F296287

General Info

Members Datasets Scaffolds Average Seq Length
192 132 384 187

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0234681|Ga0501075_0234681_579_1193
Length 204
Sequence LVVLSVRCGAARHLLEDEMGRLIYLLNVSLDGFIETPDRGLAWAAVDDELHTWFNDWARGIAASLYGRRLYEVMAAYWPTAESDPEATGQMLEFARIWNATPKIVFSRTLTSVIEGSRLVRGDPVDELARIRTEFDGDLEVGGPTLAAEFVRHGLVDVYGLVVHPVVLGAGTPYFPPLQAPLRLRLTETRTFASGVTYLGYERA

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
79 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
80 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
126 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
130 2619618881 Frankia sp. ACN1ag Isolate Unclassified
131 2619619003 Frankia sp. CpI1-P Isolate Nodule
132 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0.52
Rhizoplane 5.21
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 17.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0234681 3300049591 Bacteria 1399
2 Ga0070690_100093749 3300005330 Unclassified 1981
3 Ga0070690_100131143 3300005330 Bacteria 1693
4 Ga0070682_100663151 3300005337 Bacteria 832
5 Ga0070687_100332876 3300005343 Bacteria 974
6 Ga0070669_100400195 3300005353 Bacteria 1123
7 Ga0070675_100050053 3300005354 Bacteria 3430
8 Ga0070673_100298127 3300005364 Archaea 1418
9 Ga0070688_100022732 3300005365 Bacteria 3679
10 Ga0070701_10111954 3300005438 Bacteria 1526
11 Ga0070701_10311442 3300005438 Bacteria 971
12 Ga0070700_100485751 3300005441 Unclassified 947
13 Ga0070700_101042809 3300005441 Bacteria 675
14 Ga0070708_100548860 3300005445 Bacteria 1090
15 Ga0070708_100554874 3300005445 Bacteria 1083
16 Ga0070681_10055148 3300005458 Bacteria 3959
17 Ga0070699_100010061 3300005518 Bacteria 8189
18 Ga0070699_100475419 3300005518 Bacteria 1134
19 Ga0070679_100250849 3300005530 Bacteria 1726
20 Ga0070686_100174722 3300005544 Bacteria 1522
21 Ga0070704_100436857 3300005549 Bacteria 1124
22 Ga0070664_100028403 3300005564 Bacteria 4653
23 Ga0068857_100101732 3300005577 Bacteria 2579
24 Ga0068856_101010740 3300005614 Bacteria 850
25 Ga0070702_100118453 3300005615 Bacteria 1654
26 Ga0068859_100071870 3300005617 Bacteria 3495
27 Ga0068859_100284059 3300005617 Unclassified 1748
28 Ga0068859_100614250 3300005617 Bacteria 1180
29 Ga0068864_100099193 3300005618 Bacteria 2580
30 Ga0068864_100123689 3300005618 Bacteria 2316
31 Ga0068861_101746256 3300005719 Unclassified 616
32 Ga0068863_100260120 3300005841 Bacteria 1678
33 Ga0068858_100168055 3300005842 Bacteria 2067
34 Ga0068860_100428507 3300005843 Unclassified 1312
35 Ga0068862_100123064 3300005844 Bacteria 2288
36 Ga0081455_10209792 3300005937 Bacteria 1452
37 Ga0081540_1005642 3300005983 Bacteria 9314
38 Ga0075365_10030353 3300006038 Bacteria 3461
39 Ga0068871_100281098 3300006358 Bacteria 1456
40 Ga0075428_100176058 3300006844 Bacteria 2317
41 Ga0075428_100249557 3300006844 Unclassified 1913
42 Ga0075433_10251210 3300006852 Bacteria 1569
43 Ga0075434_100123589 3300006871 Unclassified 2604
44 Ga0068865_100452092 3300006881 Bacteria 1062
45 Ga0097620_100071865 3300006931 Bacteria 3495
46 Ga0097620_100284052 3300006931 Unclassified 1748
