F295444

General Info

Members Datasets Scaffolds Average Seq Length
192 124 384 242

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10032446|Ga0075365_100324464
Length 239
Sequence LDRLTPAVISPVEQRAPGRWQIGTVTQIKRETPHVKSFRIELPMWVPHLPGQHYDVRLTAPDGYRAQRSYSIASSPLDEGEVELTIDRSPYFHDVVVEGDQVELRGPFASYFVWHGEEPVLLVGGGSGVVPLMAMLRHRRRTMPDLPMRLVYSVRTADDVIYADELGDDAVVTYTREPPDGWQGHTGRVDEAFIGTALMPMATAFVCGSNGFVEAASRLLLDAGVDPSRIRTERFGPTG

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
68 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
74 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
121 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 0
Rhizoplane 2.6
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10032446 3300006038 Bacteria 3357
2 JGI25407J50210_10020780 3300003373 Bacteria 1706
3 JGI25407J50210_10043722 3300003373 Bacteria 1144
4 JGI25407J50210_10056898 3300003373 Bacteria 985
5 Ga0070668_100258150 3300005347 Bacteria 1448
6 Ga0070674_100009328 3300005356 Bacteria 5874
7 Ga0070667_100000411 3300005367 Bacteria 45880
8 Ga0070663_100000139 3300005455 Bacteria 35134
9 Ga0068867_100553269 3300005459 Bacteria 997
10 Ga0070679_100006865 3300005530 Bacteria 10613
11 Ga0070665_100006597 3300005548 Bacteria 11795
12 Ga0068858_100250394 3300005842 Bacteria 1683
13 Ga0068860_100183913 3300005843 Bacteria 2020
14 Ga0068862_100031754 3300005844 Bacteria 4461
15 Ga0081455_10005335 3300005937 Bacteria 14116
16 Ga0081455_10304314 3300005937 Bacteria 1142
17 Ga0081455_10423836 3300005937 Bacteria 917
18 Ga0081538_10000018 3300005981 Bacteria 143542
19 Ga0081538_10001081 3300005981 Bacteria 29003
20 Ga0081538_10002046 3300005981 Bacteria 20129
21 Ga0081538_10011391 3300005981 Bacteria 7205
22 Ga0081538_10011623 3300005981 Bacteria 7117
23 Ga0081538_10017827 3300005981 Bacteria 5366
24 Ga0081538_10062333 3300005981 Bacteria 2127
25 Ga0075365_10016761 3300006038 Bacteria 4466
26 Ga0075365_10038607 3300006038 Bacteria 3105
27 Ga0075365_10053466 3300006038 Bacteria 2675
28 Ga0075368_10028745 3300006042 Bacteria 2149
29 Ga0075363_100001203 3300006048 Bacteria 9553
30 Ga0075363_100046677 3300006048 Bacteria 2299
31 Ga0075363_100105187 3300006048 Bacteria 1565
32 Ga0075364_10025086 3300006051 Bacteria 3793
33 Ga0075364_10025894 3300006051 Bacteria 3738
34 Ga0075364_10079857 3300006051 Bacteria 2162
35 Ga0075428_100478628 3300006844 Bacteria 1333
36 Ga0075430_100003400 3300006846 Bacteria 13300
37 Ga0075430_100114067 3300006846 Bacteria 2252
38 Ga0075431_100002575 3300006847 Bacteria 17518
39 Ga0075431_100003260 3300006847 Bacteria 15714
40 Ga0075431_100004773 3300006847 Bacteria 13323
41 Ga0075434_100143494 3300006871 Bacteria 2408
42 Ga0075429_100620576 3300006880 Bacteria 947
43 Ga0068865_100385614 3300006881 Bacteria 1144
44 Ga0075435_100121155 3300007076 Bacteria 2183
45 Ga0111539_10004135 3300009094 Bacteria 19042
46 Ga0114129_10108263 3300009147 Bacteria 3837
47 Ga0114129_10234533 3300009147 Bacteria 2470
48 Ga0114129_11234821 3300009147 Bacteria 929
49 Ga0114129_11401023 3300009147 Bacteria 862
50 Ga0105243_10045280 3300009148 Bacteria 3456
51 Ga0105242_10583502 3300009176 Bacteria 1077
52 Ga0105238_10690332 3300009551 Bacteria 1033
53 Ga0105249_10000630 3300009553 Bacteria 32116
54 Ga0105239_10029309 3300010375 Bacteria 6052
55 Ga0157378_10410690 3300013297 Bacteria 1336
56 Ga0157379_10014741 3300014968 Bacteria 6857
57 Ga0157376_10023197 3300014969 Bacteria 4854
58 Ga0207699_10053356 3300025906 Bacteria 2397
59 Ga0207693_10073898 3300025915 Bacteria 2669
60 Ga0207693_10127335 3300025915 Bacteria 2002
61 Ga0207660_10224534 3300025917 Bacteria 1475
