F296770

General Info

Members Datasets Scaffolds Average Seq Length
193 139 192 324

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100000033|Ga0070714_10000003350
Length 371
Sequence MPRSISVVMPIYNEEALLGELFERMTRVFDAVEREFALSCEWVLVNDGSRDRSLEMLSDFAASDVRLAVLDLSRNFGHQPAIQAGIEYASGDAVIIMDGDLQDPPELIPELLRSWMEGNRVVVAQRRSRAEQGVKGMLFALFHAMLARMSDLKMETGSGVFGLMDRRAVNDLLQLRERNRFLPGLRTWVGYEQAHVLYDREERAAGKPKQSFSRLVRYGFDAIFSFSFKPLRAIWTLGFIVSFFSFXXALYLILMRILHINVVAGFTTPTVAILLLGGVQLISIGILGEYLGRIYDEVKQRPHYVINKIIRSSEGQRVSSGIGYRMPGLENPVSSSSPVSESVAGSNIQEVANGHSPAPEIRYPLPGPHAD

Samples

Sample ID Description Type Environment
1 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 3.63
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10358974 3300003323 Unclassified 1250
2 Ga0070676_10012409 3300005328 Bacteria 4650
3 Ga0070677_10024144 3300005333 Bacteria 2258
4 Ga0070666_10000010 3300005335 Bacteria 264789
5 Ga0070682_100000036 3300005337 Bacteria 149965
6 Ga0070661_100048498 3300005344 Bacteria 3109
7 Ga0070668_100184964 3300005347 Bacteria 1704
8 Ga0070669_100088889 3300005353 Bacteria 2313
9 Ga0070659_100084511 3300005366 Bacteria 2538
10 Ga0070667_100003158 3300005367 Bacteria 14125
11 Ga0070709_10004859 3300005434 Bacteria 7265
12 Ga0070714_100000033 3300005435 Bacteria 131739
13 Ga0070714_100039591 3300005435 Bacteria 3969
14 Ga0070713_100005613 3300005436 Bacteria 8601
15 Ga0070711_100072760 3300005439 Bacteria 2426
16 Ga0070711_100297990 3300005439 Bacteria 1281
17 Ga0070700_100028608 3300005441 Unclassified 3317
18 Ga0070708_100009469 3300005445 Bacteria 7852
19 Ga0070708_100429670 3300005445 Bacteria 1246
20 Ga0070663_100005896 3300005455 Bacteria 7330
21 Ga0070678_100021232 3300005456 Bacteria 4277
22 Ga0070685_10001168 3300005466 Bacteria 14057
23 Ga0070685_10065089 3300005466 Bacteria 2145
24 Ga0070707_100018464 3300005468 Bacteria 6561
25 Ga0070707_100129987 3300005468 Bacteria 2449
26 Ga0070698_100243075 3300005471 Bacteria 1733
27 Ga0070699_100004848 3300005518 Bacteria 11869
28 Ga0070699_100136052 3300005518 Bacteria 2168
29 Ga0070697_100059858 3300005536 Bacteria 3103
30 Ga0070695_100127730 3300005545 Bacteria 1748
31 Ga0070665_100000124 3300005548 Bacteria 146998
32 Ga0070665_100000339 3300005548 Bacteria 71205
33 Ga0070665_100068331 3300005548 Bacteria 3563
34 Ga0070665_100166945 3300005548 Bacteria 2203
35 Ga0070704_100030279 3300005549 Bacteria 3625
36 Ga0068861_100231597 3300005719 Bacteria 1567
37 Ga0068870_10076843 3300005840 Bacteria 1835
38 Ga0068858_100071322 3300005842 Bacteria 3222
39 Ga0068860_100016117 3300005843 Bacteria 7293
40 Ga0081539_10000388 3300005985 Bacteria 95218
41 Ga0075368_10022086 3300006042 Bacteria 2420
42 Ga0075432_10027452 3300006058 Bacteria 1960
43 Ga0070716_100016890 3300006173 Bacteria 3775
44 Ga0070712_100040357 3300006175 Bacteria 3200
45 Ga0075367_10003284 3300006178 Bacteria 7666
