F296105

General Info

Members Datasets Scaffolds Average Seq Length
192 141 158 158

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0263532|Ga0495629_0263532_42_596
Length 184
Sequence MADDWRTDRIGSALRGENPAVLRRLDAGFAVIGDVQFLPGYTVLLVDEPGVERLSELPRAKRLAFLTDMDRLAEAVERACRRADPAFRRVNLEILGNTDGFLHAHVWPRYEWEPADLVRGPVWLYPRERWSDERFALGPRHDELRSAIAAELERTVSDQAPGGGPAGQLVAVGELELAQDRRDV

Samples

Sample ID Description Type Environment
1 2643221548 Streptomyces sp. Root55 Isolate Unclassified
2 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
3 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
4 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
5 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
6 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
7 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
8 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
9 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
10 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
11 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
12 2808606448 Streptomyces sp. 193411 Isolate Unclassified
13 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
14 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
15 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
16 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
17 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
18 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
19 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
20 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
21 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
22 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
23 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
24 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
25 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
26 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
27 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
28 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
46 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
95 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
128 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
129 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
130 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
131 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
132 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
133 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
137 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
138 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
139 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
140 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
141 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.77
Metatranscriptomes 0.52
Isolates 17.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 1.04
Rhizoplane 0.52
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_101024624 3300005331 Bacteria 751
2 Ga0070681_10309474 3300005458 Bacteria 1489
3 Ga0070665_100043086 3300005548 Bacteria 4537
4 Ga0075364_10083159 3300006051 Bacteria 2118
5 Ga0157376_10997532 3300014969 Bacteria 860
6 Ga0182007_10022351 3300015262 Bacteria 2235
7 Ga0206356_11523342 3300020070 Bacteria 1673
8 Ga0207707_10251257 3300025912 Bacteria 1536
9 Ga0268266_10076455 3300028379 Bacteria 2910
