F296298

General Info

Members Datasets Scaffolds Average Seq Length
192 131 384 438

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0051788|Ga0501035_0051788_838_2262
Length 474
Sequence MQIIWAQKLSKCFFNNLQFINSFYRQKIQKNKMDNQNKPVQNFVNLLDYNKNIIFNMTPEEVTEAITSGDASRVRAIDGQFAIVEKVGQEVFMARSIGRPMRYFLAKQTAGPLLIVAERMDEIYEFLKSKNLHSQFHPSYTRMVPAHFVVRLEVIGCPDPNPVYTRFFAPQRNRLTTDLDEIGKQYIGALANECGKWLKTIPENEPVGVLFSGGIDSGSVFLVLYHLMLKMGLSPQRLKAFTLSVNNGADAQQAHEFLDKLGLSLFLEVIDVPQSAIDYKEAIKVVEDYKALDIESATMILALCKQLRRLYPDWKYLADGEGGDENLKDYPIEENTELTIRSVLNNTMLYQEGWGVDKIKHSLTYTGGQSRGHVRSYAPLQKLGFKDFSPYALPNVIEVSEGIPFIELTNWEEKELYALKGEIVKRGVKAITGFDMPVFEKRRFQRGAVDDNTFSQIFADNAMQYRTYFNSLYA

