F296844

General Info

Members Datasets Scaffolds Average Seq Length
193 104 193 169

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100018958|Ga0070706_1000189587
Length 191
Sequence VRNRRGPGADRAAPATTSYDRAVSHVGDAVARASAYLTEHPDEARYRDSAAVARLGQNLHVEIAGPGGEAIATDMPRGIGGEAAVPSPGWLFRAAAAACVASLIGIRAATLGMELEPGAVEVTVDSESDDRGILGLDDGIPAGALSMKVVVTFDGPPTGHEARTALARWALDHCPVTDTAARPVPIELEVA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
74 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.7
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10142610 3300003322 Unclassified 1765
2 Ga0068869_100487571 3300005334 Bacteria 1027
3 Ga0070680_100000008 3300005336 Bacteria 100309
4 Ga0070680_100075283 3300005336 Bacteria 2779
5 Ga0070687_100016908 3300005343 Bacteria 3341
6 Ga0070687_100299943 3300005343 Bacteria 1019
7 Ga0070703_10108427 3300005406 Bacteria 990
8 Ga0070703_10207635 3300005406 Bacteria 772
9 Ga0070705_100034967 3300005440 Unclassified 2813
10 Ga0070705_100041402 3300005440 Bacteria 2626
11 Ga0070700_100193122 3300005441 Bacteria 1425
12 Ga0070700_101227500 3300005441 Bacteria 627
13 Ga0070694_100023056 3300005444 Bacteria 3997
14 Ga0070694_100092384 3300005444 Bacteria 2126
15 Ga0070708_100009478 3300005445 Bacteria 7848
16 Ga0070708_100011906 3300005445 Bacteria 7084
17 Ga0070708_100037535 3300005445 Bacteria 4228
18 Ga0070708_100498801 3300005445 Bacteria 1148
19 Ga0070681_10309955 3300005458 Bacteria 1488
20 Ga0070706_100018958 3300005467 Bacteria 6347
21 Ga0070706_100150583 3300005467 Bacteria 2172
22 Ga0070706_100223952 3300005467 Bacteria 1756
23 Ga0070706_100241440 3300005467 Bacteria 1687
24 Ga0070706_100314816 3300005467 Bacteria 1460
25 Ga0070706_100589048 3300005467 Bacteria 1034
26 Ga0070706_100598197 3300005467 Bacteria 1025
27 Ga0070707_100023260 3300005468 Bacteria 5862
28 Ga0070707_100143332 3300005468 Bacteria 2325
29 Ga0070707_100307088 3300005468 Bacteria 1542
30 Ga0070698_100000135 3300005471 Bacteria 65274
31 Ga0070698_100001647 3300005471 Bacteria 24897
32 Ga0070698_100102389 3300005471 Bacteria 2834
33 Ga0070698_100262955 3300005471 Bacteria 1657
34 Ga0070698_100724463 3300005471 Bacteria 937
35 Ga0070699_100015473 3300005518 Bacteria 6556
36 Ga0070699_100204437 3300005518 Unclassified 1757
37 Ga0070697_100004086 3300005536 Bacteria 11189
38 Ga0070697_100091711 3300005536 Unclassified 2513
39 Ga0070697_100185061 3300005536 Bacteria 1766
40 Ga0070697_100187065 3300005536 Bacteria 1757
41 Ga0070686_100124014 3300005544 Bacteria 1777
42 Ga0070686_100168809 3300005544 Bacteria 1546
43 Ga0070695_100002994 3300005545 Bacteria 9846
44 Ga0070695_100055535 3300005545 Bacteria 2553
45 Ga0070695_100187520 3300005545 Bacteria 1470
46 Ga0070696_100008235 3300005546 Bacteria 6977
47 Ga0070696_100014924 3300005546 Bacteria 5217
48 Ga0070696_100777678 3300005546 Unclassified 786
49 Ga0070704_100127114 3300005549 Unclassified 1969
50 Ga0070704_100261962 3300005549 Bacteria 1425
51 Ga0070704_100396502 3300005549 Bacteria 1177
52 Ga0070704_100891864 3300005549 Bacteria 799
53 Ga0068855_100280158 3300005563 Bacteria 1852
54 Ga0068864_100076792 3300005618 Bacteria 2920
55 Ga0068858_100616527 3300005842 Bacteria 1053
56 Ga0068860_100036756 3300005843 Bacteria 4690