46 Ga0075428_100000995 3300006844 Bacteria 29993
47 Ga0075428_100026039 3300006844 Bacteria 6476
48 Ga0075428_100122520 3300006844 Unclassified 2830
49 Ga0075430_100001021 3300006846 Bacteria 22153
50 Ga0075430_100048685 3300006846 Bacteria 3579
51 Ga0075430_100105513 3300006846 Bacteria 2351
52 Ga0075431_100001337 3300006847 Bacteria 22537
53 Ga0075431_100029771 3300006847 Bacteria 5622
54 Ga0075429_100000273 3300006880 Bacteria 36203
55 Ga0075429_100207804 3300006880 Unclassified 1715
56 Ga0075436_100024709 3300006914 Bacteria 4131
57 Ga0097620_100434876 3300006931 Bacteria 1408
58 Ga0105240_10058374 3300009093 Bacteria 4817
59 Ga0105240_10123883 3300009093 Bacteria 3109
60 Ga0111539_10000201 3300009094 Bacteria 70327
61 Ga0111539_10004205 3300009094 Bacteria 18889
62 Ga0111539_10018658 3300009094 Bacteria 8591
63 Ga0105245_10090944 3300009098 Bacteria 2808
64 Ga0114129_10000751 3300009147 Bacteria 41232
65 Ga0114129_10008941 3300009147 Bacteria 14272
66 Ga0114129_10183547 3300009147 Unclassified 2845
67 Ga0114129_10278879 3300009147 Bacteria 2234
68 Ga0105242_10047883 3300009176 Bacteria 3472
69 Ga0105248_10096735 3300009177 Bacteria 3326
70 Ga0105238_10000013 3300009551 Bacteria 257248
71 Ga0105238_10000044 3300009551 Bacteria 151485
72 Ga0105238_10078496 3300009551 Unclassified 3291
73 Ga0105249_10108105 3300009553 Bacteria 2625
74 Ga0105239_10228933 3300010375 Unclassified 2085
75 Ga0157369_10018029 3300013105 Bacteria 7920
76 Ga0163162_10020821 3300013306 Bacteria 6448
77 Ga0157380_10057455 3300014326 Bacteria 3099
78 Ga0157380_10342245 3300014326 Bacteria 1396
79 Ga0213875_10000099 3300021388 Bacteria 98377
80 Ga0209233_1002400 3300025261 Bacteria 6918
81 Ga0207680_10000002 3300025903 Bacteria 1018646
82 Ga0207699_10030933 3300025906 Bacteria 3001
83 Ga0207684_10132189 3300025910 Bacteria 2142
84 Ga0207684_10229894 3300025910 Bacteria 1600
85 Ga0207695_10016500 3300025913 Bacteria 8634
86 Ga0207695_10053878 3300025913 Bacteria 4204
87 Ga0207695_10142653 3300025913 Bacteria 2342
88 Ga0207671_10054451 3300025914 Unclassified 2964
89 Ga0207693_10180278 3300025915 Bacteria 1662
90 Ga0207663_10114370 3300025916 Bacteria 1837
91 Ga0207662_10033312 3300025918 Bacteria 3002
92 Ga0207646_10024150 3300025922 Bacteria 5572
93 Ga0207646_10069851 3300025922 Bacteria 3137
94 Ga0207694_10000026 3300025924 Bacteria 257192
95 Ga0207694_10003600 3300025924 Bacteria 12276
96 Ga0207687_10198483 3300025927 Unclassified 1566
97 Ga0207700_10000001 3300025928 Bacteria 1122509
98 Ga0207664_10000024 3300025929 Bacteria 199974
99 Ga0207664_10061355 3300025929 Unclassified 3000
100 Ga0207690_10063279 3300025932 Bacteria 2522
101 Ga0207686_10047458 3300025934 Bacteria 2655
102 Ga0207665_10174347 3300025939 Bacteria 1555
103 Ga0207661_10190713 3300025944 Bacteria 1797
104 Ga0207712_10119982 3300025961 Unclassified 1988