47 Ga0097620_100614236 3300006931 Bacteria 1180
48 Ga0075435_100049259 3300007076 Bacteria 3387
49 Ga0111539_10014954 3300009094 Bacteria 9674
50 Ga0105245_10189246 3300009098 Bacteria 1970
51 Ga0114129_10035196 3300009147 Bacteria 7075
52 Ga0114129_10172274 3300009147 Bacteria 2950
53 Ga0114129_10216804 3300009147 Bacteria 2584
54 Ga0114129_10737714 3300009147 Bacteria 1262
55 Ga0105248_10962519 3300009177 Unclassified 964
56 Ga0105248_10977134 3300009177 Bacteria 956
57 Ga0105239_11621861 3300010375 Bacteria 748
58 Ga0105246_10783988 3300011119 Bacteria 844
59 Ga0157374_10656356 3300013296 Unclassified 1061
60 Ga0157375_10041522 3300013308 Bacteria 4442
61 Ga0157375_11007818 3300013308 Bacteria 972
62 Ga0163163_10061722 3300014325 Bacteria 3714
63 Ga0163163_10062205 3300014325 Bacteria 3698
64 Ga0157380_10506351 3300014326 Bacteria 1174
65 Ga0157377_10024720 3300014745 Bacteria 3195
66 Ga0157379_10032783 3300014968 Bacteria 4632
67 Ga0207688_10079751 3300025901 Bacteria 1867
68 Ga0207688_10344696 3300025901 Bacteria 917
69 Ga0207707_10076146 3300025912 Bacteria 2928
70 Ga0207662_10312861 3300025918 Unclassified 1047
71 Ga0207662_10351128 3300025918 Bacteria 990
72 Ga0207659_10097994 3300025926 Bacteria 2204
73 Ga0207679_10133764 3300025945 Bacteria 1993
74 Ga0207679_10390854 3300025945 Bacteria 1221
75 Ga0207668_10887290 3300025972 Bacteria 793
76 Ga0207703_10275871 3300026035 Bacteria 1525
77 Ga0207641_10158325 3300026088 Bacteria 2057
78 Ga0207676_10040543 3300026095 Bacteria 3569
79 Ga0207676_10226218 3300026095 Unclassified 1669
80 Ga0207674_10123041 3300026116 Bacteria 2560
81 Ga0207675_100555841 3300026118 Bacteria 1147
82 Ga0207428_10232353 3300027907 Unclassified 1380
83 Ga0268265_10696824 3300028380 Bacteria 981
84 Ga0268264_10319465 3300028381 Unclassified 1468
85 Ga0268264_11081477 3300028381 Bacteria 810
86 Ga0265334_10035093 3300028573 Bacteria 1987
87 Ga0265336_10107106 3300028666 Bacteria 833
88 Ga0265338_10278316 3300028800 Unclassified 1223
89 Ga0265320_10070118 3300031240 Bacteria 1654
90 Ga0265320_10127479 3300031240 Unclassified 1157
91 Ga0265316_10016761 3300031344 Bacteria 6346
92 Ga0265316_10280197 3300031344 Unclassified 1218
93 Ga0307413_10212376 3300031824 Unclassified 1407
94 Ga0307414_10025751 3300032004 Bacteria 3774
95 Ga0373960_0143339 3300035121 Bacteria 811
96 Ga0395905_0471170 3300037471 Bacteria 1155
97 Ga0395901_0832836 3300038443 Bacteria 909
98 Ga0436365_1745065 3300039437 Unclassified 801
99 Ga0436363_1393177 3300039450 Unclassified 752
100 Ga0451793_1279868 3300041452 Bacteria 825
101 Ga0451853_3851688 3300041512 Bacteria 1110
102 Ga0450909_029377 3300042185 Bacteria 832
103 Ga0439435_0029529 3300042436 Bacteria 1481
104 Ga0439459_0069858 3300042438 Unclassified 810
105 Ga0453684_0732951 3300044712 Unclassified 1071
106 Ga0466967_0442999 3300045976 Bacteria 1269
107 Ga0495580_0014606 3300046472 Bacteria 5952
108 Ga0495594_0341360 3300046499 Bacteria 853
109 Ga0495630_0733072 3300046517 Unclassified 756
110 Ga0495646_0254427 3300046680 Bacteria 940
111 Ga0495674_0577990 3300047319 Bacteria 892
112 Ga0495676_0106491 3300047321 Bacteria 2066
113 Ga0496104_0128715 3300048907 Unclassified 2432