57 Ga0068860_100656051 3300005843 Bacteria 1057
58 Ga0068860_100808855 3300005843 Bacteria 951
59 Ga0068860_101233566 3300005843 Bacteria 768
60 Ga0070717_10111733 3300006028 Bacteria 2332
61 Ga0068871_101318081 3300006358 Bacteria 679
62 Ga0075428_100001696 3300006844 Bacteria 23508
63 Ga0075433_10069317 3300006852 Bacteria 3097
64 Ga0075433_11429238 3300006852 Unclassified 598
65 Ga0075434_100190529 3300006871 Bacteria 2071
66 Ga0075434_100594369 3300006871 Unclassified 1126
67 Ga0075434_100660415 3300006871 Unclassified 1064
68 Ga0075436_100770316 3300006914 Unclassified 715
69 Ga0075435_100065559 3300007076 Bacteria 2953
70 Ga0075435_100196869 3300007076 Bacteria 1707
71 Ga0075435_100985991 3300007076 Unclassified 736
72 Ga0075435_101117404 3300007076 Bacteria 689
73 Ga0111539_11270604 3300009094 Bacteria 854
74 Ga0105245_10018524 3300009098 Bacteria 6089
75 Ga0105245_11754244 3300009098 Bacteria 673
76 Ga0114129_10008672 3300009147 Bacteria 14490
77 Ga0114129_11344180 3300009147 Unclassified 884
78 Ga0105243_12006446 3300009148 Bacteria 613
79 Ga0105242_10513480 3300009176 Bacteria 1142
80 Ga0099796_10235752 3300010159 Bacteria 755
81 Ga0105239_10189183 3300010375 Bacteria 2304
82 Ga0105239_11333589 3300010375 Unclassified 828
83 Ga0105246_10010853 3300011119 Bacteria 5648
84 Ga0157378_10094974 3300013297 Unclassified 2715
85 Ga0157378_10115005 3300013297 Bacteria 2472
86 Ga0163162_11678262 3300013306 Bacteria 725
87 Ga0163163_10086143 3300014325 Bacteria 3150
88 Ga0163163_10259673 3300014325 Unclassified 1788
89 Ga0157380_10506727 3300014326 Bacteria 1174
90 Ga0182008_10263315 3300014497 Bacteria 892
91 Ga0182008_10403218 3300014497 Bacteria 735
92 Ga0157379_10174324 3300014968 Bacteria 1941
93 Ga0207653_10044860 3300025885 Bacteria 1459
94 Ga0207653_10131428 3300025885 Bacteria 909
95 Ga0207645_10115416 3300025907 Bacteria 1741
96 Ga0207684_10040296 3300025910 Bacteria 3961
97 Ga0207684_10130372 3300025910 Bacteria 2158
98 Ga0207684_10178318 3300025910 Bacteria 1832
99 Ga0207684_10543533 3300025910 Bacteria 994
100 Ga0207660_10000001 3300025917 Bacteria 1034169
101 Ga0207660_10109081 3300025917 Unclassified 2080
102 Ga0207662_10014163 3300025918 Bacteria 4468
103 Ga0207662_10039601 3300025918 Bacteria 2766
104 Ga0207662_10214565 3300025918 Bacteria 1251
105 Ga0207646_10016769 3300025922 Bacteria 6871
106 Ga0207646_10031757 3300025922 Bacteria 4780
107 Ga0207646_10061195 3300025922 Bacteria 3361
108 Ga0207646_10068242 3300025922 Unclassified 3176
109 Ga0207646_10183934 3300025922 Unclassified 1887
110 Ga0207646_10206549 3300025922 Bacteria 1774
111 Ga0207646_10336717 3300025922 Bacteria 1363
112 Ga0207650_10154712 3300025925 Bacteria 1812
113 Ga0207687_10114830 3300025927 Unclassified 2005
114 Ga0207690_10419371 3300025932 Bacteria 1070
115 Ga0207706_10358583 3300025933 Bacteria 1267
116 Ga0207669_10013913 3300025937 Bacteria 4016
117 Ga0207667_10204185 3300025949 Bacteria 2027
118 Ga0207703_11075469 3300026035 Bacteria 772
119 Ga0207678_10248448 3300026067 Bacteria 1523
120 Ga0207708_10248549 3300026075 Bacteria 1432
121 Ga0207698_10970361 3300026142 Bacteria 860
122 Ga0209999_1034940 3300027543 Bacteria 936
123 Ga0209971_1028442 3300027682 Bacteria 1338
124 Ga0209998_10000873 3300027717 Bacteria 7744