105 Ga0207668_10027198 3300025972 Bacteria 3725
106 Ga0207678_10021339 3300026067 Bacteria 5679
107 Ga0207678_10062817 3300026067 Bacteria 3192
108 Ga0207702_10108030 3300026078 Unclassified 2468
109 Ga0207675_100291564 3300026118 Bacteria 1587
110 Ga0207683_10014485 3300026121 Bacteria 6714
111 Ga0207428_10000505 3300027907 Bacteria 46673
112 Ga0207428_10009485 3300027907 Bacteria 8716
113 Ga0207428_10058608 3300027907 Bacteria 3055
114 Ga0268266_10000004 3300028379 Bacteria 1495817
115 Ga0268266_10000384 3300028379 Bacteria 67247
116 Ga0268264_10046936 3300028381 Bacteria 3590
117 Ga0268264_10338248 3300028381 Bacteria 1429
118 Ga0265337_1000917 3300028556 Bacteria 15446
119 Ga0265334_10013662 3300028573 Bacteria 3397
120 Ga0265318_10002649 3300028577 Bacteria 9431
121 Ga0265338_10001574 3300028800 Bacteria 36783
122 Ga0265338_10112448 3300028800 Unclassified 2190
123 Ga0265338_10210478 3300028800 Bacteria 1460
124 Ga0265320_10032699 3300031240 Unclassified 2660
125 Ga0265320_10100451 3300031240 Bacteria 1333
126 Ga0265325_10008976 3300031241 Bacteria 5870
127 Ga0265325_10017778 3300031241 Bacteria 3950
128 Ga0265325_10105387 3300031241 Bacteria 1376
129 Ga0265339_10018730 3300031249 Unclassified 4077
130 Ga0265339_10099640 3300031249 Bacteria 1514
131 Ga0265327_10004880 3300031251 Bacteria 11591
132 Ga0265316_10009787 3300031344 Bacteria 8802
133 Ga0265316_10043842 3300031344 Bacteria 3562
134 Ga0307408_100006831 3300031548 Bacteria 7567
135 Ga0307408_100077877 3300031548 Bacteria 2469
136 Ga0265313_10004502 3300031595 Bacteria 10664
137 Ga0265314_10029906 3300031711 Bacteria 4041
138 Ga0265314_10068255 3300031711 Bacteria 2391
139 Ga0265342_10017514 3300031712 Bacteria 4656
140 Ga0307405_10189770 3300031731 Bacteria 1483
141 Ga0307412_10173990 3300031911 Bacteria 1612
142 Ga0307416_100076328 3300032002 Bacteria 2808
143 Ga0373959_0000286 3300034820 Bacteria 10772
144 Ga0373940_0040507 3300035088 Bacteria 1279
145 Ga0373923_0009782 3300035111 Bacteria 3467
146 Ga0373945_0110862 3300035116 Bacteria 1083
147 Ga0373953_0008183 3300035117 Bacteria 3541
148 Ga0373954_0004424 3300035118 Bacteria 6048
149 Ga0373956_0002785 3300035119 Bacteria 7068
150 Ga0373955_0087956 3300035172 Bacteria 1766
151 Ga0373935_0174572 3300035692 Bacteria 1472
152 Ga0373927_0116650 3300035695 Bacteria 1741
153 Ga0373933_0006042 3300035724 Bacteria 6587
154 Ga0373937_0476111 3300036401 Bacteria 1186
155 Ga0395898_0175056 3300037466 Bacteria 2051
156 Ga0395905_0317339 3300037471 Bacteria 1448
157 Ga0436364_0431728 3300037853 Bacteria 222864
158 Ga0395901_0322084 3300038443 Bacteria 1599
159 Ga0439450_015724 3300042008 Bacteria 1554
160 Ga0439464_0005226 3300042439 Bacteria 3348
161 Ga0453683_0000353 3300044673 Bacteria 55685
162 Ga0453683_0113290 3300044673 Bacteria 1706
163 Ga0453684_0059982 3300044712 Bacteria 4899
