F295381

General Info

Members Datasets Scaffolds Average Seq Length
192 140 180 406

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100028792|Ga0068861_1000287923
Length 424
Sequence VTNADDPAHRTVESVARASYGKLVAFLSSRTRDVASAEDALSDALIAALTAWPHTGIPRNPQGWLIATARNRLIDRARHDQVHAQSIPTLELIAQDADPVEDEQVFPDERLKLLFVCAHPAIDADMHTPLMLQTVLGLDAAEIGRAFLVSPEAMSQRLVRAKTKIRRTAIAFDIPETQHLPQRMEAVMNAIYAAYGSGWEDAAGADSRAQGLTEEAIWLARLLCDRMRDDPEVKGLLALMLHCEARRTARRDTDGRFIPLSEQDPSQWNRGMIDEAERILTTAAEQRREPGRFQLEAAIQSVHAERARSGITQWPAIAVFYDRLVELSPTLGARVACAAAHAEVDGAATGLSLLDAIDHDAVVAYQPYWAVRAHLLHQLRHHDAAAAAFDRAIGLSEDPAVRRFLLERRNGSQPTSSRPAEPSR

Samples

Sample ID Description Type Environment
1 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
2 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
3 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
4 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
5 2849660919 Nostoc sp. T09 Isolate Unclassified
6 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
7 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
8 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
9 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
135 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
138 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
139 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
140 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0.52
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 1.04
Rhizoplane 1.04
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1000102 3300003761 Bacteria 92203
2 Ga0055542_1000147 3300003762 Bacteria 88503
3 Ga0065704_10000988 3300005289 Bacteria 17860
4 Ga0065712_10068035 3300005290 Bacteria 16451
5 Ga0065707_10082242 3300005295 Bacteria 18446
6 Ga0070677_10072980 3300005333 Bacteria 1449
7 Ga0070680_100054142 3300005336 Bacteria 3275
8 Ga0070682_100125325 3300005337 Bacteria 1730
9 Ga0070660_100240801 3300005339 Bacteria 1474
10 Ga0070668_100218822 3300005347 Bacteria 1570
11 Ga0070669_100009031 3300005353 Bacteria 7108
12 Ga0070688_100015508 3300005365 Bacteria 4339
13 Ga0070700_100054155 3300005441 Bacteria 2506
14 Ga0070700_100069635 3300005441 Bacteria 2241
15 Ga0070700_100153108 3300005441 Bacteria 1579
16 Ga0070708_100000957 3300005445 Bacteria 21911
17 Ga0070681_10004299 3300005458 Bacteria 13525
18 Ga0070706_100009097 3300005467 Bacteria 9250
19 Ga0070706_100142222 3300005467 Unclassified 2239
20 Ga0070707_100074245 3300005468 Unclassified 3279
21 Ga0070707_100280512 3300005468 Unclassified 1619
22 Ga0070707_100358014 3300005468 Bacteria 1417
23 Ga0070698_100000012 3300005471 Bacteria 116260
24 Ga0070698_100012121 3300005471 Bacteria 9136
25 Ga0070698_100018866 3300005471 Bacteria 7257
26 Ga0070699_100085051 3300005518 Bacteria 2760
27 Ga0070699_100094344 3300005518 Bacteria 2619
28 Ga0070679_100195093 3300005530 Bacteria 1992
29 Ga0070679_100222312 3300005530 Bacteria 1849
30 Ga0070697_100071863 3300005536 Bacteria 2838
31 Ga0070697_100166862 3300005536 Unclassified 1862
32 Ga0070672_100082483 3300005543 Bacteria 2579
33 Ga0070672_100104086 3300005543 Bacteria 2306
34 Ga0070672_100123131 3300005543 Bacteria 2125
35 Ga0070665_100006732 3300005548 Bacteria 11682
36 Ga0068854_100025453 3300005578 Bacteria 4061
37 Ga0068856_100315887 3300005614 Bacteria 1580
38 Ga0068852_100038181 3300005616 Bacteria 4034
39 Ga0068859_100005861 3300005617 Bacteria 12470
40 Ga0068859_100025506 3300005617 Bacteria 5930
41 Ga0068859_100027436 3300005617 Bacteria 5711
42 Ga0068859_100425135 3300005617 Bacteria 1425
43 Ga0068864_100199639 3300005618 Bacteria 1837
44 Ga0068864_100233396 3300005618 Bacteria 1702
45 Ga0068861_100021447 3300005719 Bacteria 4642
46 Ga0068861_100028792 3300005719 Plasmid 4056
