F296622

General Info

Members Datasets Scaffolds Average Seq Length
193 147 386 168

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10284167|Ga0070658_102841672
Length 184
Sequence VSTVIDWFDNLPRRVLALVAVACVCLLAFGMYLQLVVGLNPCPMCIVQRYALIIVAVIAGVTAMFKSRRAWITGGVLAVLVGGFGAFVAARQSWLQWYPPEVASCGRDFYGMIENFPLKRAIPMIFKGSGDCTKVDWTFLGGSIANWSFLWFCFIVLVSLVLITRQMGTSRALRPNAVPTHRAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
97 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
146 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
147 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.42
Nodule 0
Rhizoplane 0.52
Rhizosphere 65.8
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10284167 3300005327 Bacteria 1409
2 JGI25155J39150_1000095 3300002704 Bacteria 49917
3 JGI25156J39149_1000025 3300002705 Bacteria 136287
4 JGI25154J39366_1000045 3300002738 Bacteria 136302
5 JGI25157J39369_1000034 3300002741 Bacteria 136301
6 JGI25150J39212_1006697 3300002774 Bacteria 2360
7 JGI25150J39212_1010400 3300002774 Bacteria 1732
8 JGI25159J45721_1002245 3300002987 Bacteria 7462
9 JGI25151J46595_10006281 3300003187 Bacteria 5999
10 JGI25160J50197_1000321 3300003354 Bacteria 33340
11 JGI25161J50226_1000070 3300003374 Bacteria 89592
12 Ga0055526_1008277 3300003771 Bacteria 5217
13 Ga0055537_1007538 3300003773 Bacteria 2615
14 Ga0055530_10014596 3300003791 Bacteria 2607
15 Ga0055540_1003349 3300003792 Bacteria 7786
16 Ga0055531_10000280 3300003794 Bacteria 52101
17 Ga0055543_1000368 3300004625 Bacteria 29830
18 Ga0065165_1005130 3300005262 Bacteria 7583
19 Ga0065165_1011496 3300005262 Bacteria 3685
20 Ga0065165_1028985 3300005262 Bacteria 1779
21 Ga0065714_10124490 3300005288 Bacteria 1310
22 Ga0070658_10400052 3300005327 Bacteria 1179
23 Ga0070670_100092746 3300005331 Bacteria 2597
24 Ga0070674_100015873 3300005356 Bacteria 4711
25 Ga0070659_100348081 3300005366 Bacteria 1243
26 Ga0070714_100152475 3300005435 Bacteria 2084
27 Ga0070681_10188892 3300005458 Bacteria 1980
28 Ga0068867_100642606 3300005459 Bacteria 930
29 Ga0070679_100165534 3300005530 Bacteria 2185
30 Ga0070672_100184604 3300005543 Bacteria 1739
31 Ga0068855_100774053 3300005563 Bacteria 1022
32 Ga0068856_100076766 3300005614 Bacteria 3310
33 Ga0068852_101837432 3300005616 Bacteria 628
34 Ga0068863_100196311 3300005841 Bacteria 1940
35 Ga0068862_100359750 3300005844 Bacteria 1352
36 Ga0075365_10022474 3300006038 Bacteria 3952
37 Ga0075368_10130160 3300006042 Bacteria 1046
38 Ga0075366_10018354 3300006195 Bacteria 4038
39 Ga0075370_10036776 3300006353 Bacteria 2751
40 Ga0105240_10012766 3300009093 Bacteria 11577
41 Ga0105240_10564770 3300009093 Bacteria 1257
42 Ga0105241_10079842 3300009174 Bacteria 2559
43 Ga0105248_10913880 3300009177 Bacteria 991
44 Ga0105238_10492367 3300009551 Bacteria 1226
45 Ga0105239_10671806 3300010375 Bacteria 1184
46 Ga0157326_1029528 3300012513 Bacteria 719
47 Ga0157374_10682089 3300013296 Bacteria 1040
48 Ga0157378_10206436 3300013297 Bacteria 1861
49 Ga0157378_11191325 3300013297 Unclassified 801
50 Ga0157376_10111120 3300014969 Bacteria 2412
51 Ga0157376_11252529 3300014969 Bacteria 771