164 Ga0451576_0004475 3300045051 Bacteria 18097
165 Ga0451576_0090264 3300045051 Bacteria 3187
166 Ga0451576_0306235 3300045051 Bacteria 1662
167 Ga0495653_0198345 3300046463 Bacteria 1364
168 Ga0495625_0015170 3300046660 Bacteria 6115
169 Ga0495658_0336407 3300046683 Bacteria 958
170 Ga0495672_0001328 3300047320 Bacteria 24586
171 Ga0496100_0064010 3300048903 Bacteria 2432
172 Ga0496104_0345919 3300048907 Bacteria 1400
173 Ga0496105_0040912 3300048908 Bacteria 3821
174 Ga0496110_0058097 3300048913 Bacteria 3406
175 Ga0496110_0415885 3300048913 Bacteria 1226
176 Ga0496112_0008567 3300048915 Bacteria 9167
177 Ga0496112_0159893 3300048915 Bacteria 2219
178 Ga0496121_0048440 3300048924 Bacteria 3615
179 Ga0496126_0022709 3300048929 Bacteria 6095
180 Ga0501034_0384079 3300049571 Bacteria 1329
181 nmdc:mga05p37_156645_c1 3300050507 Unclassified 2783
182 nmdc:mga05p37_638_c1 3300050507 Bacteria 38795
183 nmdc:mga09592_129530_c1 3300050508 Bacteria 2170
184 nmdc:mga09592_2864_c1 3300050508 Bacteria 13997
185 nmdc:mga0qj67_111226_c1 3300050509 Unclassified 2212
186 nmdc:mga0qj67_67000_c1 3300050509 Bacteria 2860
187 nmdc:mga06r32_27393_c1 3300050510 Bacteria 5324
188 nmdc:mga08y16_12397_c1 3300050511 Bacteria 8966
189 nmdc:mga08y16_275969_c1 3300050511 Bacteria 1735
190 nmdc:mga08y16_917_c1 3300050511 Bacteria 28573
191 Ga0500595_007961 3300053119 Unclassified 4353
192 Ga0500622_0000112 3300053156 Bacteria 83558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100127730 Ga0070695_1001277302 266
2 3300005549 Ga0070704_100030279 Ga0070704_1000302793 266
3 3300009176 Ga0105242_10047883 Ga0105242_100478833 266
4 3300025934 Ga0207686_10047458 Ga0207686_100474583 266
5 3300006846 Ga0075430_100105513 Ga0075430_1001055132 275
6 3300009147 Ga0114129_10278879 Ga0114129_102788792 275
7 3300046683 Ga0495658_0336407 Ga0495658_0336407_62_946 278
8 3300048915 Ga0496112_0159893 Ga0496112_0159893_1305_2207 285
9 3300005335 Ga0070666_10000010 Ga0070666_10000010104 288
10 3300005344 Ga0070661_100048498 Ga0070661_1000484983 288
11 3300005367 Ga0070667_100003158 Ga0070667_10000315810 288
12 3300005466 Ga0070685_10065089 Ga0070685_100650893 288
13 3300005548 Ga0070665_100000339 Ga0070665_10000033948 288
14 3300005842 Ga0068858_100071322 Ga0068858_1000713223 288
15 3300005843 Ga0068860_100016117 Ga0068860_1000161177 288
16 3300009551 Ga0105238_10000044 Ga0105238_1000004433 288
17 3300013306 Ga0163162_10020821 Ga0163162_100208216 288
18 3300025903 Ga0207680_10000002 Ga0207680_10000002286 288
19 3300025924 Ga0207694_10003600 Ga0207694_100036005 288
20 3300025972 Ga0207668_10027198 Ga0207668_100271983 288
21 3300028379 Ga0268266_10000004 Ga0268266_10000004284 288
22 3300028381 Ga0268264_10046936 Ga0268264_100469364 288
23 3300046660 Ga0495625_0015170 Ga0495625_0015170_5126_6085 288
24 3300048924 Ga0496121_0048440 Ga0496121_0048440_1800_2759 288