10 Ga0307515_10019601 3300028794 Bacteria 12155
11 Ga0307512_10030060 3300030522 Bacteria 4734
12 Ga0307513_10011199 3300031456 Bacteria 11165
13 Ga0307513_10493083 3300031456 Bacteria 943
14 Ga0307508_10046157 3300031616 Bacteria 3890
15 Ga0307516_10004371 3300031730 Bacteria 17487
16 Ga0307516_10023601 3300031730 Bacteria 6299
17 Ga0307415_100050303 3300032126 Bacteria 2823
18 Ga0307510_10323209 3300033180 Bacteria 999
19 Ga0373944_0021960 3300035089 Bacteria 1852
20 Ga0373946_0275577 3300035171 Bacteria 826
21 Ga0373935_0261824 3300035692 Bacteria 1213
22 Ga0373927_0146500 3300035695 Bacteria 1546
23 Ga0373947_0119854 3300035725 Bacteria 1670
24 Ga0395899_0239569 3300037312 Bacteria 1249
25 Ga0395898_0450993 3300037466 Bacteria 1225
26 Ga0395905_0818284 3300037471 Bacteria 834
27 Ga0395905_0860330 3300037471 Bacteria 810
28 Ga0395901_0238076 3300038443 Bacteria 1899
29 Ga0395901_0293743 3300038443 Bacteria 1686
30 Ga0395901_1144383 3300038443 Bacteria 747
31 Ga0439436_0002007 3300041404 Bacteria 6045
32 Ga0439436_0017769 3300041404 Bacteria 2128
33 Ga0439439_0015562 3300041406 Bacteria 1859
34 Ga0439439_0035298 3300041406 Bacteria 1284
35 Ga0451793_0112773 3300041452 Bacteria 614
36 Ga0451853_1179790 3300041512 Bacteria 4153
37 Ga0439442_129333 3300042002 Bacteria 555
38 Ga0439449_0003550 3300042007 Bacteria 6058
39 Ga0439449_0006052 3300042007 Bacteria 4623
40 Ga0439449_0206231 3300042007 Bacteria 736
41 Ga0439457_000499 3300042014 Bacteria 11375
42 Ga0439457_001220 3300042014 Bacteria 7739
43 Ga0450903_017914 3300042138 Bacteria 1105
44 Ga0466969_0047442 3300044656 Bacteria 2126
45 Ga0466972_0000528 3300044658 Bacteria 18820
46 Ga0466972_0084071 3300044658 Bacteria 1513
47 Ga0466965_0001137 3300044683 Bacteria 10432
48 Ga0466965_0114626 3300044683 Bacteria 1388
49 Ga0466966_0004525 3300044684 Bacteria 9171
50 Ga0466966_0009024 3300044684 Bacteria 6608
51 Ga0466961_0007794 3300044693 Bacteria 6814
52 Ga0466961_0504431 3300044693 Bacteria 730
53 Ga0466963_0003379 3300044694 Bacteria 9117
54 Ga0466971_0000985 3300044719 Bacteria 11737
55 Ga0466968_0097194 3300044735 Bacteria 1312
56 Ga0466970_0002508 3300044765 Bacteria 8851
57 Ga0466970_0004811 3300044765 Bacteria 6670
58 Ga0466970_0449720 3300044765 Bacteria 738
59 Ga0466957_0008512 3300044842 Bacteria 5837
60 Ga0466959_0000367 3300045049 Bacteria 26707
61 Ga0466959_0058705 3300045049 Bacteria 2802
62 Ga0466958_0085601 3300045836 Bacteria 1944
63 Ga0466958_0621412 3300045836 Bacteria 703
64 Ga0466967_0224682 3300045976 Bacteria 1786
65 Ga0466967_0456310 3300045976 Bacteria 1250
66 Ga0495629_0001029 3300046459 Bacteria 22347
67 Ga0495629_0041301 3300046459 Bacteria 3246
68 Ga0495629_0263532 3300046459 Bacteria 1184
69 Ga0495629_0317682 3300046459 Bacteria 1065
70 Ga0495629_0406257 3300046459 Bacteria 925
71 Ga0495651_0130374 3300046462 Bacteria 1836
72 Ga0495582_0039658 3300046473 Bacteria 2593
73 Ga0495662_0009464 3300046476 Bacteria 4779
74 Ga0495662_0071814 3300046476 Bacteria 1677
75 Ga0495594_0001997 3300046499 Bacteria 10635
76 Ga0495618_0178614 3300046514 Bacteria 1349
77 Ga0495628_0021197 3300046516 Bacteria 5350
78 Ga0495643_0238871 3300046522 Bacteria 853
79 Ga0495652_0184227 3300046529 Bacteria 1599
80 Ga0495622_0007724 3300046557 Bacteria 4996
81 Ga0495635_0050598 3300046663 Bacteria 2864
82 Ga0495588_0002502 3300046674 Bacteria 7873