125 Ga0209974_10032410 3300027876 Bacteria 1732
126 Ga0268265_10885097 3300028380 Bacteria 876
127 Ga0268264_10202343 3300028381 Bacteria 1817
128 Ga0268264_10827060 3300028381 Viruses 926
129 Ga0268264_11743471 3300028381 Bacteria 633
130 Ga0307410_10327919 3300031852 Bacteria 1217
131 Ga0307412_10438814 3300031911 Bacteria 1073
132 Ga0307409_100356173 3300031995 Bacteria 1383
133 Ga0307409_100602612 3300031995 Bacteria 1086
134 Ga0307411_10441853 3300032005 Bacteria 1086
135 Ga0307411_11530475 3300032005 Bacteria 614
136 Ga0307415_100259634 3300032126 Bacteria 1417
137 Ga0395901_0441092 3300038443 Bacteria 1333
138 Ga0439438_087471 3300041405 Bacteria 761
139 Ga0439441_088395 3300042001 Bacteria 683
140 Ga0439458_0167672 3300042157 Bacteria 593
141 Ga0496102_0619500 3300048905 Bacteria 1005
142 Ga0496102_0856021 3300048905 Bacteria 831
143 Ga0496103_0040931 3300048906 Bacteria 2848
144 Ga0496106_0228042 3300048909 Bacteria 1487
145 Ga0496106_0828503 3300048909 Bacteria 733
146 Ga0496107_0183266 3300048910 Bacteria 1555
147 Ga0496109_1318736 3300048912 Bacteria 658
148 Ga0496112_0000010 3300048915 Bacteria 245046
149 Ga0496112_0103426 3300048915 Bacteria 2818
150 Ga0496112_0267035 3300048915 Bacteria 1660
151 Ga0496113_0498213 3300048916 Bacteria 978
152 Ga0501038_0497199 3300049574 Bacteria 933
153 Ga0501038_1065665 3300049574 Archaea 591
154 Ga0501039_0476612 3300049575 Bacteria 980
155 Ga0501040_0290962 3300049576 Bacteria 1167
156 Ga0501041_0221902 3300049577 Bacteria 1186
157 Ga0501067_0032140 3300049583 Bacteria 2913
158 Ga0501067_0289227 3300049583 Unclassified 912
159 Ga0501068_0117305 3300049584 Unclassified 1658
160 Ga0501068_0136055 3300049584 Bacteria 1539
161 Ga0501069_0115192 3300049585 Bacteria 1533
162 Ga0501069_0412876 3300049585 Unclassified 800
163 Ga0501070_0061356 3300049586 Bacteria 3115
164 Ga0501070_0289073 3300049586 Bacteria 1336
165 Ga0501070_0987617 3300049586 Bacteria 653
166 Ga0501072_0109527 3300049588 Bacteria 2198
167 Ga0501074_0715882 3300049590 Unclassified 706
168 Ga0501075_0263883 3300049591 Bacteria 1313
169 Ga0501076_0103124 3300049592 Bacteria 2301
170 Ga0501076_0721791 3300049592 Archaea 823
171 Ga0501077_0088313 3300049593 Bacteria 1965
172 Ga0501079_0122855 3300049741 Bacteria 2019
173 Ga0501079_0701027 3300049741 Bacteria 797
174 Ga0501079_0805859 3300049741 Archaea 739
175 Ga0501083_0212948 3300049744 Bacteria 1260
176 nmdc:mga05p37_1199957_c1 3300050507 Bacteria 784
177 nmdc:mga05p37_16196_c1 3300050507 Bacteria 8976
178 nmdc:mga0n895_135566_c1 3300050512 Bacteria 2488
179 nmdc:mga0n895_340093_c1 3300050512 Bacteria 1520
180 nmdc:mga0n895_458755_c1 3300050512 Bacteria 1286
181 nmdc:mga0n895_54916_c1 3300050512 Bacteria 3919
182 nmdc:mga0n895_609467_c1 3300050512 Bacteria 1093
183 nmdc:mga0rr50_107722_c1 3300050513 Bacteria 2200
184 nmdc:mga0rr50_109994_c1 3300050513 Bacteria 2179
185 nmdc:mga0rr50_318034_c1 3300050513 Bacteria 1304
186 nmdc:mga0a205_10444_c1 3300050515 Bacteria 8529
187 nmdc:mga0a205_402359_c1 3300050515 Bacteria 1233
188 nmdc:mga0a205_801390_c1 3300050515 Unclassified 790
189 Ga0501084_0007116 3300054114 Bacteria 9221
190 Ga0501082_0614112 3300060353 Bacteria 951
191 Ga0501082_1104473 3300060353 Unclassified 693