25 3300048929 Ga0496126_0022709 Ga0496126_0022709_888_1847 288
26 3300036401 Ga0373937_0476111 Ga0373937_0476111_15_992 289
27 3300045051 Ga0451576_0306235 Ga0451576_0306235_283_1245 289
28 3300006058 Ga0075432_10027452 Ga0075432_100274521 290
29 3300006844 Ga0075428_100122520 Ga0075428_1001225202 290
30 3300009094 Ga0111539_10004205 Ga0111539_1000420515 290
31 3300027907 Ga0207428_10000505 Ga0207428_100005052 290
32 3300050511 nmdc:mga08y16_275969_c1 nmdc:mga08y16_275969_c1_540_1541 290
33 3300046463 Ga0495653_0198345 Ga0495653_0198345_112_1107 295
34 iso_pu_bacteria 2910245624 2910250366 301
35 3300005439 Ga0070711_100072760 Ga0070711_1000727602 303
36 3300005548 Ga0070665_100068331 Ga0070665_1000683313 303
37 3300006042 Ga0075368_10022086 Ga0075368_100220862 303
38 3300006178 Ga0075367_10003284 Ga0075367_100032845 303
39 3300009177 Ga0105248_10096735 Ga0105248_100967353 303
40 3300021388 Ga0213875_10000099 Ga0213875_1000009933 303
41 3300025916 Ga0207663_10114370 Ga0207663_101143702 303
42 3300035111 Ga0373923_0009782 Ga0373923_0009782_1243_2202 303
43 3300035117 Ga0373953_0008183 Ga0373953_0008183_49_1008 303
44 3300035118 Ga0373954_0004424 Ga0373954_0004424_1424_2383 303
45 3300035119 Ga0373956_0002785 Ga0373956_0002785_4647_5606 303
46 3300035172 Ga0373955_0087956 Ga0373955_0087956_291_1250 303
47 3300035692 Ga0373935_0174572 Ga0373935_0174572_120_1079 303
48 3300035695 Ga0373927_0116650 Ga0373927_0116650_384_1343 303
49 3300035724 Ga0373933_0006042 Ga0373933_0006042_389_1348 303
50 3300005435 Ga0070714_100000033 Ga0070714_10000003350 304
51 3300006844 Ga0075428_100026039 Ga0075428_1000260394 304
52 3300006846 Ga0075430_100048685 Ga0075430_1000486853 304
53 3300006847 Ga0075431_100029771 Ga0075431_1000297714 304
54 3300009147 Ga0114129_10008941 Ga0114129_1000894114 304
55 3300025929 Ga0207664_10000024 Ga0207664_10000024144 304
56 3300026078 Ga0207702_10108030 Ga0207702_101080302 304
57 3300031241 Ga0265325_10105387 Ga0265325_101053872 304
58 3300031249 Ga0265339_10099640 Ga0265339_100996402 304
59 3300035116 Ga0373945_0110862 Ga0373945_0110862_11_955 304
60 3300047320 Ga0495672_0001328 Ga0495672_0001328_5743_6693 304
61 3300050508 nmdc:mga09592_129530_c1 nmdc:mga09592_129530_c1_612_1571 304
62 3300050509 nmdc:mga0qj67_67000_c1 nmdc:mga0qj67_67000_c1_883_1842 304
63 3300053156 Ga0500622_0000112 Ga0500622_0000112_35607_36641 304
64 3300005337 Ga0070682_100000036 Ga0070682_1000000367 305
65 3300009093 Ga0105240_10058374 Ga0105240_100583744 305
66 3300009551 Ga0105238_10078496 Ga0105238_100784962 305
67 3300009553 Ga0105249_10108105 Ga0105249_101081052 305
68 3300010375 Ga0105239_10228933 Ga0105239_102289331 305
69 3300025913 Ga0207695_10016500 Ga0207695_100165003 305
70 3300025914 Ga0207671_10054451 Ga0207671_100544512 305
71 3300025961 Ga0207712_10119982 Ga0207712_101199822 305
72 3300038443 Ga0395901_0322084 Ga0395901_0322084_279_1235 305