62 Ga0207652_10002019 3300025921 Bacteria 17497
63 Ga0207709_10379791 3300025935 Bacteria 1075
64 Ga0207669_10281845 3300025937 Bacteria 1254
65 Ga0207665_10030772 3300025939 Bacteria 3549
66 Ga0207712_10144775 3300025961 Bacteria 1828
67 Ga0207668_10012704 3300025972 Bacteria 5164
68 Ga0207668_10249660 3300025972 Bacteria 1440
69 Ga0207658_10023377 3300025986 Bacteria 4314
70 Ga0207658_10073238 3300025986 Bacteria 2599
71 Ga0207703_10221860 3300026035 Bacteria 1691
72 Ga0207678_10001348 3300026067 Bacteria 22636
73 Ga0207648_10505585 3300026089 Bacteria 1106
74 Ga0207428_10103010 3300027907 Bacteria 2204
75 Ga0268266_10000614 3300028379 Bacteria 48613
76 Ga0268264_10266734 3300028381 Bacteria 1598
77 Ga0307408_100232490 3300031548 Bacteria 1511
78 Ga0307405_10254332 3300031731 Bacteria 1309
79 Ga0307405_10338613 3300031731 Bacteria 1156
80 Ga0307413_10327124 3300031824 Bacteria 1173
81 Ga0307413_10503103 3300031824 Bacteria 973
82 Ga0307410_10081615 3300031852 Bacteria 2272
83 Ga0307410_10556275 3300031852 Bacteria 951
84 Ga0307406_10043584 3300031901 Bacteria 2807
85 Ga0307407_10004689 3300031903 Bacteria 5839
86 Ga0307407_10136766 3300031903 Bacteria 1575
87 Ga0307407_10400646 3300031903 Bacteria 984
88 Ga0307412_10121559 3300031911 Bacteria 1881
89 Ga0307409_100004724 3300031995 Bacteria 7713
90 Ga0307409_100176909 3300031995 Bacteria 1884
91 Ga0307409_100676701 3300031995 Bacteria 1029
92 Ga0307416_100140035 3300032002 Bacteria 2197
93 Ga0307411_10014634 3300032005 Bacteria 4374
94 Ga0307415_100455778 3300032126 Bacteria 1107
95 Ga0307415_100569769 3300032126 Bacteria 1002
96 Ga0395900_0137337 3300037418 Bacteria 2505
97 Ga0395900_0261370 3300037418 Bacteria 1729
98 Ga0395898_0088250 3300037466 Bacteria 2986
99 Ga0395898_0606581 3300037466 Bacteria 1037
100 Ga0395905_0179613 3300037471 Bacteria 1987
101 Ga0395901_0010169 3300038443 Bacteria 9532
102 Ga0395901_0019171 3300038443 Bacteria 6994
103 Ga0395901_0243129 3300038443 Bacteria 1877
104 Ga0451853_0057597 3300041512 Bacteria 5740
105 Ga0495641_0145665 3300046461 Bacteria 1058
106 Ga0495589_0079130 3300046794 Bacteria 1600
107 Ga0495672_0046185 3300047320 Bacteria 2599
108 Ga0495686_0063295 3300047472 Bacteria 2293
109 Ga0496101_0348647 3300048904 Bacteria 1163
110 Ga0496104_0223655 3300048907 Bacteria 1794
111 Ga0496106_0336443 3300048909 Bacteria 1212
112 Ga0496107_0075109 3300048910 Bacteria 2460
113 Ga0496107_0177146 3300048910 Bacteria 1583
114 Ga0496117_0000619 3300048920 Bacteria 57505
115 Ga0496118_0000766 3300048921 Bacteria 51540
116 Ga0496119_0001739 3300048922 Bacteria 25383
117 Ga0496124_0064879 3300048927 Bacteria 3047
118 Ga0496125_0020100 3300048928 Bacteria 6279
119 Ga0496125_0267358 3300048928 Bacteria 1068
120 Ga0496126_0005127 3300048929 Bacteria 15173
121 Ga0496126_0213471 3300048929 Bacteria 1623
122 Ga0496126_0253653 3300048929 Bacteria 1465
123 Ga0501031_0000069 3300049568 Bacteria 55852
124 Ga0501032_0001005 3300049569 Bacteria 22740
125 Ga0501033_0000159 3300049570 Bacteria 64757
126 Ga0501034_0171329 3300049571 Bacteria 2138
127 Ga0501036_0000279 3300049572 Bacteria 35206
128 Ga0501037_0000327 3300049573 Bacteria 40321
129 Ga0501038_0000166 3300049574 Bacteria 55718
130 Ga0501039_0008737 3300049575 Bacteria 7716
131 Ga0501040_0035596 3300049576 Bacteria 3377
132 Ga0501040_0643119 3300049576 Bacteria 766
133 Ga0501042_0328394 3300049578 Bacteria 1105
134 Ga0501043_0000376 3300049579 Bacteria 40497
135 Ga0501046_0000469 3300049580 Bacteria 40385
136 Ga0501047_0000716 3300049581 Bacteria 34570
137 Ga0501048_0000174 3300049582 Bacteria 40380