192 Ga0530510_0408210 3300061734 Bacteria 1024
193 Ga0530510_1018236 3300061734 Unclassified 634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0007116 Ga0501084_0007116_4010_4459 141
2 3300005406 Ga0070703_10108427 Ga0070703_101084272 144
3 3300050515 nmdc:mga0a205_10444_c1 nmdc:mga0a205_10444_c1_2470_2973 149
4 3300013297 Ga0157378_10094974 Ga0157378_100949743 152
5 3300049574 Ga0501038_0497199 Ga0501038_0497199_414_914 158
6 3300048915 Ga0496112_0103426 Ga0496112_0103426_1046_1546 159
7 3300048916 Ga0496113_0498213 Ga0496113_0498213_292_792 159
8 3300006358 Ga0068871_101318081 Ga0068871_1013180811 162
9 3300048905 Ga0496102_0856021 Ga0496102_0856021_32_547 162
10 3300005336 Ga0070680_100075283 Ga0070680_1000752832 164
11 3300005343 Ga0070687_100299943 Ga0070687_1002999431 164
12 3300005406 Ga0070703_10207635 Ga0070703_102076351 164
13 3300005440 Ga0070705_100034967 Ga0070705_1000349672 164
14 3300005444 Ga0070694_100023056 Ga0070694_1000230564 164
15 3300005444 Ga0070694_100092384 Ga0070694_1000923843 164
16 3300005445 Ga0070708_100011906 Ga0070708_1000119064 164
17 3300005445 Ga0070708_100037535 Ga0070708_1000375354 164
18 3300005445 Ga0070708_100498801 Ga0070708_1004988012 164
19 3300005458 Ga0070681_10309955 Ga0070681_103099552 164
20 3300005467 Ga0070706_100150583 Ga0070706_1001505833 164
21 3300005467 Ga0070706_100241440 Ga0070706_1002414402 164
22 3300005468 Ga0070707_100023260 Ga0070707_1000232603 164
23 3300005468 Ga0070707_100307088 Ga0070707_1003070881 164
24 3300005471 Ga0070698_100724463 Ga0070698_1007244632 164
25 3300005536 Ga0070697_100004086 Ga0070697_1000040867 164
26 3300005536 Ga0070697_100185061 Ga0070697_1001850614 164
27 3300005544 Ga0070686_100168809 Ga0070686_1001688092 164
28 3300005545 Ga0070695_100002994 Ga0070695_10000299410 164
29 3300005545 Ga0070695_100055535 Ga0070695_1000555353 164
30 3300005546 Ga0070696_100008235 Ga0070696_1000082356 164
31 3300005546 Ga0070696_100014924 Ga0070696_1000149246 164
32 3300005546 Ga0070696_100777678 Ga0070696_1007776781 164
33 3300005549 Ga0070704_100127114 Ga0070704_1001271143 164
34 3300005549 Ga0070704_100261962 Ga0070704_1002619622 164
35 3300005549 Ga0070704_100891864 Ga0070704_1008918642 164
36 3300005563 Ga0068855_100280158 Ga0068855_1002801582 164
37 3300005618 Ga0068864_100076792 Ga0068864_1000767925 164
38 3300005842 Ga0068858_100616527 Ga0068858_1006165272 164
39 3300005843 Ga0068860_100036756 Ga0068860_1000367564 164
40 3300005843 Ga0068860_100656051 Ga0068860_1006560512 164
41 3300005843 Ga0068860_100808855 Ga0068860_1008088552 164
42 3300005843 Ga0068860_101233566 Ga0068860_1012335661 164
43 3300006871 Ga0075434_100190529 Ga0075434_1001905291 164
44 3300006914 Ga0075436_100770316 Ga0075436_1007703161 164
45 3300007076 Ga0075435_100985991 Ga0075435_1009859912 164
46 3300007076 Ga0075435_101117404 Ga0075435_1011174042 164
47 3300010375 Ga0105239_11333589 Ga0105239_113335892 164
48 3300013306 Ga0163162_11678262 Ga0163162_116782621 164
49 3300014325 Ga0163163_10086143 Ga0163163_100861433 164
50 3300014325 Ga0163163_10259673 Ga0163163_102596733 164
51 3300014497 Ga0182008_10263315 Ga0182008_102633151 164
52 3300014968 Ga0157379_10174324 Ga0157379_101743242 164
53 3300025885 Ga0207653_10044860 Ga0207653_100448601 164