83 Ga0495657_0001275 3300046675 Bacteria 21897
84 Ga0495613_0001452 3300046689 Bacteria 18068
85 Ga0495613_0031131 3300046689 Bacteria 3963
86 Ga0495613_0088403 3300046689 Bacteria 2245
87 Ga0495613_0218055 3300046689 Bacteria 1340
88 Ga0495600_0093110 3300046809 Bacteria 1965
89 Ga0495581_0084365 3300047315 Bacteria 1841
90 Ga0495604_0184101 3300047317 Bacteria 1460
91 Ga0495680_0000803 3300047322 Bacteria 35020
92 Ga0495687_001932 3300047443 Bacteria 17754
93 Ga0495687_019078 3300047443 Bacteria 3374
94 Ga0495685_058452 3300047447 Bacteria 1301
95 Ga0495614_0277371 3300048089 Bacteria 771
96 Ga0501031_0100064 3300049568 Bacteria 1892
97 Ga0501031_0163875 3300049568 Bacteria 1453
98 Ga0501031_0287056 3300049568 Bacteria 1067
99 Ga0501032_0130094 3300049569 Bacteria 1661
100 Ga0501033_0001630 3300049570 Bacteria 19706
101 Ga0501033_0015942 3300049570 Bacteria 5693
102 Ga0501034_0002548 3300049571 Bacteria 21746
103 Ga0501034_0022541 3300049571 Bacteria 6417
104 Ga0501036_0014468 3300049572 Bacteria 6572
105 Ga0501036_0367715 3300049572 Bacteria 1200
106 Ga0501037_0366692 3300049573 Bacteria 991
107 Ga0501037_0589361 3300049573 Bacteria 747
108 Ga0501038_0053148 3300049574 Bacteria 3489
109 Ga0501038_0701519 3300049574 Bacteria 758
110 Ga0501039_0133511 3300049575 Bacteria 1948
111 Ga0501039_0152335 3300049575 Bacteria 1816
112 Ga0501040_0028554 3300049576 Bacteria 3762
113 Ga0501042_0165726 3300049578 Bacteria 1594
114 Ga0501043_0001841 3300049579 Bacteria 18183
115 Ga0501043_0194959 3300049579 Bacteria 1574
116 Ga0501047_0056896 3300049581 Bacteria 3782
117 Ga0501047_0227396 3300049581 Bacteria 1720
118 Ga0501047_0271293 3300049581 Bacteria 1543
119 Ga0501047_0363271 3300049581 Bacteria 1283
120 Ga0501048_0166283 3300049582 Bacteria 1562
121 Ga0501048_0312631 3300049582 Bacteria 1119
122 Ga0501068_0171035 3300049584 Bacteria 1371
123 Ga0501069_0320256 3300049585 Bacteria 911
124 Ga0501070_0001946 3300049586 Bacteria 18227
125 Ga0501070_0030971 3300049586 Bacteria 4481
126 Ga0501070_0078609 3300049586 Bacteria 2730
127 Ga0501070_0204524 3300049586 Bacteria 1621
128 Ga0501071_0208230 3300049587 Bacteria 1470
129 Ga0501071_0214420 3300049587 Bacteria 1448
130 Ga0501072_0442646 3300049588 Bacteria 1029
131 Ga0501074_0025195 3300049590 Bacteria 4321
132 Ga0501074_0685664 3300049590 Bacteria 723
133 Ga0501075_0085963 3300049591 Bacteria 2383
134 Ga0501075_1294700 3300049591 Bacteria 552
135 Ga0501076_0683863 3300049592 Bacteria 847
136 Ga0501077_0399146 3300049593 Bacteria 879
137 Ga0501079_0405414 3300049741 Bacteria 1069
138 Ga0501079_0790326 3300049741 Bacteria 747
139 Ga0501080_0577904 3300049742 Bacteria 999
140 Ga0501081_0392549 3300049743 Bacteria 1027
141 Ga0501035_0011752 3300049822 Bacteria 8109
142 Ga0501035_0211075 3300049822 Bacteria 1661
143 Ga0501044_0002960 3300049823 Bacteria 19316
144 Ga0501045_0068395 3300049824 Bacteria 2609
145 Ga0501045_0093563 3300049824 Bacteria 2223
146 nmdc:mga00v17_59209_c1 3300050491 Bacteria 2349
147 Ga0500566_0028826 3300053094 Bacteria 3242
148 Ga0500641_0140304 3300053096 Bacteria 1044
149 Ga0500660_046196 3300053100 Bacteria 2183
150 Ga0500560_121445 3300053107 Bacteria 876
151 Ga0500569_047620 3300053109 Bacteria 1282
152 Ga0500614_038547 3300053123 Bacteria 1204
153 Ga0500579_123682 3300053143 Bacteria 1242
