 540
179 nmdc:mga0n895_117701_c1 3300050512 Unclassified 2677
180 nmdc:mga0n895_1989708_c1 3300050512 Unclassified 539
181 nmdc:mga0n895_604063_c1 3300050512 Bacteria 1099
182 nmdc:mga0n895_640350_c1 3300050512 Bacteria 1063
183 nmdc:mga0rr50_134346_c1 3300050513 Bacteria 1984
184 nmdc:mga0rr50_1481216_c1 3300050513 Unclassified 574
185 nmdc:mga0rr50_769502_c1 3300050513 Bacteria 822
186 nmdc:mga0rr50_929617_c1 3300050513 Bacteria 741
187 nmdc:mga08x19_992066_c1 3300050514 Bacteria 597
188 nmdc:mga0a205_236031_c1 3300050515 Unclassified 1710
189 nmdc:mga0a205_587460_c1 3300050515 Unclassified 967
190 Ga0495619_0876398 3300053085 Unclassified 605
191 Ga0590071_012553 3300059421 Unclassified 1984
192 Ga0590074_002834 3300059423 Bacteria 2854
193 Ga0590075_097883 3300059424 Unclassified 763
194 Ga0068864_100066720
195 Ga0070690_100270037
196 Ga0068869_100079452
197 Ga0068868_100374319
198 Ga0070660_100018627
199 Ga0070689_102057629
200 Ga0070687_100423661
201 Ga0070692_10300813
202 Ga0070669_100997817
203 Ga0070675_100251724
204 Ga0070671_102029133
205 Ga0070673_101268671
206 Ga0070688_101602444
207 Ga0070713_100507076
208 Ga0070708_100600383
209 Ga0070662_100534610
210 Ga0070681_10534869
211 Ga0070707_100456014
212 Ga0070707_100577357
213 Ga0070698_100701596
214 Ga0070699_100001899
215 Ga0070699_100254744
216 Ga0070684_100173660
217 Ga0070697_100008005
218 Ga0070697_100954338
219 Ga0070686_100114976
220 Ga0070686_100293124
221 Ga0070695_100029924
222 Ga0070695_101575424
223 Ga0070696_100000839
224 Ga0070704_100269373
225 Ga0070704_100549875
226 Ga0070704_101063681
227 Ga0070704_101756493
228 Ga0068857_100406770
229 Ga0068857_101209135
230 Ga0068854_100613303
231 Ga0068852_100048803
232 Ga0068859_100003072
233 Ga0068864_101932983
234 Ga0068866_11025607
235 Ga0068861_100045725
236 Ga0068870_10263718
237 Ga0068863_100321608
238 Ga0068860_101498984
239 Ga0068860_102235087
240 Ga0068862_100000645
241 Ga0068862_100294629
242 Ga0068862_100827131
243 Ga0081455_10020975
244 Ga0081455_10082678
245 Ga0081455_10094978
246 Ga0081539_10119370
247 Ga0070715_10535985
248 Ga0070716_100005181
249 Ga0075428_101040513
250 Ga0075428_102164673
251 Ga0075433_10155029
252 Ga0075434_100622306
253 Ga0068865_101703891
254 Ga0097620_100003072
255 Ga0075435_100197025
256 Ga0075435_100257105
257 Ga0075435_100632921
258 Ga0075435_101266727
259 Ga0099794_10342941
260 Ga0105240_10011817
261 Ga0105245_11353734
262 Ga0105247_11038969
263 Ga0105249_10122523
264 Ga0105249_10491833
265 Ga0157370_10015738
266 Ga0157369_10017467
267 Ga0163162_10772677
268 Ga0157372_12326863
269 Ga0157375_10045342
270 Ga0157375_12892611
271 Ga0163163_10248281
272 Ga0157380_10636587
273 Ga0157377_10964207
274 Ga0157379_11530256
275 Ga0207710_10463123
276 Ga0207685_10231325
277 Ga0207643_10252185
278 Ga0207695_10051042
279 Ga0207662_10007786
280 Ga0207646_11212428
281 Ga0207681_10017799
282 Ga0207700_10483943
283 Ga0207670_10050978
284 Ga0207665_10005734
285 Ga0207665_11122893
286 Ga0207689_10033025
287 Ga0207667_10205712
288 Ga0207651_10906735
289 Ga0207712_10140888
290 Ga0207712_10528126
291 Ga0207640_10555734
292 Ga0207708_10740982
293 Ga0207641_10020884
294 Ga0207676_10053290
295 Ga0207676_10544392
296 Ga0207674_12026747
297 Ga0207675_100049133
298 Ga0209969_1015965
299 Ga0209981_1038713