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
131 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.56
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0051788 3300049822 Bacteria 3674
2 rootH2_10000256 3300003320 Bacteria 54479
3 Ga0065707_10083482 3300005295 Bacteria 9005
4 Ga0065707_10169148 3300005295 Bacteria 1498
5 Ga0070658_10000025 3300005327 Bacteria 174551
6 Ga0070683_100022588 3300005329 Bacteria 5624
7 Ga0070690_100000141 3300005330 Bacteria 36444
8 Ga0070670_100036227 3300005331 Bacteria 4246
9 Ga0068869_100021581 3300005334 Bacteria 4431
10 Ga0070680_100003963 3300005336 Bacteria 11075
11 Ga0070680_100018193 3300005336 Bacteria 5551
12 Ga0068868_100007014 3300005338 Bacteria 8008
13 Ga0070660_100006389 3300005339 Bacteria 8168
14 Ga0070660_100146017 3300005339 Bacteria 1900
15 Ga0070689_100051712 3300005340 Unclassified 3176
16 Ga0070675_100001933 3300005354 Bacteria 15337
17 Ga0070659_100008564 3300005366 Bacteria 7478
18 Ga0070667_100000384 3300005367 Bacteria 47948
19 Ga0070709_10021352 3300005434 Unclassified 3769
20 Ga0070709_10041858 3300005434 Bacteria 2825
21 Ga0070681_10001482 3300005458 Bacteria 20736
22 Ga0070685_10067996 3300005466 Bacteria 2103
23 Ga0070706_100007722 3300005467 Bacteria 10060
24 Ga0070706_100008013 3300005467 Bacteria 9856
25 Ga0070707_100011826 3300005468 Bacteria 8149
26 Ga0070698_100000424 3300005471 Bacteria 45082
27 Ga0070698_100055194 3300005471 Bacteria 4030
28 Ga0070684_100054566 3300005535 Unclassified 3482
29 Ga0070697_100003620 3300005536 Bacteria 11867
30 Ga0070672_100005682 3300005543 Bacteria 8307
31 Ga0070693_100007167 3300005547 Bacteria 5438
32 Ga0068855_100001291 3300005563 Bacteria 31050
33 Ga0068855_100037867 3300005563 Bacteria 5732
34 Ga0068855_100141364 3300005563 Bacteria 2743
35 Ga0070664_100014888 3300005564 Bacteria 6345
36 Ga0068857_100092508 3300005577 Unclassified 2708
37 Ga0068857_100276399 3300005577 Bacteria 1544
38 Ga0068852_100000021 3300005616 Bacteria 126061
39 Ga0068852_100179280 3300005616 Bacteria 1991
40 Ga0068864_100044143 3300005618 Bacteria 3819
41 Ga0068851_10050286 3300005834 Bacteria 2116
42 Ga0097621_100019216 3300006237 Bacteria 5240
43 Ga0068871_100007802 3300006358 Bacteria 7663
44 Ga0075431_100237545 3300006847 Bacteria 1855
45 Ga0105240_10006828 3300009093 Bacteria 16695
46 Ga0105241_10093071 3300009174 Bacteria 2381
47 Ga0105248_10003068 3300009177 Bacteria 18526
48 Ga0105248_10050883 3300009177 Bacteria 4648
49 Ga0105248_10099012 3300009177 Bacteria 3285
50 Ga0105237_10253364 3300009545 Bacteria 1762
51 Ga0105238_10000036 3300009551 Bacteria 165343
52 Ga0157373_10027243 3300013100 Bacteria 4123
53 Ga0157371_10006100 3300013102 Bacteria 10022
54 Ga0157371_10008355 3300013102 Bacteria 8258
55 Ga0157371_10010013 3300013102 Bacteria 7415
56 Ga0157371_10013382 3300013102 Bacteria 6233
57 Ga0157371_10033602 3300013102 Bacteria 3684
58 Ga0157370_10000067 3300013104 Bacteria 113351
59 Ga0157370_10260174 3300013104 Bacteria 1604
60 Ga0157369_10000066 3300013105 Bacteria 144815
61 Ga0157369_10029754 3300013105 Bacteria 6032
62 Ga0157369_10049480 3300013105 Bacteria 4556
63 Ga0157374_10005791 3300013296 Bacteria 10435
64 Ga0157374_10104892 3300013296 Bacteria 2714
65 Ga0163162_10278775 3300013306 Bacteria 1804
66 Ga0157372_10000038 3300013307 Bacteria 167357
67 Ga0157372_10011448 3300013307 Bacteria 9431
68 Ga0157372_10024200 3300013307 Bacteria 6592
69 Ga0157372_10238819 3300013307 Bacteria 2108
70 Ga0157372_10352996 3300013307 Bacteria 1713
71 Ga0163163_10002026 3300014325 Bacteria 17123
72 Ga0163163_10020139 3300014325 Bacteria 6279
73 Ga0157376_10029826 3300014969 Bacteria 4348
74 Ga0157376_10035699 3300014969 Bacteria 4022
75 Ga0207680_10002224 3300025903 Bacteria 9057
76 Ga0207699_10047640 3300025906 Bacteria 2514
77 Ga0207705_10000185 3300025909 Bacteria 65037
78 Ga0207684_10001946 3300025910 Bacteria 21394
79 Ga0207707_10006467 3300025912 Bacteria 10230
80 Ga0207707_10062888 3300025912 Bacteria 3230
81 Ga0207695_10000026 3300025913 Bacteria 624558
82 Ga0207660_10075124 3300025917 Unclassified 2468
83 Ga0207657_10005982 3300025919 Bacteria 12662
84 Ga0207649_10060834 3300025920 Unclassified 2375
85 Ga0207652_10005430 3300025921 Bacteria 10342
86 Ga0207652_10008510 3300025921 Bacteria 8257
87 Ga0207652_10010587 3300025921 Bacteria 7423
88 Ga0207659_10025400 3300025926 Bacteria 3980
89 Ga0207690_10019271 3300025932 Bacteria 4198
90 Ga0207670_10066577 3300025936 Bacteria 2475
91 Ga0207670_10110909 3300025936 Bacteria 1977
92 Ga0207691_10062744 3300025940 Bacteria 3371
93 Ga0207711_10000351 3300025941 Bacteria 48821