73 3300048903 Ga0496100_0064010 Ga0496100_0064010_1003_1950 305
74 3300037471 Ga0395905_0317339 Ga0395905_0317339_414_1406 307
75 3300005436 Ga0070713_100005613 Ga0070713_1000056135 308
76 3300025906 Ga0207699_10030933 Ga0207699_100309331 308
77 3300025928 Ga0207700_10000001 Ga0207700_10000001904 308
78 3300037466 Ga0395898_0175056 Ga0395898_0175056_157_1146 308
79 3300048913 Ga0496110_0058097 Ga0496110_0058097_686_1675 308
80 3300005366 Ga0070659_100084511 Ga0070659_1000845112 309
81 3300005434 Ga0070709_10004859 Ga0070709_100048593 309
82 3300005435 Ga0070714_100039591 Ga0070714_1000395912 309
83 3300005439 Ga0070711_100297990 Ga0070711_1002979902 309
84 3300005445 Ga0070708_100009469 Ga0070708_1000094693 309
85 3300005466 Ga0070685_10001168 Ga0070685_100011682 309
86 3300005468 Ga0070707_100018464 Ga0070707_1000184643 309
87 3300005468 Ga0070707_100129987 Ga0070707_1001299872 309
88 3300005471 Ga0070698_100243075 Ga0070698_1002430752 309
89 3300005518 Ga0070699_100004848 Ga0070699_1000048482 309
90 3300005536 Ga0070697_100059858 Ga0070697_1000598583 309
91 3300006173 Ga0070716_100016890 Ga0070716_1000168904 309
92 3300006175 Ga0070712_100040357 Ga0070712_1000403573 309
93 3300006914 Ga0075436_100024709 Ga0075436_1000247092 309
94 3300009098 Ga0105245_10090944 Ga0105245_100909442 309
95 3300013105 Ga0157369_10018029 Ga0157369_100180295 309
96 3300025910 Ga0207684_10229894 Ga0207684_102298941 309
97 3300025915 Ga0207693_10180278 Ga0207693_101802782 309
98 3300025922 Ga0207646_10024150 Ga0207646_100241503 309
99 3300025922 Ga0207646_10069851 Ga0207646_100698512 309
100 3300025927 Ga0207687_10198483 Ga0207687_101984832 309
101 3300025929 Ga0207664_10061355 Ga0207664_100613553 309
102 3300025932 Ga0207690_10063279 Ga0207690_100632792 309
103 3300025939 Ga0207665_10174347 Ga0207665_101743472 309
104 3300034820 Ga0373959_0000286 Ga0373959_0000286_2642_3586 309
105 3300048913 Ga0496110_0415885 Ga0496110_0415885_33_1016 309
106 3300053119 Ga0500595_007961 Ga0500595_007961_723_1739 309
107 3300005328 Ga0070676_10012409 Ga0070676_100124094 310
108 3300005441 Ga0070700_100028608 Ga0070700_1000286082 310
109 3300005445 Ga0070708_100429670 Ga0070708_1004296701 310
110 3300005518 Ga0070699_100136052 Ga0070699_1001360522 310
111 3300005840 Ga0068870_10076843 Ga0068870_100768432 310
112 3300005985 Ga0081539_10000388 Ga0081539_1000038881 310
113 3300006880 Ga0075429_100207804 Ga0075429_1002078041 310
114 3300006931 Ga0097620_100434876 Ga0097620_1004348762 310
115 3300009094 Ga0111539_10018658 Ga0111539_100186588 310
116 3300009147 Ga0114129_10183547 Ga0114129_101835472 310
117 3300014326 Ga0157380_10342245 Ga0157380_103422452 310
118 3300025261 Ga0209233_1002400 Ga0209233_10024005 310
119 3300025910 Ga0207684_10132189 Ga0207684_101321892 310
120 3300027907 Ga0207428_10009485 Ga0207428_100094853 310