114 Ga0496104_0734117 3300048907 Bacteria 895
115 Ga0496108_0658303 3300048911 Bacteria 910
116 Ga0496108_0902548 3300048911 Bacteria 758
117 Ga0496109_0067606 3300048912 Bacteria 3274
118 Ga0496112_0152135 3300048915 Bacteria 2281
119 Ga0496112_0181163 3300048915 Bacteria 2071
120 Ga0496113_0128043 3300048916 Bacteria 1990
121 Ga0496114_0560491 3300048917 Bacteria 1009
122 Ga0501031_0062385 3300049568 Bacteria 2429
123 Ga0501032_0099980 3300049569 Bacteria 1922
124 Ga0501033_0108148 3300049570 Bacteria 2026
125 Ga0501037_0066500 3300049573 Bacteria 2626
126 Ga0501038_0123865 3300049574 Bacteria 2129
127 Ga0501038_0310743 3300049574 Bacteria 1235
128 Ga0501038_0406351 3300049574 Bacteria 1053
129 Ga0501039_0240231 3300049575 Bacteria 1424
130 Ga0501039_0449611 3300049575 Bacteria 1012
131 Ga0501040_0197655 3300049576 Bacteria 1427
132 Ga0501040_0236342 3300049576 Bacteria 1302
133 Ga0501040_0634327 3300049576 Bacteria 772
134 Ga0501041_0043807 3300049577 Bacteria 2721
135 Ga0501041_0334572 3300049577 Bacteria 956
136 Ga0501042_0186205 3300049578 Bacteria 1497
137 Ga0501042_0376860 3300049578 Bacteria 1027
138 Ga0501048_0034924 3300049582 Bacteria 3623
139 Ga0501048_0082793 3300049582 Bacteria 2263
140 Ga0501067_0296288 3300049583 Bacteria 900
141 Ga0501068_0021109 3300049584 Bacteria 3801
142 Ga0501070_0143629 3300049586 Unclassified 1970
143 Ga0501071_0004813 3300049587 Bacteria 8597
144 Ga0501071_0036900 3300049587 Unclassified 3487
145 Ga0501071_0222895 3300049587 Bacteria 1419
146 Ga0501071_0670184 3300049587 Bacteria 798
147 Ga0501071_0710545 3300049587 Bacteria 774
148 Ga0501072_0020097 3300049588 Bacteria 5171
149 Ga0501072_0080253 3300049588 Bacteria 2584
150 Ga0501072_0574263 3300049588 Bacteria 890
151 Ga0501073_0249427 3300049589 Bacteria 1225
152 Ga0501074_0047041 3300049590 Bacteria 3119
153 Ga0501075_0189936 3300049591 Bacteria 1567
154 Ga0501075_0292968 3300049591 Bacteria 1240
155 Ga0501075_0450450 3300049591 Bacteria 981
156 Ga0501076_0019396 3300049592 Bacteria 5199
157 Ga0501076_0036308 3300049592 Bacteria 3862
158 Ga0501076_0080001 3300049592 Bacteria 2623
159 Ga0501076_0298070 3300049592 Unclassified 1321
160 Ga0501077_0027923 3300049593 Bacteria 3585
161 Ga0501077_0226269 3300049593 Unclassified 1189
162 Ga0501079_0054034 3300049741 Bacteria 3098
163 Ga0501079_0127892 3300049741 Bacteria 1976
164 Ga0501080_0165146 3300049742 Bacteria 2043
165 Ga0501080_0466298 3300049742 Bacteria 1131
166 Ga0501081_0310263 3300049743 Bacteria 1158
167 Ga0501083_0099476 3300049744 Unclassified 1918
168 Ga0501035_0147833 3300049822 Bacteria 2040
169 Ga0501035_0767062 3300049822 Unclassified 773
170 Ga0501045_0175943 3300049824 Bacteria 1594
171 Ga0501045_0236755 3300049824 Unclassified 1359
172 nmdc:mga05p37_113903_c1 3300050507 Bacteria 3325
173 nmdc:mga05p37_13867_c2 3300050507 Bacteria 4619
174 nmdc:mga05p37_416554_c1 3300050507 Bacteria 1564
175 nmdc:mga08y16_221267_c1 3300050511 Unclassified 1960
176 nmdc:mga08y16_42714_c1 3300050511 Bacteria 4747
177 nmdc:mga0rr50_81892_c1 3300050513 Bacteria 2492
178 nmdc:mga0a205_239707_c1 3300050515 Bacteria 1694