52 Ga0209435_100001 3300025206 Bacteria 1424171
53 Ga0209436_111211 3300025208 Bacteria 1589
54 Ga0207425_1001345 3300025245 Bacteria 10522
55 Ga0209646_1000001 3300025246 Bacteria 3092932
56 Ga0209026_1000003 3300025250 Bacteria 1060571
57 Ga0209759_1000001 3300025256 Bacteria 2799452
58 Ga0209565_1001987 3300025263 Bacteria 7972
59 Ga0209130_1000166 3300025284 Bacteria 96473
60 Ga0209675_1002477 3300025291 Bacteria 9469
61 Ga0209025_1016301 3300025294 Bacteria 4400
62 Ga0209564_1008126 3300025295 Bacteria 5249
63 Ga0209050_1004306 3300025298 Bacteria 9722
64 Ga0207426_1000025 3300025302 Bacteria 532921
65 Ga0209051_1000406 3300025303 Bacteria 59626
66 Ga0209257_1000012 3300025304 Bacteria 1111138
67 Ga0207642_10376521 3300025899 Bacteria 844
68 Ga0207705_10243619 3300025909 Bacteria 1370
69 Ga0207705_10333680 3300025909 Bacteria 1166
70 Ga0207695_10268889 3300025913 Bacteria 1601
71 Ga0207652_10051453 3300025921 Bacteria 3531
72 Ga0207681_10024600 3300025923 Bacteria 3866
73 Ga0207650_10176830 3300025925 Bacteria 1699
74 Ga0207687_10320763 3300025927 Bacteria 1254
75 Ga0207664_10041343 3300025929 Bacteria 3591
76 Ga0207690_10354922 3300025932 Bacteria 1160
77 Ga0207667_10118750 3300025949 Bacteria 2725
78 Ga0207667_10583279 3300025949 Bacteria 1128
79 Ga0207640_11580029 3300025981 Bacteria 591
80 Ga0207639_10119871 3300026041 Bacteria 2160
81 Ga0207702_10039516 3300026078 Bacteria 3954
82 Ga0207702_10511928 3300026078 Bacteria 1171
83 Ga0207641_10175502 3300026088 Bacteria 1959
84 Ga0207674_10681092 3300026116 Bacteria 993
85 Ga0265319_1077682 3300028563 Bacteria 1057
86 Ga0307515_10224674 3300028794 Bacteria 1686
87 Ga0265330_10020192 3300031235 Bacteria 3045
88 Ga0265332_10000128 3300031238 Bacteria 63543
89 Ga0265332_10035459 3300031238 Bacteria 2166
90 Ga0265329_10037565 3300031242 Bacteria 1560
91 Ga0265331_10033306 3300031250 Bacteria 2548
92 Ga0265316_10161517 3300031344 Bacteria 1675
93 Ga0265316_10685117 3300031344 Bacteria 723
94 Ga0307513_10000014 3300031456 Bacteria 303157
95 Ga0307513_10549891 3300031456 Bacteria 867
96 Ga0307408_100000177 3300031548 Bacteria 71449
97 Ga0307408_100958733 3300031548 Bacteria 786
98 Ga0265314_10053561 3300031711 Bacteria 2797
99 Ga0265342_10085748 3300031712 Bacteria 1812
100 Ga0307416_101499467 3300032002 Bacteria 780
101 Ga0373946_0249246 3300035171 Bacteria 866
102 Ga0373931_0542013 3300035691 Bacteria 755
103 Ga0373935_0334064 3300035692 Bacteria 1078
104 Ga0373937_1101616 3300036401 Bacteria 743
105 Ga0395899_0002226 3300037312 Bacteria 15895
106 Ga0395899_0003234 3300037312 Bacteria 12924
107 Ga0395899_0429139 3300037312 Bacteria 869
108 Ga0395900_0023488 3300037418 Bacteria 6310
109 Ga0395900_0089528 3300037418 Bacteria 3163
110 Ga0395900_0269689 3300037418 Bacteria 1697
111 Ga0395900_0490789 3300037418 Bacteria 1180
112 Ga0395900_1314241 3300037418 Bacteria 637
113 Ga0395898_0327984 3300037466 Bacteria 1460
114 Ga0395905_0000339 3300037471 Bacteria 66527
115 Ga0395905_0010004 3300037471 Bacteria 9243
116 Ga0395905_0019689 3300037471 Bacteria 6396
117 Ga0395905_0019696 3300037471 Bacteria 6395
118 Ga0395905_0022900 3300037471 Bacteria 5904