138 Ga0501048_0053926 3300049582 Bacteria 2857
139 Ga0501067_0102148 3300049583 Bacteria 1593
140 Ga0501068_0008452 3300049584 Bacteria 5728
141 Ga0501068_0091427 3300049584 Bacteria 1878
142 Ga0501069_0043200 3300049585 Bacteria 2494
143 Ga0501069_0064368 3300049585 Bacteria 2049
144 Ga0501069_0142500 3300049585 Bacteria 1375
145 Ga0501070_0000131 3300049586 Bacteria 67175
146 Ga0501070_0008214 3300049586 Bacteria 8828
147 Ga0501070_0231891 3300049586 Bacteria 1512
148 Ga0501071_0130867 3300049587 Bacteria 1864
149 Ga0501071_0131499 3300049587 Bacteria 1860
150 Ga0501072_0121721 3300049588 Bacteria 2079
151 Ga0501072_0352961 3300049588 Bacteria 1167
152 Ga0501073_0001466 3300049589 Bacteria 17473
153 Ga0501073_0017509 3300049589 Bacteria 5190
154 Ga0501074_0028776 3300049590 Bacteria 4025
155 Ga0501079_0003381 3300049741 Bacteria 11707
156 Ga0501079_0189094 3300049741 Bacteria 1607
157 Ga0501080_0008127 3300049742 Bacteria 9506
158 Ga0501080_0029358 3300049742 Bacteria 5119
159 Ga0501083_0000435 3300049744 Bacteria 26857
160 Ga0501083_0164156 3300049744 Bacteria 1452
161 Ga0501035_0321832 3300049822 Bacteria 1299
162 Ga0501044_0004146 3300049823 Bacteria 16279
163 Ga0501044_0072325 3300049823 Bacteria 3506
164 Ga0501044_0173279 3300049823 Bacteria 2128
165 Ga0501045_0051080 3300049824 Bacteria 3017
166 Ga0501045_0606435 3300049824 Bacteria 810
167 nmdc:mga03n38_21271_c1 3300050490 Bacteria 2608
168 nmdc:mga03n38_60473_c1 3300050490 Bacteria 1722
169 nmdc:mga00v17_105528_c1 3300050491 Bacteria 1783
170 nmdc:mga00v17_21454_c1 3300050491 Bacteria 3713
171 nmdc:mga00v17_87465_c1 3300050491 Bacteria 1953
172 nmdc:mga0yw44_133241_c1 3300050492 Bacteria 1610
173 nmdc:mga0yw44_3167_c1 3300050492 Bacteria 7226
174 nmdc:mga0yw44_34164_c1 3300050492 Bacteria 2978
175 nmdc:mga0yw44_586550_c1 3300050492 Bacteria 757
176 nmdc:mga07m45_220872_c1 3300050496 Bacteria 1102
177 nmdc:mga05p37_193169_c1 3300050507 Bacteria 2470
178 nmdc:mga05p37_282619_c1 3300050507 Bacteria 1978
179 nmdc:mga09592_347413_c1 3300050508 Bacteria 1284
180 nmdc:mga0qj67_104209_c1 3300050509 Bacteria 2288
181 nmdc:mga06r32_20287_c1 3300050510 Bacteria 6116
182 nmdc:mga06r32_93421_c1 3300050510 Bacteria 2942
183 nmdc:mga08y16_7104_c1 3300050511 Bacteria 11755
184 nmdc:mga0n895_110737_c1 3300050512 Bacteria 2762
185 nmdc:mga0a205_152696_c1 3300050515 Bacteria 2208
186 nmdc:mga0sz30_63105_c1 3300050516 Bacteria 1585
187 Ga0495655_0052321 3300053083 Bacteria 1086
188 Ga0501084_0046338 3300054114 Bacteria 3642
189 Ga0501084_0386431 3300054114 Bacteria 1183
190 Ga0501084_0728949 3300054114 Bacteria 835
191 Ga0501082_0003963 3300060353 Bacteria 12925
192 Ga0530510_0104281 3300061734 Bacteria 2074
193 Ga0075365_10032446
194 JGI25407J50210_10020780
195 JGI25407J50210_10043722
196 JGI25407J50210_10056898
197 Ga0070668_100258150
198 Ga0070674_100009328
199 Ga0070667_100000411
200 Ga0070663_100000139
201 Ga0068867_100553269
202 Ga0070679_100006865
203 Ga0070665_100006597
204 Ga0068858_100250394
205 Ga0068860_100183913
206 Ga0068862_100031754
207 Ga0081455_10005335
208 Ga0081455_10304314
209 Ga0081455_10423836
210 Ga0081538_10000018
211 Ga0081538_10001081
212 Ga0081538_10002046
213 Ga0081538_10011391
214 Ga0081538_10011623
215 Ga0081538_10017827
216 Ga0081538_10062333
217 Ga0075365_10016761
218 Ga0075365_10038607
219 Ga0075365_10053466
220 Ga0075368_10028745
221 Ga0075363_100001203
222 Ga0075363_100046677
223 Ga0075363_100105187
224 Ga0075364_10025086
225 Ga0075364_10025894
226 Ga0075364_10079857
227 Ga0075428_100478628
228 Ga0075430_100003400
229 Ga0075430_100114067
230 Ga0075431_100002575
231 Ga0075431_100003260