179 Ga0501084_0069121 3300054114 Bacteria 2956
180 Ga0501084_0342355 3300054114 Unclassified 1263
181 Ga0501084_1220937 3300054114 Bacteria 631
182 Ga0590071_004666 3300059421 Bacteria 3312
183 Ga0590075_002707 3300059424 Bacteria 4238
184 Ga0501082_0096950 3300060353 Bacteria 2549
185 Ga0501082_0192119 3300060353 Bacteria 1776
186 Ga0501082_0219390 3300060353 Bacteria 1655
187 Ga0530510_0043273 3300061734 Bacteria 3252
188 Ga0530510_0144157 3300061734 Unclassified 1756
189 2579857223 2579778521 Bacteria 7624758
190 2619853949 2619618881 Bacteria 7521104
191 2620353100 2619619003 Bacteria 7619552
192 2974306023 2974302888 Bacteria 4369871
193 Ga0501075_0234681
194 Ga0070690_100093749
195 Ga0070690_100131143
196 Ga0070682_100663151
197 Ga0070687_100332876
198 Ga0070669_100400195
199 Ga0070675_100050053
200 Ga0070673_100298127
201 Ga0070688_100022732
202 Ga0070701_10111954
203 Ga0070701_10311442
204 Ga0070700_100485751
205 Ga0070700_101042809
206 Ga0070708_100548860
207 Ga0070708_100554874
208 Ga0070681_10055148
209 Ga0070699_100010061
210 Ga0070699_100475419
211 Ga0070679_100250849
212 Ga0070686_100174722
213 Ga0070704_100436857
214 Ga0070664_100028403
215 Ga0068857_100101732
216 Ga0068856_101010740
217 Ga0070702_100118453
218 Ga0068859_100071870
219 Ga0068859_100284059
220 Ga0068859_100614250
221 Ga0068864_100099193
222 Ga0068864_100123689
223 Ga0068861_101746256
224 Ga0068863_100260120
225 Ga0068858_100168055
226 Ga0068860_100428507
227 Ga0068862_100123064
228 Ga0081455_10209792
229 Ga0081540_1005642
230 Ga0075365_10030353
231 Ga0068871_100281098
232 Ga0075428_100176058
233 Ga0075428_100249557
234 Ga0075433_10251210
235 Ga0075434_100123589
236 Ga0068865_100452092
237 Ga0097620_100071865
238 Ga0097620_100284052
239 Ga0097620_100614236
240 Ga0075435_100049259
241 Ga0111539_10014954
242 Ga0105245_10189246
243 Ga0114129_10035196
244 Ga0114129_10172274
245 Ga0114129_10216804
246 Ga0114129_10737714
247 Ga0105248_10962519
248 Ga0105248_10977134
249 Ga0105239_11621861
250 Ga0105246_10783988
251 Ga0157374_10656356
252 Ga0157375_10041522
253 Ga0157375_11007818
254 Ga0163163_10061722
255 Ga0163163_10062205
256 Ga0157380_10506351
257 Ga0157377_10024720
258 Ga0157379_10032783
259 Ga0207688_10079751
260 Ga0207688_10344696
261 Ga0207707_10076146
262 Ga0207662_10312861
263 Ga0207662_10351128
264 Ga0207659_10097994
265 Ga0207679_10133764
266 Ga0207679_10390854
267 Ga0207668_10887290
268 Ga0207703_10275871
269 Ga0207641_10158325
270 Ga0207676_10040543
271 Ga0207676_10226218
272 Ga0207674_10123041
273 Ga0207675_100555841
274 Ga0207428_10232353
275 Ga0268265_10696824
276 Ga0268264_10319465
277 Ga0268264_11081477
278 Ga0265334_10035093
279 Ga0265336_10107106
280 Ga0265338_10278316
281 Ga0265320_10070118
282 Ga0265320_10127479
283 Ga0265316_10016761
284 Ga0265316_10280197
285 Ga0307413_10212376
286 Ga0307414_10025751
287 Ga0373960_0143339
288 Ga0395905_0471170
289 Ga0395901_0832836
290 Ga0436365_1745065
291 Ga0436363_1393177
292 Ga0451793_1279868
293 Ga0451853_3851688
294 Ga0450909_029377
295 Ga0439435_0029529
296 Ga0439459_0069858
297 Ga0453684_0732951
298 Ga0466967_0442999
299 Ga0495580_0014606
300 Ga0495594_0341360