154 Ga0500589_322768 3300053147 Bacteria 539
155 Ga0500600_0020605 3300053149 Bacteria 3964
156 Ga0501082_0199943 3300060353 Bacteria 1739
157 Ga0466962_0005445 3300061719 Bacteria 6116
158 Ga0466962_0104421 3300061719 Bacteria 1361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0015942 Ga0501033_0015942_520_999 138
2 3300049571 Ga0501034_0002548 Ga0501034_0002548_16714_17193 138
3 3300049572 Ga0501036_0014468 Ga0501036_0014468_4609_5088 138
4 3300049573 Ga0501037_0589361 Ga0501037_0589361_212_691 138
5 3300049574 Ga0501038_0053148 Ga0501038_0053148_1180_1659 138
6 3300049575 Ga0501039_0133511 Ga0501039_0133511_1234_1713 138
7 3300049579 Ga0501043_0001841 Ga0501043_0001841_4608_5087 138
8 3300049581 Ga0501047_0227396 Ga0501047_0227396_390_869 138
9 3300049584 Ga0501068_0171035 Ga0501068_0171035_818_1297 138
10 3300049586 Ga0501070_0001946 Ga0501070_0001946_4665_5144 138
11 3300049590 Ga0501074_0025195 Ga0501074_0025195_168_647 138
12 3300049822 Ga0501035_0011752 Ga0501035_0011752_2943_3422 138
13 3300044765 Ga0466970_0449720 Ga0466970_0449720_12_467 143
14 3300041512 Ga0451853_1179790 Ga0451853_1179790_487_972 146
15 3300037312 Ga0395899_0239569 Ga0395899_0239569_648_1127 150
16 3300037471 Ga0395905_0818284 Ga0395905_0818284_323_802 150
17 3300038443 Ga0395901_0238076 Ga0395901_0238076_1117_1596 150
18 3300044683 Ga0466965_0114626 Ga0466965_0114626_128_616 150
19 iso_pu_bacteria 8057568493 8057571320 151
20 3300049586 Ga0501070_0078609 Ga0501070_0078609_1287_1748 152
21 3300014969 Ga0157376_10997532 Ga0157376_109975321 153
22 3300020070 Ga0206356_11523342 Ga0206356_115233422 153
23 3300028794 Ga0307515_10019601 Ga0307515_100196015 153
24 3300030522 Ga0307512_10030060 Ga0307512_100300602 153
25 3300031456 Ga0307513_10011199 Ga0307513_100111997 153
26 3300031616 Ga0307508_10046157 Ga0307508_100461576 153
27 3300033180 Ga0307510_10323209 Ga0307510_103232091 153
28 3300041452 Ga0451793_0112773 Ga0451793_0112773_140_601 153
29 3300046459 Ga0495629_0317682 Ga0495629_0317682_502_963 153
30 3300049568 Ga0501031_0163875 Ga0501031_0163875_906_1373 153
31 3300049574 Ga0501038_0701519 Ga0501038_0701519_169_636 153
32 3300049575 Ga0501039_0152335 Ga0501039_0152335_551_1018 153
33 3300049576 Ga0501040_0028554 Ga0501040_0028554_1595_2062 153
34 3300049582 Ga0501048_0312631 Ga0501048_0312631_249_716 153
35 3300049586 Ga0501070_0030971 Ga0501070_0030971_2203_2664 153
36 3300049587 Ga0501071_0214420 Ga0501071_0214420_626_1093 153
37 3300049588 Ga0501072_0442646 Ga0501072_0442646_88_555 153
38 3300049590 Ga0501074_0685664 Ga0501074_0685664_174_641 153
39 3300049591 Ga0501075_1294700 Ga0501075_1294700_69_536 153
40 3300049592 Ga0501076_0683863 Ga0501076_0683863_116_583 153
41 3300049593 Ga0501077_0399146 Ga0501077_0399146_300_767 153
42 3300049741 Ga0501079_0790326 Ga0501079_0790326_136_603 153
43 3300049742 Ga0501080_0577904 Ga0501080_0577904_84_551 153
44 3300049824 Ga0501045_0068395 Ga0501045_0068395_726_1193 153
45 3300053096 Ga0500641_0140304 Ga0500641_0140304_239_703 153
46 3300053109 Ga0500569_047620 Ga0500569_047620_521_985 153
47 3300053147 Ga0500589_322768 Ga0500589_322768_52_516 153
48 iso_pu_bacteria 2643221548 2643766093 153
49 iso_pu_bacteria 2643221601 2644015555 153
50 iso_pu_bacteria 2643221631 2644176960 153
51 iso_pu_bacteria 2643221682 2644463550 153
52 iso_pu_bacteria 2808606375 2808916285 153