94 Ga0207711_10028058 3300025941 Bacteria 4734
95 Ga0207689_10000317 3300025942 Bacteria 44677
96 Ga0207661_10054020 3300025944 Unclassified 3217
97 Ga0207679_10159318 3300025945 Unclassified 1846
98 Ga0207667_10003210 3300025949 Bacteria 20191
99 Ga0207667_10005633 3300025949 Bacteria 15281
100 Ga0207658_10000877 3300025986 Bacteria 25048
101 Ga0207677_10032290 3300026023 Bacteria 3363
102 Ga0207639_10015332 3300026041 Bacteria 5405
103 Ga0207676_10106710 3300026095 Bacteria 2334
104 Ga0207674_10001274 3300026116 Bacteria 32933
105 Ga0207674_10002543 3300026116 Bacteria 22970
106 Ga0207675_100182327 3300026118 Unclassified 2011
107 Ga0207683_10013598 3300026121 Bacteria 6942
108 Ga0207683_10028522 3300026121 Bacteria 4827
109 Ga0207698_10000016 3300026142 Bacteria 183355
110 Ga0207698_10023325 3300026142 Bacteria 4321
111 Ga0268264_10176991 3300028381 Bacteria 1934
112 Ga0265324_10002705 3300029957 Bacteria 8848
113 Ga0265320_10051098 3300031240 Bacteria 2007
114 Ga0265331_10036927 3300031250 Bacteria 2395
115 Ga0265327_10003284 3300031251 Bacteria 15663
116 Ga0265327_10013668 3300031251 Bacteria 5375
117 Ga0265316_10004363 3300031344 Bacteria 14106
118 Ga0316579_10016977 3300031691 Bacteria 3188
119 Ga0265314_10001839 3300031711 Bacteria 22785
120 Ga0316576_10071943 3300031727 Bacteria 2551
121 Ga0316578_10044907 3300031728 Bacteria 2571
122 Ga0316577_10013419 3300031733 Bacteria 4478
123 Ga0316580_10008836 3300032139 Unclassified 3025
124 Ga0373943_0011886 3300035170 Bacteria 3919
125 Ga0316574_0054220 3300035398 Bacteria 2504
126 Ga0316574_0175555 3300035398 Bacteria 1379
127 Ga0373924_0001497 3300035410 Bacteria 7609
128 Ga0316582_0003773 3300036647 Bacteria 7517
129 Ga0316582_0008168 3300036647 Bacteria 5613
130 Ga0316584_0021663 3300036712 Bacteria 4674
131 Ga0316584_0045367 3300036712 Bacteria 3281
132 Ga0373925_0009168 3300037068 Bacteria 7203
133 Ga0395899_0001093 3300037312 Bacteria 24347
134 Ga0395899_0101157 3300037312 Bacteria 2080
135 Ga0395900_0004077 3300037418 Bacteria 15577
136 Ga0395900_0076468 3300037418 Bacteria 3440
137 Ga0395898_0006715 3300037466 Bacteria 12270
138 Ga0395898_0035617 3300037466 Bacteria 4947
139 Ga0395898_0056378 3300037466 Bacteria 3829
140 Ga0436361_0669362 3300039447 Bacteria 30067
141 Ga0439464_0021237 3300042439 Bacteria 1782
142 Ga0439464_0022339 3300042439 Bacteria 1742
143 Ga0451577_0025205 3300042876 Bacteria 5398
144 Ga0451577_0027080 3300042876 Bacteria 5190
145 Ga0451577_0091532 3300042876 Unclassified 2715
146 Ga0453683_0000424 3300044673 Bacteria 48806
147 Ga0453683_0028102 3300044673 Bacteria 3563
148 Ga0453684_0000165 3300044712 Bacteria 294572
149 Ga0453684_0001194 3300044712 Bacteria 80254
150 Ga0453684_0002787 3300044712 Bacteria 41321
151 Ga0453684_0011257 3300044712 Bacteria 15056
152 Ga0453684_0038742 3300044712 Bacteria 6507
153 Ga0453684_0080151 3300044712 Bacteria 4078
154 Ga0453684_0090733 3300044712 Unclassified 3775
155 Ga0453684_0091836 3300044712 Bacteria 3746
156 Ga0453684_0198156 3300044712 Unclassified 2343
157 Ga0453684_0243220 3300044712 Bacteria 2070
158 Ga0453684_0248802 3300044712 Unclassified 2042
159 Ga0453684_0267050 3300044712 Bacteria 1957
160 Ga0453684_0366073 3300044712 Bacteria 1622
161 Ga0451576_0000190 3300045051 Bacteria 154484
162 Ga0451576_0000889 3300045051 Bacteria 56799
163 Ga0451576_0233173 3300045051 Bacteria 1922
164 Ga0495582_0053457 3300046473 Bacteria 2228
165 Ga0495594_0025116 3300046499 Bacteria 3202
166 Ga0495608_0007593 3300046511 Bacteria 7646
167 Ga0495630_0001006 3300046517 Bacteria 19532
168 Ga0495652_0074195 3300046529 Bacteria 2830
169 Ga0495634_0044560 3300046642 Bacteria 3002
170 Ga0495658_0086885 3300046683 Bacteria 1846
171 Ga0495669_0000946 3300046684 Bacteria 12139
172 Ga0495613_0000643 3300046689 Bacteria 27730
173 Ga0495604_0016362 3300047317 Bacteria 5929
174 Ga0495674_0117700 3300047319 Bacteria 2247
175 Ga0495684_0007516 3300047471 Bacteria 8437
176 Ga0496102_0020242 3300048905 Bacteria 5878
177 Ga0496107_0043178 3300048910 Bacteria 3239
178 Ga0496111_0073396 3300048914 Bacteria 2492
179 Ga0496126_0011050 3300048929 Bacteria 9384
180 Ga0501033_0092943 3300049570 Bacteria 2206
181 Ga0501034_0002648 3300049571 Bacteria 21207
182 Ga0501038_0206341 3300049574 Bacteria 1575
183 Ga0501067_0034938 3300049583 Bacteria 2790
184 Ga0501069_0027896 3300049585 Bacteria 3095
185 Ga0501070_0211952 3300049586 Unclassified 1590
186 Ga0501080_0106783 3300049742 Bacteria 2595
187 nmdc:mga05p37_134179_c1 3300050507 Bacteria 3037
188 nmdc:mga06r32_60434_c1 3300050510 Bacteria 3647