232 Ga0075431_100004773
233 Ga0075434_100143494
234 Ga0075429_100620576
235 Ga0068865_100385614
236 Ga0075435_100121155
237 Ga0111539_10004135
238 Ga0114129_10108263
239 Ga0114129_10234533
240 Ga0114129_11234821
241 Ga0114129_11401023
242 Ga0105243_10045280
243 Ga0105242_10583502
244 Ga0105238_10690332
245 Ga0105249_10000630
246 Ga0105239_10029309
247 Ga0157378_10410690
248 Ga0157379_10014741
249 Ga0157376_10023197
250 Ga0207699_10053356
251 Ga0207693_10073898
252 Ga0207693_10127335
253 Ga0207660_10224534
254 Ga0207652_10002019
255 Ga0207709_10379791
256 Ga0207669_10281845
257 Ga0207665_10030772
258 Ga0207712_10144775
259 Ga0207668_10012704
260 Ga0207668_10249660
261 Ga0207658_10023377
262 Ga0207658_10073238
263 Ga0207703_10221860
264 Ga0207678_10001348
265 Ga0207648_10505585
266 Ga0207428_10103010
267 Ga0268266_10000614
268 Ga0268264_10266734
269 Ga0307408_100232490
270 Ga0307405_10254332
271 Ga0307405_10338613
272 Ga0307413_10327124
273 Ga0307413_10503103
274 Ga0307410_10081615
275 Ga0307410_10556275
276 Ga0307406_10043584
277 Ga0307407_10004689
278 Ga0307407_10136766
279 Ga0307407_10400646
280 Ga0307412_10121559
281 Ga0307409_100004724
282 Ga0307409_100176909
283 Ga0307409_100676701
284 Ga0307416_100140035
285 Ga0307411_10014634
286 Ga0307415_100455778
287 Ga0307415_100569769
288 Ga0395900_0137337
289 Ga0395900_0261370
290 Ga0395898_0088250
291 Ga0395898_0606581
292 Ga0395905_0179613
293 Ga0395901_0010169
294 Ga0395901_0019171
295 Ga0395901_0243129
296 Ga0451853_0057597
297 Ga0495641_0145665
298 Ga0495589_0079130
299 Ga0495672_0046185
300 Ga0495686_0063295
301 Ga0496101_0348647
302 Ga0496104_0223655
303 Ga0496106_0336443
304 Ga0496107_0075109
305 Ga0496107_0177146
306 Ga0496117_0000619
307 Ga0496118_0000766
308 Ga0496119_0001739
309 Ga0496124_0064879
310 Ga0496125_0020100
311 Ga0496125_0267358
312 Ga0496126_0005127
313 Ga0496126_0213471
314 Ga0496126_0253653
315 Ga0501031_0000069
316 Ga0501032_0001005
317 Ga0501033_0000159
318 Ga0501034_0171329
319 Ga0501036_0000279
320 Ga0501037_0000327
321 Ga0501038_0000166
322 Ga0501039_0008737
323 Ga0501040_0035596
324 Ga0501040_0643119
325 Ga0501042_0328394
326 Ga0501043_0000376
327 Ga0501046_0000469
328 Ga0501047_0000716
329 Ga0501048_0000174
330 Ga0501048_0053926
331 Ga0501067_0102148
332 Ga0501068_0008452
333 Ga0501068_0091427
334 Ga0501069_0043200
335 Ga0501069_0064368
336 Ga0501069_0142500
337 Ga0501070_0000131
338 Ga0501070_0008214
339 Ga0501070_0231891
340 Ga0501071_0130867
341 Ga0501071_0131499
342 Ga0501072_0121721
343 Ga0501072_0352961
344 Ga0501073_0001466
345 Ga0501073_0017509
346 Ga0501074_0028776
347 Ga0501079_0003381
348 Ga0501079_0189094
349 Ga0501080_0008127
350 Ga0501080_0029358
351 Ga0501083_0000435
352 Ga0501083_0164156
353 Ga0501035_0321832
354 Ga0501044_0004146
355 Ga0501044_0072325
356 Ga0501044_0173279
357 Ga0501045_0051080
358 Ga0501045_0606435
359 nmdc:mga03n38_21271_c1
360 nmdc:mga03n38_60473_c1
361 nmdc:mga00v17_105528_c1
362 nmdc:mga00v17_21454_c1
363 nmdc:mga00v17_87465_c1
364 nmdc:mga0yw44_133241_c1
365 nmdc:mga0yw44_3167_c1
366 nmdc:mga0yw44_34164_c1
367 nmdc:mga0yw44_586550_c1
368 nmdc:mga07m45_220872_c1
369 nmdc:mga05p37_193169_c1
370 nmdc:mga05p37_282619_c1
371 nmdc:mga09592_347413_c1
372 nmdc:mga0qj67_104209_c1
373 nmdc:mga06r32_20287_c1
374 nmdc:mga06r32_93421_c1
375 nmdc:mga08y16_7104_c1
376 nmdc:mga0n895_110737_c1
377 nmdc:mga0a205_152696_c1
378 nmdc:mga0sz30_63105_c1
379 Ga0495655_0052321
380 Ga0501084_0046338
381 Ga0501084_0386431
382 Ga0501084_0728949
383 Ga0501082_0003963
384 Ga0530510_0104281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