121 3300035088 Ga0373940_0040507 Ga0373940_0040507_97_1086 310
122 3300037853 Ga0436364_0431728 Ga0436364_0431728_108802_109851 310
123 3300048915 Ga0496112_0008567 Ga0496112_0008567_4486_5508 310
124 3300049571 Ga0501034_0384079 Ga0501034_0384079_319_1260 310
125 3300050507 nmdc:mga05p37_156645_c1 nmdc:mga05p37_156645_c1_1019_2089 310
126 3300050511 nmdc:mga08y16_12397_c1 nmdc:mga08y16_12397_c1_6185_7129 310
127 3300005353 Ga0070669_100088889 Ga0070669_1000888892 311
128 3300005455 Ga0070663_100005896 Ga0070663_1000058963 311
129 3300005456 Ga0070678_100021232 Ga0070678_1000212324 311
130 3300005548 Ga0070665_100000124 Ga0070665_10000012499 311
131 3300005719 Ga0068861_100231597 Ga0068861_1002315972 311
132 3300009093 Ga0105240_10123883 Ga0105240_101238833 311
133 3300009551 Ga0105238_10000013 Ga0105238_10000013194 311
134 3300014326 Ga0157380_10057455 Ga0157380_100574552 311
135 3300025913 Ga0207695_10053878 Ga0207695_100538783 311
136 3300025913 Ga0207695_10142653 Ga0207695_101426532 311
137 3300025918 Ga0207662_10033312 Ga0207662_100333123 311
138 3300025924 Ga0207694_10000026 Ga0207694_1000002652 311
139 3300025944 Ga0207661_10190713 Ga0207661_101907132 311
140 3300026067 Ga0207678_10021339 Ga0207678_100213393 311
141 3300026118 Ga0207675_100291564 Ga0207675_1002915642 311
142 3300026121 Ga0207683_10014485 Ga0207683_100144853 311
143 3300028379 Ga0268266_10000384 Ga0268266_1000038412 311
144 3300031240 Ga0265320_10100451 Ga0265320_101004512 311
145 3300045051 Ga0451576_0090264 Ga0451576_0090264_950_1981 311
146 3300048908 Ga0496105_0040912 Ga0496105_0040912_2770_3750 311
147 3300005333 Ga0070677_10024144 Ga0070677_100241442 312
148 3300005347 Ga0070668_100184964 Ga0070668_1001849642 312
149 3300006844 Ga0075428_100000995 Ga0075428_10000099520 312
150 3300006846 Ga0075430_100001021 Ga0075430_1000010219 312
151 3300006847 Ga0075431_100001337 Ga0075431_10000133710 312
152 3300006880 Ga0075429_100000273 Ga0075429_10000027314 312
153 3300009094 Ga0111539_10000201 Ga0111539_100002017 312
154 3300009147 Ga0114129_10000751 Ga0114129_1000075122 312
155 3300026067 Ga0207678_10062817 Ga0207678_100628173 312
156 3300027907 Ga0207428_10058608 Ga0207428_100586081 312
157 3300031241 Ga0265325_10008976 Ga0265325_100089766 312
158 3300031548 Ga0307408_100006831 Ga0307408_1000068313 312
159 3300031548 Ga0307408_100077877 Ga0307408_1000778772 312
160 3300031731 Ga0307405_10189770 Ga0307405_101897702 312
161 3300031911 Ga0307412_10173990 Ga0307412_101739902 312
162 3300032002 Ga0307416_100076328 Ga0307416_1000763281 312
163 3300042008 Ga0439450_015724 Ga0439450_015724_297_1340 312
164 3300042439 Ga0439464_0005226 Ga0439464_0005226_2096_3139 312
165 3300048907 Ga0496104_0345919 Ga0496104_0345919_383_1375 312
166 3300050507 nmdc:mga05p37_638_c1 nmdc:mga05p37_638_c1_30046_31089 312
167 3300050508 nmdc:mga09592_2864_c1 nmdc:mga09592_2864_c1_2223_3266 312