301 Ga0495630_0733072
302 Ga0495646_0254427
303 Ga0495674_0577990
304 Ga0495676_0106491
305 Ga0496104_0128715
306 Ga0496104_0734117
307 Ga0496108_0658303
308 Ga0496108_0902548
309 Ga0496109_0067606
310 Ga0496112_0152135
311 Ga0496112_0181163
312 Ga0496113_0128043
313 Ga0496114_0560491
314 Ga0501031_0062385
315 Ga0501032_0099980
316 Ga0501033_0108148
317 Ga0501037_0066500
318 Ga0501038_0123865
319 Ga0501038_0310743
320 Ga0501038_0406351
321 Ga0501039_0240231
322 Ga0501039_0449611
323 Ga0501040_0197655
324 Ga0501040_0236342
325 Ga0501040_0634327
326 Ga0501041_0043807
327 Ga0501041_0334572
328 Ga0501042_0186205
329 Ga0501042_0376860
330 Ga0501048_0034924
331 Ga0501048_0082793
332 Ga0501067_0296288
333 Ga0501068_0021109
334 Ga0501070_0143629
335 Ga0501071_0004813
336 Ga0501071_0036900
337 Ga0501071_0222895
338 Ga0501071_0670184
339 Ga0501071_0710545
340 Ga0501072_0020097
341 Ga0501072_0080253
342 Ga0501072_0574263
343 Ga0501073_0249427
344 Ga0501074_0047041
345 Ga0501075_0189936
346 Ga0501075_0292968
347 Ga0501075_0450450
348 Ga0501076_0019396
349 Ga0501076_0036308
350 Ga0501076_0080001
351 Ga0501076_0298070
352 Ga0501077_0027923
353 Ga0501077_0226269
354 Ga0501079_0054034
355 Ga0501079_0127892
356 Ga0501080_0165146
357 Ga0501080_0466298
358 Ga0501081_0310263
359 Ga0501083_0099476
360 Ga0501035_0147833
361 Ga0501035_0767062
362 Ga0501045_0175943
363 Ga0501045_0236755
364 nmdc:mga05p37_113903_c1
365 nmdc:mga05p37_13867_c2
366 nmdc:mga05p37_416554_c1
367 nmdc:mga08y16_221267_c1
368 nmdc:mga08y16_42714_c1
369 nmdc:mga0rr50_81892_c1
370 nmdc:mga0a205_239707_c1
371 Ga0501084_0069121
372 Ga0501084_0342355
373 Ga0501084_1220937
374 Ga0590071_004666
375 Ga0590075_002707
376 Ga0501082_0096950
377 Ga0501082_0192119
378 Ga0501082_0219390
379 Ga0530510_0043273
380 Ga0530510_0144157
381 2579857223
382 2619853949
383 2620353100
384 2974306023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

21

198

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8691 7 190
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8406 8 192
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8359 8 192
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8318 7 190
3igq-assembly2.cif.gz_F-3 crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion channel 0.8217 167 191
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8475 9 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8374 9 189 3.40.430.10
af_F7FH45_6_315_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8356 172 190 1.10.510.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8344 8 193 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8161 8 193 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A5Q0NVV4-F1-model_v4 Dihydrofolate reductase 0.9662 7 193 GO:0008703
GO:0009231
AF-A0A7V9MIQ6-F1-model_v4 Dihydrofolate reductase family protein 0.9654 106 192 GO:0008703
GO:0009231
AF-A0A7W0SZC9-F1-model_v4 Dihydrofolate reductase family protein 0.9651 130 193 GO:0008703
GO:0009231
AF-A0A363T0S4-F1-model_v4 Deaminase 0.9626 7 191 GO:0008703
GO:0009231
AF-A0A5Q0NVV4-F1-model_v4 Dihydrofolate reductase 0.9612 7 193 GO:0008703
GO:0009231

Map