119 Ga0395905_0027546 3300037471 Bacteria 5359
120 Ga0395905_0046316 3300037471 Bacteria 4077
121 Ga0395905_0124974 3300037471 Bacteria 2419
122 Ga0395905_0147125 3300037471 Bacteria 2216
123 Ga0395905_0164094 3300037471 Bacteria 2087
124 Ga0395905_0379979 3300037471 Bacteria 1306
125 Ga0395905_0550643 3300037471 Bacteria 1055
126 Ga0395901_0281681 3300038443 Bacteria 1727
127 Ga0395901_0303416 3300038443 Bacteria 1655
128 Ga0395901_0431524 3300038443 Bacteria 1350
129 Ga0451791_0730515 3300041451 Bacteria 879
130 Ga0451833_0282584 3300041491 Bacteria 646
131 Ga0439445_0005773 3300042004 Bacteria 2828
132 Ga0450911_000121 3300042115 Bacteria 31301
133 Ga0451577_0045585 3300042876 Bacteria 3925
134 Ga0451577_0046903 3300042876 Bacteria 3864
135 Ga0466972_0301642 3300044658 Bacteria 748
136 Ga0453683_0003282 3300044673 Bacteria 12011
137 Ga0466965_0041786 3300044683 Bacteria 2260
138 Ga0466966_0053549 3300044684 Bacteria 2560
139 Ga0466966_0140119 3300044684 Bacteria 1478
140 Ga0453684_1596217 3300044712 Bacteria 670
141 Ga0466971_0197522 3300044719 Bacteria 949
142 Ga0466957_0247260 3300044842 Bacteria 1185
143 Ga0466960_0242505 3300044901 Bacteria 998
144 Ga0466959_0268208 3300045049 Bacteria 1174
145 Ga0466959_0384463 3300045049 Bacteria 955
146 Ga0451576_0535678 3300045051 Bacteria 1230
147 Ga0451576_0572931 3300045051 Bacteria 1186
148 Ga0451576_0601810 3300045051 Bacteria 1155
149 Ga0451576_0980832 3300045051 Bacteria 886
150 Ga0495650_0070838 3300046471 Bacteria 1368
151 Ga0495643_0028093 3300046522 Bacteria 3156
152 Ga0495642_0062502 3300046528 Bacteria 1546
153 Ga0495656_0450119 3300046615 Bacteria 678
154 Ga0495657_0244925 3300046675 Bacteria 1081
155 Ga0495669_0070061 3300046684 Bacteria 1597
156 Ga0495602_0957908 3300048088 Bacteria 567
157 Ga0496124_0023567 3300048927 Bacteria 5618
158 Ga0496125_0004501 3300048928 Bacteria 16030
159 Ga0501032_0210142 3300049569 Bacteria 1269
160 Ga0501036_0945960 3300049572 Bacteria 706
161 Ga0501037_0354832 3300049573 Bacteria 1011
162 Ga0501043_0649861 3300049579 Bacteria 775
163 Ga0501046_0395694 3300049580 Bacteria 998
164 Ga0501047_0408454 3300049581 Bacteria 1190
165 Ga0501048_0234272 3300049582 Bacteria 1303
166 Ga0501080_0023279 3300049742 Bacteria 5743
167 Ga0501044_0270730 3300049823 Bacteria 1634
168 Ga0501044_0390541 3300049823 Bacteria 1305
169 nmdc:mga03n38_67688_c1 3300050490 Bacteria 1644
170 nmdc:mga0yw44_104533_c1 3300050492 Bacteria 1808
171 nmdc:mga0k408_21249_c1 3300050493 Bacteria 3644
172 nmdc:mga0k408_295671_c1 3300050493 Bacteria 966
173 Ga0500643_082812 3300053087 Bacteria 880
174 Ga0500651_0018365 3300053093 Bacteria 4328
175 Ga0500650_0004219 3300053098 Bacteria 5162
176 Ga0500562_027704 3300053108 Bacteria 1487
177 Ga0500593_000429 3300053117 Bacteria 16647
178 Ga0500608_111963 3300053122 Bacteria 1250
179 Ga0500618_120070 3300053125 Bacteria 595
180 Ga0500559_0026918 3300053136 Bacteria 2452
181 Ga0500559_0030235 3300053136 Bacteria 2321
182 Ga0500573_0058008 3300053140 Bacteria 2220
183 Ga0500604_0093674 3300053151 Bacteria 984
184 Ga0500645_000059 3300053730 Bacteria 91141