122

218

0.91

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

23

112

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eh1-assembly1.cif.gz_A crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor 0.8752 16 238
1gvh-assembly1.cif.gz_A the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket 0.8528 8 240
5ogx-assembly1.cif.gz_A crystal structure of amycolatopsis cytochrome p450 reductase gcob. 0.8447 14 238
7c3a-assembly3.cif.gz_C ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8446 14 237
5yly-assembly2.cif.gz_B crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase 0.8385 14 234
ID Description Score Start End Superfamily
1gvhA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8888 14 114 2.40.30.10
af_I1KVY3_156_295_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8768 106 232 3.40.50.80
af_P76254_2_105_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8707 14 105 2.40.30.10
af_A0A1D6N8X4_138_306_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8692 106 234 3.40.50.80
af_P9WNE9_60_162_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8657 14 112 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A0M8TW06-F1-model_v4 Oxidoreductase 0.9324 14 237 GO:0016491
GO:0051537
AF-A0A7Y6CKD3-F1-model_v4 deleted 0.9284 14 180
AF-A0A0M8UZ90-F1-model_v4 Oxidoreductase 0.9277 21 237 GO:0016491
GO:0051537
AF-A0A0M8VTR7-F1-model_v4 Oxidoreductase 0.9239 21 237 GO:0016491
GO:0051537
AF-A0A3G8JG57-F1-model_v4 Flavohemoprotein (EC 1.14.12.17) 0.9231 14 237 GO:0008941
GO:0051537

Map