168 3300050509 nmdc:mga0qj67_111226_c1 nmdc:mga0qj67_111226_c1_70_1113 312
169 3300050510 nmdc:mga06r32_27393_c1 nmdc:mga06r32_27393_c1_3041_4084 312
170 3300050511 nmdc:mga08y16_917_c1 nmdc:mga08y16_917_c1_9462_10505 312
171 3300003323 rootH1_10358974 rootH1_103589742 313
172 3300005548 Ga0070665_100166945 Ga0070665_1001669451 313
173 3300028381 Ga0268264_10338248 Ga0268264_103382482 313
174 3300028556 Ga0265337_1000917 Ga0265337_10009177 313
175 3300028573 Ga0265334_10013662 Ga0265334_100136623 313
176 3300028577 Ga0265318_10002649 Ga0265318_100026492 313
177 3300028800 Ga0265338_10001574 Ga0265338_100015747 313
178 3300028800 Ga0265338_10112448 Ga0265338_101124482 313
179 3300028800 Ga0265338_10210478 Ga0265338_102104781 313
180 3300031240 Ga0265320_10032699 Ga0265320_100326992 313
181 3300031241 Ga0265325_10017778 Ga0265325_100177782 313
182 3300031249 Ga0265339_10018730 Ga0265339_100187303 313
183 3300031251 Ga0265327_10004880 Ga0265327_100048808 313
184 3300031344 Ga0265316_10009787 Ga0265316_100097873 313
185 3300031344 Ga0265316_10043842 Ga0265316_100438423 313
186 3300031595 Ga0265313_10004502 Ga0265313_100045023 313
187 3300031711 Ga0265314_10029906 Ga0265314_100299063 313
188 3300031711 Ga0265314_10068255 Ga0265314_100682552 313
189 3300031712 Ga0265342_10017514 Ga0265342_100175142 313
190 3300044673 Ga0453683_0000353 Ga0453683_0000353_31070_32032 313
191 3300044673 Ga0453683_0113290 Ga0453683_0113290_610_1569 313
192 3300044712 Ga0453684_0059982 Ga0453684_0059982_1136_2095 313
193 3300045051 Ga0451576_0004475 Ga0451576_0004475_9498_10457 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

6

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8134 1 310
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8116 1 310
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7924 1 310
5eke-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7914 1 310
5ekp-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7908 1 310
ID Description Score Start End Superfamily
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9322 7 209 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9249 7 193 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9109 7 193 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9064 7 209 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9034 7 224 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1X7MIX0-F1-model_v4 deleted 0.9808 3 109
AF-W2D0Y6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9802 5 119 GO:0005886
GO:0016757
AF-R6PDZ6-F1-model_v4 deleted 0.9774 4 118
AF-A0A1I1DVC6-F1-model_v4 Glycosyl transferase family 2 0.9692 4 101 GO:0005886
GO:0016757
AF-K1X8E6-F1-model_v4 Glycosyl transferase family 2 0.9686 5 310 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
80.68 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map