189 Ga0495601_0001227 3300053077 Bacteria 14076
190 Ga0495619_0002118 3300053085 Bacteria 13147
191 2673164811 2671180531 Bacteria 9045424
192 2688393415 2687453341 Bacteria 6534136
193 Ga0501035_0051788
194 rootH2_10000256
195 Ga0065707_10083482
196 Ga0065707_10169148
197 Ga0070658_10000025
198 Ga0070683_100022588
199 Ga0070690_100000141
200 Ga0070670_100036227
201 Ga0068869_100021581
202 Ga0070680_100003963
203 Ga0070680_100018193
204 Ga0068868_100007014
205 Ga0070660_100006389
206 Ga0070660_100146017
207 Ga0070689_100051712
208 Ga0070675_100001933
209 Ga0070659_100008564
210 Ga0070667_100000384
211 Ga0070709_10021352
212 Ga0070709_10041858
213 Ga0070681_10001482
214 Ga0070685_10067996
215 Ga0070706_100007722
216 Ga0070706_100008013
217 Ga0070707_100011826
218 Ga0070698_100000424
219 Ga0070698_100055194
220 Ga0070684_100054566
221 Ga0070697_100003620
222 Ga0070672_100005682
223 Ga0070693_100007167
224 Ga0068855_100001291
225 Ga0068855_100037867
226 Ga0068855_100141364
227 Ga0070664_100014888
228 Ga0068857_100092508
229 Ga0068857_100276399
230 Ga0068852_100000021
231 Ga0068852_100179280
232 Ga0068864_100044143
233 Ga0068851_10050286
234 Ga0097621_100019216
235 Ga0068871_100007802
236 Ga0075431_100237545
237 Ga0105240_10006828
238 Ga0105241_10093071
239 Ga0105248_10003068
240 Ga0105248_10050883
241 Ga0105248_10099012
242 Ga0105237_10253364
243 Ga0105238_10000036
244 Ga0157373_10027243
245 Ga0157371_10006100
246 Ga0157371_10008355
247 Ga0157371_10010013
248 Ga0157371_10013382
249 Ga0157371_10033602
250 Ga0157370_10000067
251 Ga0157370_10260174
252 Ga0157369_10000066
253 Ga0157369_10029754
254 Ga0157369_10049480
255 Ga0157374_10005791
256 Ga0157374_10104892
257 Ga0163162_10278775
258 Ga0157372_10000038
259 Ga0157372_10011448
260 Ga0157372_10024200
261 Ga0157372_10238819
262 Ga0157372_10352996
263 Ga0163163_10002026
264 Ga0163163_10020139
265 Ga0157376_10029826
266 Ga0157376_10035699
267 Ga0207680_10002224
268 Ga0207699_10047640
269 Ga0207705_10000185
270 Ga0207684_10001946
271 Ga0207707_10006467
272 Ga0207707_10062888
273 Ga0207695_10000026
274 Ga0207660_10075124
275 Ga0207657_10005982
276 Ga0207649_10060834
277 Ga0207652_10005430
278 Ga0207652_10008510
279 Ga0207652_10010587
280 Ga0207659_10025400
281 Ga0207690_10019271
282 Ga0207670_10066577
283 Ga0207670_10110909
284 Ga0207691_10062744
285 Ga0207711_10000351
286 Ga0207711_10028058
287 Ga0207689_10000317
288 Ga0207661_10054020
289 Ga0207679_10159318
290 Ga0207667_10003210
291 Ga0207667_10005633
292 Ga0207658_10000877
293 Ga0207677_10032290
294 Ga0207639_10015332
295 Ga0207676_10106710
296 Ga0207674_10001274
297 Ga0207674_10002543
298 Ga0207675_100182327
299 Ga0207683_10013598
300 Ga0207683_10028522
301 Ga0207698_10000016
302 Ga0207698_10023325
303 Ga0268264_10176991
304 Ga0265324_10002705
305 Ga0265320_10051098
306 Ga0265331_10036927
307 Ga0265327_10003284
308 Ga0265327_10013668
309 Ga0265316_10004363
310 Ga0316579_10016977
311 Ga0265314_10001839
312 Ga0316576_10071943
313 Ga0316578_10044907
314 Ga0316577_10013419
315 Ga0316580_10008836
316 Ga0373943_0011886
317 Ga0316574_0054220
318 Ga0316574_0175555
319 Ga0373924_0001497
320 Ga0316582_0003773
321 Ga0316582_0008168
322 Ga0316584_0021663
323 Ga0316584_0045367
324 Ga0373925_0009168
325 Ga0395899_0001093
326 Ga0395899_0101157
327 Ga0395900_0004077
328 Ga0395900_0076468
329 Ga0395898_0006715
330 Ga0395898_0035617
331 Ga0395898_0056378
332 Ga0436361_0669362
333 Ga0439464_0021237
334 Ga0439464_0022339
335 Ga0451577_0025205
336 Ga0451577_0027080
337 Ga0451577_0091532
338 Ga0453683_0000424
339 Ga0453683_0028102
340 Ga0453684_0000165
341 Ga0453684_0001194
342 Ga0453684_0002787
343 Ga0453684_0011257
344 Ga0453684_0038742
345 Ga0453684_0080151
346 Ga0453684_0090733
347 Ga0453684_0091836
348 Ga0453684_0198156
349 Ga0453684_0243220
350 Ga0453684_0248802
351 Ga0453684_0267050
352 Ga0453684_0366073
353 Ga0451576_0000190
354 Ga0451576_0000889
355 Ga0451576_0233173
356 Ga0495582_0053457
357 Ga0495594_0025116
358 Ga0495608_0007593
359 Ga0495630_0001006
360 Ga0495652_0074195
361 Ga0495634_0044560
362 Ga0495658_0086885
363 Ga0495669_0000946
364 Ga0495613_0000643
365 Ga0495604_0016362
366 Ga0495674_0117700
367 Ga0495684_0007516
368 Ga0496102_0020242
369 Ga0496107_0043178
370 Ga0496111_0073396
371 Ga0496126_0011050
372 Ga0501033_0092943
373 Ga0501034_0002648
374 Ga0501038_0206341
375 Ga0501067_0034938
376 Ga0501069_0027896
377 Ga0501070_0211952
378 Ga0501080_0106783
379 nmdc:mga05p37_134179_c1
380 nmdc:mga06r32_60434_c1
381 Ga0495601_0001227
382 Ga0495619_0002118
383 2673164811
384 2688393415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00733