53 iso_pu_bacteria 2870721527 2870728027 153
54 iso_pu_bacteria 2995463766 2995464217 153
55 3300005548 Ga0070665_100043086 Ga0070665_1000430863 154
56 3300028379 Ga0268266_10076455 Ga0268266_100764552 154
57 3300038443 Ga0395901_1144383 Ga0395901_1144383_115_588 154
58 3300044658 Ga0466972_0084071 Ga0466972_0084071_515_985 154
59 3300044683 Ga0466965_0001137 Ga0466965_0001137_3198_3668 154
60 3300044684 Ga0466966_0009024 Ga0466966_0009024_576_1046 154
61 3300044693 Ga0466961_0007794 Ga0466961_0007794_6274_6744 154
62 3300044694 Ga0466963_0003379 Ga0466963_0003379_7067_7537 154
63 3300044719 Ga0466971_0000985 Ga0466971_0000985_468_938 154
64 3300044765 Ga0466970_0002508 Ga0466970_0002508_1493_1963 154
65 3300044842 Ga0466957_0008512 Ga0466957_0008512_4952_5422 154
66 3300045049 Ga0466959_0000367 Ga0466959_0000367_9653_10123 154
67 3300045836 Ga0466958_0085601 Ga0466958_0085601_1033_1503 154
68 3300045976 Ga0466967_0456310 Ga0466967_0456310_189_659 154
69 3300049568 Ga0501031_0100064 Ga0501031_0100064_1017_1484 154
70 3300049569 Ga0501032_0130094 Ga0501032_0130094_425_892 154
71 3300049572 Ga0501036_0367715 Ga0501036_0367715_584_1051 154
72 3300049573 Ga0501037_0366692 Ga0501037_0366692_442_909 154
73 3300049578 Ga0501042_0165726 Ga0501042_0165726_343_810 154
74 3300049585 Ga0501069_0320256 Ga0501069_0320256_29_496 154
75 3300049586 Ga0501070_0204524 Ga0501070_0204524_653_1117 154
76 3300049587 Ga0501071_0208230 Ga0501071_0208230_512_979 154
77 3300049591 Ga0501075_0085963 Ga0501075_0085963_1724_2191 154
78 3300049741 Ga0501079_0405414 Ga0501079_0405414_187_654 154
79 3300049743 Ga0501081_0392549 Ga0501081_0392549_538_1005 154
80 3300049824 Ga0501045_0093563 Ga0501045_0093563_392_859 154
81 3300060353 Ga0501082_0199943 Ga0501082_0199943_491_958 154
82 3300061719 Ga0466962_0005445 Ga0466962_0005445_587_1057 154
83 iso_pu_bacteria 2811994879 2812358110 154
84 iso_pu_bacteria 2852635781 2852636677 154
85 iso_pu_bacteria 2946064051 2946067733 154
86 iso_pu_bacteria 2990059506 2990067617 154
87 3300005458 Ga0070681_10309474 Ga0070681_103094742 155
88 3300025912 Ga0207707_10251257 Ga0207707_102512572 155
89 3300031730 Ga0307516_10004371 Ga0307516_100043716 155
90 3300031730 Ga0307516_10023601 Ga0307516_100236016 155
91 3300041404 Ga0439436_0002007 Ga0439436_0002007_2960_3436 155
92 3300041406 Ga0439439_0015562 Ga0439439_0015562_75_551 155
93 3300042002 Ga0439442_129333 Ga0439442_129333_64_540 155
94 3300042007 Ga0439449_0006052 Ga0439449_0006052_1481_1957 155
95 3300042014 Ga0439457_000499 Ga0439457_000499_4097_4573 155
96 3300044765 Ga0466970_0004811 Ga0466970_0004811_5283_5756 155
97 3300053149 Ga0500600_0020605 Ga0500600_0020605_1383_1853 155
98 iso_pu_bacteria 2751185734 2753069491 155
99 iso_pu_bacteria 2784132148 2784592705 155
100 iso_pu_bacteria 2784746763 2785342615 155
101 iso_pu_bacteria 2791355406 2793981740 155
102 iso_pu_bacteria 2802429296 2804848830 155
103 iso_pu_bacteria 2808606448 2809233745 155
104 iso_pu_bacteria 2808606982 2811846182 155
105 iso_pu_bacteria 2862178590 2862180756 155
106 iso_pu_bacteria 2873151551 2873158589 155
107 iso_pu_bacteria 2912715099 2912716770 155
108 iso_pu_bacteria 2954701450 2954709461 155
109 iso_pu_bacteria 2997600082 2997608627 155
110 iso_pu_bacteria 8025413630 8025417448 155
111 iso_pu_bacteria 8048356638 8048365768 155