54 3300025885 Ga0207653_10131428 Ga0207653_101314282 164
55 3300025910 Ga0207684_10130372 Ga0207684_101303723 164
56 3300025910 Ga0207684_10178318 Ga0207684_101783182 164
57 3300025917 Ga0207660_10109081 Ga0207660_101090813 164
58 3300025918 Ga0207662_10214565 Ga0207662_102145652 164
59 3300025922 Ga0207646_10061195 Ga0207646_100611954 164
60 3300025922 Ga0207646_10183934 Ga0207646_101839342 164
61 3300025932 Ga0207690_10419371 Ga0207690_104193712 164
62 3300025949 Ga0207667_10204185 Ga0207667_102041853 164
63 3300026035 Ga0207703_11075469 Ga0207703_110754691 164
64 3300026142 Ga0207698_10970361 Ga0207698_109703612 164
65 3300028380 Ga0268265_10885097 Ga0268265_108850972 164
66 3300028381 Ga0268264_10202343 Ga0268264_102023432 164
67 3300028381 Ga0268264_10827060 Ga0268264_108270602 164
68 3300028381 Ga0268264_11743471 Ga0268264_117434711 164
69 3300038443 Ga0395901_0441092 Ga0395901_0441092_49_555 164
70 3300042001 Ga0439441_088395 Ga0439441_088395_65_574 164
71 3300048906 Ga0496103_0040931 Ga0496103_0040931_589_1092 164
72 3300049583 Ga0501067_0289227 Ga0501067_0289227_184_678 164
73 3300049584 Ga0501068_0117305 Ga0501068_0117305_428_931 164
74 3300049585 Ga0501069_0115192 Ga0501069_0115192_289_783 164
75 3300049586 Ga0501070_0987617 Ga0501070_0987617_131_625 164
76 3300050512 nmdc:mga0n895_340093_c1 nmdc:mga0n895_340093_c1_150_650 164
77 3300050512 nmdc:mga0n895_609467_c1 nmdc:mga0n895_609467_c1_323_823 164
78 3300050513 nmdc:mga0rr50_318034_c1 nmdc:mga0rr50_318034_c1_544_1044 164
79 3300050515 nmdc:mga0a205_402359_c1 nmdc:mga0a205_402359_c1_474_977 164
80 3300005334 Ga0068869_100487571 Ga0068869_1004875711 165
81 3300005336 Ga0070680_100000008 Ga0070680_10000000893 165
82 3300005343 Ga0070687_100016908 Ga0070687_1000169084 165
83 3300005440 Ga0070705_100041402 Ga0070705_1000414024 165
84 3300005441 Ga0070700_100193122 Ga0070700_1001931222 165
85 3300005441 Ga0070700_101227500 Ga0070700_1012275001 165
86 3300005445 Ga0070708_100009478 Ga0070708_1000094786 165
87 3300005467 Ga0070706_100223952 Ga0070706_1002239523 165
88 3300005471 Ga0070698_100001647 Ga0070698_1000016475 165
89 3300005471 Ga0070698_100262955 Ga0070698_1002629552 165
90 3300005518 Ga0070699_100015473 Ga0070699_1000154734 165
91 3300005536 Ga0070697_100091711 Ga0070697_1000917113 165
92 3300005544 Ga0070686_100124014 Ga0070686_1001240143 165
93 3300005545 Ga0070695_100187520 Ga0070695_1001875203 165
94 3300005549 Ga0070704_100396502 Ga0070704_1003965022 165
95 3300006852 Ga0075433_10069317 Ga0075433_100693174 165
96 3300006871 Ga0075434_100594369 Ga0075434_1005943692 165
97 3300006871 Ga0075434_100660415 Ga0075434_1006604151 165
98 3300007076 Ga0075435_100065559 Ga0075435_1000655594 165
99 3300009098 Ga0105245_10018524 Ga0105245_100185246 165
100 3300009098 Ga0105245_11754244 Ga0105245_117542441 165
101 3300009176 Ga0105242_10513480 Ga0105242_105134803 165
102 3300010375 Ga0105239_10189183 Ga0105239_101891831 165
103 3300011119 Ga0105246_10010853 Ga0105246_100108533 165
104 3300013297 Ga0157378_10115005 Ga0157378_101150054 165
105 3300014497 Ga0182008_10403218 Ga0182008_104032181 165
106 3300025907 Ga0207645_10115416 Ga0207645_101154163 165
107 3300025917 Ga0207660_10000001 Ga0207660_10000001123 165