300 Ga0210000_1004032
301 Ga0209999_1022000
302 Ga0207428_11099903
303 Ga0268265_10000893
304 Ga0268265_10942695
305 Ga0268264_12515765
306 Ga0265327_10004083
307 Ga0307408_100183535
308 Ga0307413_10031892
309 Ga0307410_10228285
310 Ga0307407_10021616
311 Ga0307409_100321221
312 Ga0307416_100835112
313 Ga0307411_10193086
314 Ga0373944_0310403
315 Ga0373923_0637782
316 Ga0373942_0072716
317 Ga0395899_0156747
318 Ga0395900_0407781
319 Ga0395898_0191430
320 Ga0395898_0431034
321 Ga0395905_0290276
322 Ga0395901_0083727
323 Ga0395901_0143758
324 Ga0395901_0661212
325 Ga0242420_101225
326 Ga0436363_0592638
327 Ga0451800_0488302
328 Ga0451800_1054359
329 Ga0439446_0209415
330 Ga0451577_0522689
331 Ga0453683_0469823
332 Ga0453684_0749049
333 Ga0466960_0770569
334 Ga0451576_0034156
335 Ga0451576_0039677
336 Ga0451576_0734008
337 Ga0466967_1677105
338 Ga0495641_0246845
339 Ga0495582_0054851
340 Ga0495640_0316769
341 Ga0495645_0000088
342 Ga0495645_0003582
343 Ga0495634_0056571
344 Ga0495611_0488050
345 Ga0495657_0727018
346 Ga0495613_0012725
347 Ga0495600_0801604
348 Ga0495636_0010739
349 Ga0495680_0143519
350 Ga0495684_0616721
351 Ga0495593_0558911
352 Ga0496102_0034404
353 Ga0496102_0038865
354 Ga0496104_0012587
355 Ga0496105_0087717
356 Ga0496105_0501396
357 Ga0496108_0010025
358 Ga0496109_0002737
359 Ga0496110_0014312
360 Ga0496111_0002703
361 Ga0496112_0007893
362 Ga0496112_0281326
363 Ga0496112_0404886
364 Ga0496113_0000284
365 Ga0496114_0093260
366 Ga0496115_0098488
367 Ga0501034_0017680
368 Ga0501233_235481
369 Ga0501257_201132
370 Ga0501081_1488461
371 nmdc:mga05p37_2040867_c1
372 nmdc:mga0n895_117701_c1
373 nmdc:mga0n895_1989708_c1
374 nmdc:mga0n895_604063_c1
375 nmdc:mga0n895_640350_c1
376 nmdc:mga0rr50_134346_c1
377 nmdc:mga0rr50_1481216_c1
378 nmdc:mga0rr50_769502_c1
379 nmdc:mga0rr50_929617_c1
380 nmdc:mga08x19_992066_c1
381 nmdc:mga0a205_236031_c1
382 nmdc:mga0a205_587460_c1
383 Ga0495619_0876398
384 Ga0590071_012553
385 Ga0590074_002834
386 Ga0590075_097883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

38

128

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.7506 48 102
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.6974 6 102
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6923 8 100
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.68 7 109
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.664 6 102
ID Description Score Start End Superfamily
af_Q6F368_80_453_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8548 20 43 3.40.50.150
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6831 8 97 3.90.1150.30
2od0B00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,;YgaC/TfoX-N like chaperone 0.6806 4 102 3.30.1460.30
af_A0A1D6QHE2_22_477_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6717 7 43 3.40.50.150
af_A0A0P0XYX6_33_480_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6708 6 43 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7Y5LAA1-F1-model_v4 TfoX/Sxy family protein 0.9796 1 110
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9768 3 110
AF-A0A257XHX5-F1-model_v4 RNA methyltransferase 0.9762 1 108 GO:0008168
GO:0032259
AF-A0A225DQH9-F1-model_v4 TfoX N-terminal domain-containing protein 0.9743 1 110
AF-A0A848L2Z5-F1-model_v4 TfoX/Sxy family protein 0.9734 1 110

Map