185 Ga0500645_003754 3300053730 Bacteria 6054
186 Ga0500645_010792 3300053730 Bacteria 3005
187 Ga0500645_054906 3300053730 Bacteria 1158
188 Ga0500661_023014 3300055283 Bacteria 1103
189 Ga0500661_073547 3300055283 Bacteria 627
190 Ga0466962_0113747 3300061719 Bacteria 1304
191 2511243748 2511231002 Bacteria 5042903
192 2881101891 2881101125 Bacteria 4590519
193 2939632018 2939631187 Bacteria 6118131
194 Ga0070658_10284167
195 JGI25155J39150_1000095
196 JGI25156J39149_1000025
197 JGI25154J39366_1000045
198 JGI25157J39369_1000034
199 JGI25150J39212_1006697
200 JGI25150J39212_1010400
201 JGI25159J45721_1002245
202 JGI25151J46595_10006281
203 JGI25160J50197_1000321
204 JGI25161J50226_1000070
205 Ga0055526_1008277
206 Ga0055537_1007538
207 Ga0055530_10014596
208 Ga0055540_1003349
209 Ga0055531_10000280
210 Ga0055543_1000368
211 Ga0065165_1005130
212 Ga0065165_1011496
213 Ga0065165_1028985
214 Ga0065714_10124490
215 Ga0070658_10400052
216 Ga0070670_100092746
217 Ga0070674_100015873
218 Ga0070659_100348081
219 Ga0070714_100152475
220 Ga0070681_10188892
221 Ga0068867_100642606
222 Ga0070679_100165534
223 Ga0070672_100184604
224 Ga0068855_100774053
225 Ga0068856_100076766
226 Ga0068852_101837432
227 Ga0068863_100196311
228 Ga0068862_100359750
229 Ga0075365_10022474
230 Ga0075368_10130160
231 Ga0075366_10018354
232 Ga0075370_10036776
233 Ga0105240_10012766
234 Ga0105240_10564770
235 Ga0105241_10079842
236 Ga0105248_10913880
237 Ga0105238_10492367
238 Ga0105239_10671806
239 Ga0157326_1029528
240 Ga0157374_10682089
241 Ga0157378_10206436
242 Ga0157378_11191325
243 Ga0157376_10111120
244 Ga0157376_11252529
245 Ga0209435_100001
246 Ga0209436_111211
247 Ga0207425_1001345
248 Ga0209646_1000001
249 Ga0209026_1000003
250 Ga0209759_1000001
251 Ga0209565_1001987
252 Ga0209130_1000166
253 Ga0209675_1002477
254 Ga0209025_1016301
255 Ga0209564_1008126
256 Ga0209050_1004306
257 Ga0207426_1000025
258 Ga0209051_1000406
259 Ga0209257_1000012
260 Ga0207642_10376521
261 Ga0207705_10243619
262 Ga0207705_10333680
263 Ga0207695_10268889
264 Ga0207652_10051453
265 Ga0207681_10024600
266 Ga0207650_10176830
267 Ga0207687_10320763
268 Ga0207664_10041343
269 Ga0207690_10354922
270 Ga0207667_10118750
271 Ga0207667_10583279
272 Ga0207640_11580029
273 Ga0207639_10119871
274 Ga0207702_10039516
275 Ga0207702_10511928
276 Ga0207641_10175502
277 Ga0207674_10681092
278 Ga0265319_1077682
279 Ga0307515_10224674
280 Ga0265330_10020192
281 Ga0265332_10000128
282 Ga0265332_10035459
283 Ga0265329_10037565
284 Ga0265331_10033306
285 Ga0265316_10161517
286 Ga0265316_10685117
287 Ga0307513_10000014
288 Ga0307513_10549891
289 Ga0307408_100000177
290 Ga0307408_100958733
291 Ga0265314_10053561
292 Ga0265342_10085748
293 Ga0307416_101499467
294 Ga0373946_0249246
295 Ga0373931_0542013
296 Ga0373935_0334064
297 Ga0373937_1101616
298 Ga0395899_0002226
299 Ga0395899_0003234
300 Ga0395899_0429139
301 Ga0395900_0023488
302 Ga0395900_0089528
303 Ga0395900_0269689
304 Ga0395900_0490789
305 Ga0395900_1314241
306 Ga0395898_0327984
307 Ga0395905_0000339
308 Ga0395905_0010004
309 Ga0395905_0019689
310 Ga0395905_0019696
311 Ga0395905_0022900
312 Ga0395905_0027546