108 3300025918 Ga0207662_10039601 Ga0207662_100396014 165
109 3300025922 Ga0207646_10016769 Ga0207646_100167696 165
110 3300025922 Ga0207646_10068242 Ga0207646_100682424 165
111 3300025922 Ga0207646_10336717 Ga0207646_103367172 165
112 3300025927 Ga0207687_10114830 Ga0207687_101148302 165
113 3300025933 Ga0207706_10358583 Ga0207706_103585832 165
114 3300026067 Ga0207678_10248448 Ga0207678_102484481 165
115 3300026075 Ga0207708_10248549 Ga0207708_102485494 165
116 3300042157 Ga0439458_0167672 Ga0439458_0167672_61_570 165
117 3300048905 Ga0496102_0619500 Ga0496102_0619500_232_741 165
118 3300048909 Ga0496106_0228042 Ga0496106_0228042_188_697 165
119 3300048910 Ga0496107_0183266 Ga0496107_0183266_152_661 165
120 3300048912 Ga0496109_1318736 Ga0496109_1318736_11_520 165
121 3300048915 Ga0496112_0267035 Ga0496112_0267035_584_1093 165
122 3300049574 Ga0501038_1065665 Ga0501038_1065665_59_568 165
123 3300049590 Ga0501074_0715882 Ga0501074_0715882_130_639 165
124 3300049592 Ga0501076_0721791 Ga0501076_0721791_303_812 165
125 3300049741 Ga0501079_0805859 Ga0501079_0805859_32_541 165
126 3300050507 nmdc:mga05p37_1199957_c1 nmdc:mga05p37_1199957_c1_99_608 165
127 3300050512 nmdc:mga0n895_135566_c1 nmdc:mga0n895_135566_c1_1438_1947 165
128 3300050512 nmdc:mga0n895_458755_c1 nmdc:mga0n895_458755_c1_545_1060 165
129 3300050512 nmdc:mga0n895_54916_c1 nmdc:mga0n895_54916_c1_1875_2384 165
130 3300050513 nmdc:mga0rr50_109994_c1 nmdc:mga0rr50_109994_c1_1567_2076 165
131 3300050515 nmdc:mga0a205_801390_c1 nmdc:mga0a205_801390_c1_217_726 165
132 3300061734 Ga0530510_1018236 Ga0530510_1018236_70_579 165
133 3300005467 Ga0070706_100589048 Ga0070706_1005890481 166
134 3300005468 Ga0070707_100143332 Ga0070707_1001433322 166
135 3300007076 Ga0075435_100196869 Ga0075435_1001968692 166
136 3300009094 Ga0111539_11270604 Ga0111539_112706042 166
137 3300009148 Ga0105243_12006446 Ga0105243_120064461 166
138 3300014326 Ga0157380_10506727 Ga0157380_105067273 166
139 3300025910 Ga0207684_10543533 Ga0207684_105435332 166
140 3300025918 Ga0207662_10014163 Ga0207662_100141634 166
141 3300025922 Ga0207646_10031757 Ga0207646_100317574 166
142 3300025925 Ga0207650_10154712 Ga0207650_101547122 166
143 3300025937 Ga0207669_10013913 Ga0207669_100139133 166
144 3300031852 Ga0307410_10327919 Ga0307410_103279192 166
145 3300031911 Ga0307412_10438814 Ga0307412_104388142 166
146 3300031995 Ga0307409_100356173 Ga0307409_1003561731 166
147 3300031995 Ga0307409_100602612 Ga0307409_1006026122 166
148 3300032005 Ga0307411_10441853 Ga0307411_104418532 166
149 3300032005 Ga0307411_11530475 Ga0307411_115304751 166
150 3300032126 Ga0307415_100259634 Ga0307415_1002596342 166
151 3300041405 Ga0439438_087471 Ga0439438_087471_139_651 166
152 3300048909 Ga0496106_0828503 Ga0496106_0828503_146_652 166
153 3300049575 Ga0501039_0476612 Ga0501039_0476612_380_904 166
154 3300049576 Ga0501040_0290962 Ga0501040_0290962_444_968 166
155 3300049577 Ga0501041_0221902 Ga0501041_0221902_301_825 166
156 3300049583 Ga0501067_0032140 Ga0501067_0032140_588_1100 166
157 3300049584 Ga0501068_0136055 Ga0501068_0136055_1001_1513 166
158 3300049586 Ga0501070_0061356 Ga0501070_0061356_1711_2223 166
159 3300049586 Ga0501070_0289073 Ga0501070_0289073_738_1262 166