112 iso_pu_bacteria 8048406513 8048410409 155
113 iso_pu_bacteria 8056829672 8056830704 155
114 3300031456 Ga0307513_10493083 Ga0307513_104930832 156
115 3300046459 Ga0495629_0001029 Ga0495629_0001029_9482_9958 156
116 3300046459 Ga0495629_0406257 Ga0495629_0406257_282_758 156
117 3300046499 Ga0495594_0001997 Ga0495594_0001997_1761_2237 156
118 3300046557 Ga0495622_0007724 Ga0495622_0007724_4300_4776 156
119 3300046674 Ga0495588_0002502 Ga0495588_0002502_592_1068 156
120 3300046689 Ga0495613_0218055 Ga0495613_0218055_545_1021 156
121 3300053123 Ga0500614_038547 Ga0500614_038547_217_693 156
122 3300053143 Ga0500579_123682 Ga0500579_123682_406_879 156
123 iso_pu_bacteria 2918501144 2918502071 156
124 3300006051 Ga0075364_10083159 Ga0075364_100831592 157
125 3300015262 Ga0182007_10022351 Ga0182007_100223513 157
126 3300037466 Ga0395898_0450993 Ga0395898_0450993_71_550 157
127 3300037471 Ga0395905_0860330 Ga0395905_0860330_186_665 157
128 3300038443 Ga0395901_0293743 Ga0395901_0293743_700_1179 157
129 3300041404 Ga0439436_0017769 Ga0439436_0017769_1299_1781 157
130 3300041406 Ga0439439_0035298 Ga0439439_0035298_33_515 157
131 3300042007 Ga0439449_0003550 Ga0439449_0003550_502_981 157
132 3300042007 Ga0439449_0206231 Ga0439449_0206231_102_584 157
133 3300042014 Ga0439457_001220 Ga0439457_001220_6686_7168 157
134 3300042138 Ga0450903_017914 Ga0450903_017914_365_853 157
135 3300044656 Ga0466969_0047442 Ga0466969_0047442_569_1051 157
136 3300044658 Ga0466972_0000528 Ga0466972_0000528_9115_9597 157
137 3300044684 Ga0466966_0004525 Ga0466966_0004525_5200_5682 157
138 3300044693 Ga0466961_0504431 Ga0466961_0504431_104_586 157
139 3300044735 Ga0466968_0097194 Ga0466968_0097194_380_862 157
140 3300045049 Ga0466959_0058705 Ga0466959_0058705_887_1369 157
141 3300045836 Ga0466958_0621412 Ga0466958_0621412_70_549 157
142 3300045976 Ga0466967_0224682 Ga0466967_0224682_878_1357 157
143 3300046459 Ga0495629_0041301 Ga0495629_0041301_327_806 157
144 3300046459 Ga0495629_0263532 Ga0495629_0263532_42_596 157
145 3300046462 Ga0495651_0130374 Ga0495651_0130374_719_1198 157
146 3300046473 Ga0495582_0039658 Ga0495582_0039658_1620_2099 157
147 3300046476 Ga0495662_0009464 Ga0495662_0009464_4056_4535 157
148 3300046476 Ga0495662_0071814 Ga0495662_0071814_1141_1620 157
149 3300046514 Ga0495618_0178614 Ga0495618_0178614_735_1214 157
150 3300046516 Ga0495628_0021197 Ga0495628_0021197_1179_1658 157
151 3300046529 Ga0495652_0184227 Ga0495652_0184227_86_565 157
152 3300046663 Ga0495635_0050598 Ga0495635_0050598_890_1369 157
153 3300046675 Ga0495657_0001275 Ga0495657_0001275_7304_7783 157
154 3300046689 Ga0495613_0001452 Ga0495613_0001452_3891_4370 157
155 3300046689 Ga0495613_0031131 Ga0495613_0031131_1611_2090 157
156 3300046689 Ga0495613_0088403 Ga0495613_0088403_1549_2028 157
157 3300046809 Ga0495600_0093110 Ga0495600_0093110_1118_1597 157
158 3300047315 Ga0495581_0084365 Ga0495581_0084365_827_1306 157
159 3300047317 Ga0495604_0184101 Ga0495604_0184101_165_644 157
160 3300047322 Ga0495680_0000803 Ga0495680_0000803_20228_20707 157
161 3300047443 Ga0495687_019078 Ga0495687_019078_1564_2118 157
162 3300048089 Ga0495614_0277371 Ga0495614_0277371_199_678 157
163 3300049568 Ga0501031_0287056 Ga0501031_0287056_130_609 157
164 3300049570 Ga0501033_0001630 Ga0501033_0001630_1359_1838 157