313 Ga0395905_0046316
314 Ga0395905_0124974
315 Ga0395905_0147125
316 Ga0395905_0164094
317 Ga0395905_0379979
318 Ga0395905_0550643
319 Ga0395901_0281681
320 Ga0395901_0303416
321 Ga0395901_0431524
322 Ga0451791_0730515
323 Ga0451833_0282584
324 Ga0439445_0005773
325 Ga0450911_000121
326 Ga0451577_0045585
327 Ga0451577_0046903
328 Ga0466972_0301642
329 Ga0453683_0003282
330 Ga0466965_0041786
331 Ga0466966_0053549
332 Ga0466966_0140119
333 Ga0453684_1596217
334 Ga0466971_0197522
335 Ga0466957_0247260
336 Ga0466960_0242505
337 Ga0466959_0268208
338 Ga0466959_0384463
339 Ga0451576_0535678
340 Ga0451576_0572931
341 Ga0451576_0601810
342 Ga0451576_0980832
343 Ga0495650_0070838
344 Ga0495643_0028093
345 Ga0495642_0062502
346 Ga0495656_0450119
347 Ga0495657_0244925
348 Ga0495669_0070061
349 Ga0495602_0957908
350 Ga0496124_0023567
351 Ga0496125_0004501
352 Ga0501032_0210142
353 Ga0501036_0945960
354 Ga0501037_0354832
355 Ga0501043_0649861
356 Ga0501046_0395694
357 Ga0501047_0408454
358 Ga0501048_0234272
359 Ga0501080_0023279
360 Ga0501044_0270730
361 Ga0501044_0390541
362 nmdc:mga03n38_67688_c1
363 nmdc:mga0yw44_104533_c1
364 nmdc:mga0k408_21249_c1
365 nmdc:mga0k408_295671_c1
366 Ga0500643_082812
367 Ga0500651_0018365
368 Ga0500650_0004219
369 Ga0500562_027704
370 Ga0500593_000429
371 Ga0500608_111963
372 Ga0500618_120070
373 Ga0500559_0026918
374 Ga0500559_0030235
375 Ga0500573_0058008
376 Ga0500604_0093674
377 Ga0500645_000059
378 Ga0500645_003754
379 Ga0500645_010792
380 Ga0500645_054906
381 Ga0500661_023014
382 Ga0500661_073547
383 Ga0466962_0113747
384 2511243748
385 2881101891
386 2939632018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

12

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7265 11 167
5kk2-assembly1.cif.gz_F architecture of fully occupied glua2 ampa receptor - tarp complex elucidated by single particle cryo-electron microscopy 0.7039 42 167
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.6946 11 159
4p1n-assembly1.cif.gz_A crystal structure of atg1-atg13 complex 0.6924 44 168
7qhb-assembly1.cif.gz_I active state of glua1/2 in complex with tarp gamma 8, l-glutamate and ctz 0.6924 41 167
ID Description Score Start End Superfamily
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7987 11 159 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7974 11 159 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7689 11 159 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7678 11 159 1.20.1550.10
af_Q9SKX2_35_174_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7214 10 164 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A1F4HSG2-F1-model_v4 Disulfide bond formation protein DsbB 0.9045 9 107 GO:0005886
GO:0006457
GO:0015035
AF-F0GJ53-F1-model_v4 Disulfide bond formation protein B 0.8971 4 106 GO:0005886
GO:0006457
GO:0015035
AF-A0A379XTJ9-F1-model_v4 Disulfide bond formation protein 0.8586 7 162 GO:0006457
GO:0015035
GO:0016020
AF-A0A419GWT5-F1-model_v4 Disulfide bond formation protein B 0.8585 7 96 GO:0006457
GO:0015035
GO:0016020
AF-A0A1G3ZJY5-F1-model_v4 Disulfide bond formation protein DsbB 0.8513 10 168 GO:0006457
GO:0015035
GO:0016020

Map