160 3300049588 Ga0501072_0109527 Ga0501072_0109527_149_673 166
161 3300049591 Ga0501075_0263883 Ga0501075_0263883_148_672 166
162 3300049592 Ga0501076_0103124 Ga0501076_0103124_426_950 166
163 3300049593 Ga0501077_0088313 Ga0501077_0088313_1385_1909 166
164 3300049741 Ga0501079_0122855 Ga0501079_0122855_1291_1815 166
165 3300049744 Ga0501083_0212948 Ga0501083_0212948_470_994 166
166 3300050513 nmdc:mga0rr50_107722_c1 nmdc:mga0rr50_107722_c1_1080_1598 166
167 3300060353 Ga0501082_0614112 Ga0501082_0614112_19_543 166
168 3300060353 Ga0501082_1104473 Ga0501082_1104473_110_622 166
169 3300061734 Ga0530510_0408210 Ga0530510_0408210_57_569 166
170 3300005467 Ga0070706_100314816 Ga0070706_1003148162 167
171 3300005467 Ga0070706_100598197 Ga0070706_1005981972 167
172 3300005471 Ga0070698_100000135 Ga0070698_10000013520 167
173 3300005471 Ga0070698_100102389 Ga0070698_1001023893 167
174 3300005518 Ga0070699_100204437 Ga0070699_1002044372 167
175 3300006028 Ga0070717_10111733 Ga0070717_101117332 167
176 3300006852 Ga0075433_11429238 Ga0075433_114292381 167
177 3300009147 Ga0114129_11344180 Ga0114129_113441802 167
178 3300010159 Ga0099796_10235752 Ga0099796_102357522 167
179 3300025922 Ga0207646_10206549 Ga0207646_102065491 167
180 3300027543 Ga0209999_1034940 Ga0209999_10349402 167
181 3300027682 Ga0209971_1028442 Ga0209971_10284422 167
182 3300027717 Ga0209998_10000873 Ga0209998_100008738 167
183 3300027876 Ga0209974_10032410 Ga0209974_100324102 167
184 3300048915 Ga0496112_0000010 Ga0496112_0000010_122879_123394 167
185 3300049741 Ga0501079_0701027 Ga0501079_0701027_184_702 167
186 3300003322 rootL2_10142610 rootL2_101426102 168
187 3300005467 Ga0070706_100018958 Ga0070706_1000189587 168
188 3300005536 Ga0070697_100187065 Ga0070697_1001870653 168
189 3300006844 Ga0075428_100001696 Ga0075428_1000016962 168
190 3300009147 Ga0114129_10008672 Ga0114129_1000867211 168
191 3300025910 Ga0207684_10040296 Ga0207684_100402962 168
192 3300049585 Ga0501069_0412876 Ga0501069_0412876_156_695 168
193 3300050507 nmdc:mga05p37_16196_c1 nmdc:mga05p37_16196_c1_7206_7721 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

80

189

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8612 31 168
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8531 26 168
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.8436 8 168
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8423 27 168
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8309 26 168
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8551 68 167 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8491 78 168 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8425 27 168 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8418 68 168 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8357 61 168 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A535ZNZ0-F1-model_v4 OsmC family peroxiredoxin 0.9694 2 133
AF-A0A7D7VH81-F1-model_v4 OsmC family peroxiredoxin 0.9577 1 168
AF-A0A7D7VH81-F1-model_v4 OsmC family peroxiredoxin 0.9522 1 168
AF-A0A661BJT1-F1-model_v4 OsmC family peroxiredoxin 0.9416 1 168
AF-A0A7T9FEM9-F1-model_v4 deleted 0.9393 4 158

Feature Viewer

pLDDT pTM Quality
94.63 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map