Asn_synthase

Asparagine synthase

200

384

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m1z-assembly1.cif.gz_A beta-lactam synthetase apo enzyme 0.7429 39 440
1jgt-assembly1.cif.gz_A crystal structure of beta-lactam synthetase 0.7256 39 441
1mb9-assembly1.cif.gz_A beta-lactam synthetase complexed with atp 0.719 39 439
1mb9-assembly2.cif.gz_B beta-lactam synthetase complexed with atp 0.7098 34 442
1mbz-assembly2.cif.gz_B beta-lactam synthetase with trapped intermediate 0.706 21 442
ID Description Score Start End Superfamily
af_Q61024_227_531_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7453 147 442 3.40.50.620
af_Q61024_227_531_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.723 147 442 3.40.50.620
af_O16924_203_502_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7214 147 440 3.40.50.620
1jgtA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.721 140 441 3.40.50.620
af_Q58366_8_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7018 177 246 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A350HYQ8-F1-model_v4 Asparagine synthase 0.9856 11 213 GO:0004066
GO:0006529
AF-A0A517NEC9-F1-model_v4 Asparagine synthase 0.9776 6 442 GO:0004066
GO:0006529
AF-A0A7Z9LXG3-F1-model_v4 Asparagine synthetase B family protein 0.977 11 171
AF-A0A2E3DNC4-F1-model_v4 Asparagine synthase 0.9756 17 442 GO:0004066
GO:0006529
AF-A0A538P5N8-F1-model_v4 Asparagine synthetase B family protein 0.9746 7 105

Map