165 3300049571 Ga0501034_0022541 Ga0501034_0022541_3116_3595 157
166 3300049579 Ga0501043_0194959 Ga0501043_0194959_604_1110 157
167 3300049581 Ga0501047_0056896 Ga0501047_0056896_813_1292 157
168 3300049581 Ga0501047_0271293 Ga0501047_0271293_456_935 157
169 3300049581 Ga0501047_0363271 Ga0501047_0363271_720_1199 157
170 3300049582 Ga0501048_0166283 Ga0501048_0166283_188_667 157
171 3300049822 Ga0501035_0211075 Ga0501035_0211075_864_1343 157
172 3300049823 Ga0501044_0002960 Ga0501044_0002960_405_932 157
173 3300050491 nmdc:mga00v17_59209_c1 nmdc:mga00v17_59209_c1_1389_1868 157
174 3300053094 Ga0500566_0028826 Ga0500566_0028826_1248_1802 157
175 3300053100 Ga0500660_046196 Ga0500660_046196_1368_1922 157
176 3300053107 Ga0500560_121445 Ga0500560_121445_296_850 157
177 3300061719 Ga0466962_0104421 Ga0466962_0104421_671_1150 157
178 iso_pu_bacteria 2862382967 2862387057 157
179 iso_pu_bacteria 2935390628 2935396935 157
180 iso_pu_bacteria 2990088156 2990093608 157
181 iso_pu_bacteria 8008558824 8008565712 157
182 3300035089 Ga0373944_0021960 Ga0373944_0021960_1296_1787 158
183 3300035171 Ga0373946_0275577 Ga0373946_0275577_216_707 158
184 3300035692 Ga0373935_0261824 Ga0373935_0261824_43_534 158
185 3300035695 Ga0373927_0146500 Ga0373927_0146500_187_678 158
186 3300035725 Ga0373947_0119854 Ga0373947_0119854_348_839 158
187 iso_pu_bacteria 2767802112 2768643583 159
188 3300005331 Ga0070670_101024624 Ga0070670_1010246241 161
189 3300032126 Ga0307415_100050303 Ga0307415_1000503032 161
190 3300046522 Ga0495643_0238871 Ga0495643_0238871_212_745 161
191 3300047443 Ga0495687_001932 Ga0495687_001932_4583_5116 161
192 3300047447 Ga0495685_058452 Ga0495685_058452_55_588 161

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohe-assembly1.cif.gz_B crystal structure of a histidine triad protein (maqu_1709) from marinobacter aquaeolei vt8 at 1.20 a resolution 0.8745 19 153
3i24-assembly1.cif.gz_B crystal structure of a hit family hydrolase protein from vibrio fischeri. northeast structural genomics consortium target id vfr176 0.8513 19 154
6fit-assembly1.cif.gz_A-2 fhit-transition state analog 0.8424 18 111
3fit-assembly1.cif.gz_A-2 fhit (fragile histidine triad protein) in complex with adenosine/sulfate amp analog 0.8403 18 111
3i4s-assembly1.cif.gz_B crystal structure of histidine triad protein blr8122 from bradyrhizobium japonicum 0.8307 19 150
ID Description Score Start End Superfamily
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8532 18 111 3.30.428.10
3i24B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8513 19 154 3.30.428.10
3oheB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8337 19 153 3.30.428.10
3i4sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8307 19 150 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8248 18 148 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A316HW08-F1-model_v4 Diadenosine tetraphosphate (Ap4A) HIT family hydrolase 0.9917 1 153 GO:0016787
AF-A0A4Q5JC97-F1-model_v4 Diadenosine tetraphosphate hydrolase 0.9915 2 153 GO:0016787
AF-A0A2A3YDD1-F1-model_v4 Diadenosine tetraphosphate hydrolase 0.9913 2 155 GO:0016787
AF-A0A4Y9FXF7-F1-model_v4 Diadenosine tetraphosphate hydrolase 0.99 1 156 GO:0016787
AF-A0A2N9JFG4-F1-model_v4 Diadenosine tetraphosphate (Ap4A) hydrolase (Modular protein) 0.9896 2 156 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map