47 Ga0068860_100305257 3300005843 Bacteria 1560
48 Ga0068862_100031395 3300005844 Bacteria 4484
49 Ga0068862_100060917 3300005844 Bacteria 3243
50 Ga0081455_10033812 3300005937 Bacteria 4588
51 Ga0081540_1011701 3300005983 Bacteria 5841
52 Ga0075364_10086139 3300006051 Bacteria 2081
53 Ga0070712_100221922 3300006175 Unclassified 1497
54 Ga0075362_10031403 3300006177 Bacteria 2298
55 Ga0075367_10075565 3300006178 Bacteria 2032
56 Ga0075366_10103568 3300006195 Bacteria 1709
57 Ga0075428_100028230 3300006844 Bacteria 6206
58 Ga0075428_100076509 3300006844 Bacteria 3654
59 Ga0075431_100338623 3300006847 Bacteria 1514
60 Ga0075433_10012820 3300006852 Bacteria 6791
61 Ga0075433_10033294 3300006852 Bacteria 4416
62 Ga0075433_10228636 3300006852 Bacteria 1652
63 Ga0075434_100011953 3300006871 Bacteria 8212
64 Ga0075434_100015808 3300006871 Bacteria 7245
65 Ga0075429_100067810 3300006880 Bacteria 3105
66 Ga0075429_100102918 3300006880 Bacteria 2493
67 Ga0075436_100003221 3300006914 Bacteria 11194
68 Ga0097620_100025506 3300006931 Bacteria 5930
69 Ga0097620_100027436 3300006931 Bacteria 5711
70 Ga0105240_10268010 3300009093 Bacteria 1968
71 Ga0111539_10001245 3300009094 Bacteria 33905
72 Ga0111539_10028973 3300009094 Bacteria 6752
73 Ga0111539_10036281 3300009094 Bacteria 5963
74 Ga0111539_10042720 3300009094 Bacteria 5441
75 Ga0111539_10399771 3300009094 Bacteria 1600
76 Ga0114129_10001537 3300009147 Bacteria 31282
77 Ga0114129_10154162 3300009147 Bacteria 3143
78 Ga0114129_10392437 3300009147 Bacteria 1830
79 Ga0105238_10216307 3300009551 Bacteria 1892
80 Ga0105238_10283928 3300009551 Unclassified 1637
81 Ga0105249_10003745 3300009553 Bacteria 13126
82 Ga0157370_10006620 3300013104 Bacteria 12732
83 Ga0157370_10054663 3300013104 Bacteria 3806
84 Ga0163162_10323834 3300013306 Bacteria 1674
85 Ga0157372_10047385 3300013307 Bacteria 4776
86 Ga0163163_10003531 3300014325 Bacteria 13282
87 Ga0157380_10170443 3300014326 Bacteria 1901
88 Ga0157377_10072225 3300014745 Bacteria 1997
89 Ga0209672_100582 3300025228 Bacteria 19389
90 Ga0209258_100111 3300025242 Bacteria 197019
91 Ga0209148_1000099 3300025254 Bacteria 227713
92 Ga0207699_10035687 3300025906 Bacteria 2831
93 Ga0207684_10002954 3300025910 Bacteria 16852
94 Ga0207684_10011703 3300025910 Bacteria 7655
95 Ga0207684_10070037 3300025910 Bacteria 2980
96 Ga0207707_10004142 3300025912 Bacteria 12844
97 Ga0207707_10060222 3300025912 Bacteria 3303
98 Ga0207695_10065368 3300025913 Bacteria 3740
99 Ga0207652_10022900 3300025921 Bacteria 5174
100 Ga0207646_10000287 3300025922 Bacteria 69461
101 Ga0207646_10001206 3300025922 Bacteria 32514
102 Ga0207646_10161717 3300025922 Bacteria 2021
103 Ga0207700_10092503 3300025928 Unclassified 2391
104 Ga0207664_10079335 3300025929 Unclassified 2665
105 Ga0207670_10019793 3300025936 Bacteria 4119
106 Ga0207670_10074571 3300025936 Bacteria 2356
107 Ga0207691_10067983 3300025940 Bacteria 3220
108 Ga0207689_10101209 3300025942 Bacteria 2367
109 Ga0207712_10040022 3300025961 Bacteria 3214
110 Ga0207640_10178629 3300025981 Bacteria 1589
111 Ga0207639_10223702 3300026041 Bacteria 1627
112 Ga0207702_10233662 3300026078 Bacteria 1719
113 Ga0207676_10168607 3300026095 Unclassified 1905
114 Ga0207674_10246024 3300026116 Bacteria 1735
115 Ga0207675_100043066 3300026118 Unclassified 4216
116 Ga0207683_10009278 3300026121 Bacteria 8382
117 Ga0209179_1001915 3300027512 Bacteria 2689
118 Ga0207428_10000412 3300027907 Bacteria 53243
119 Ga0207428_10064154 3300027907 Bacteria 2901
120 Ga0268266_10117279 3300028379 Bacteria 2365
121 Ga0268265_10177977 3300028380 Bacteria 1825
122 Ga0268264_10232714 3300028381 Bacteria 1702
123 Ga0265337_1001388 3300028556 Bacteria 11886
124 Ga0265762_1001993 3300030760 Bacteria 3716
125 Ga0265340_10039950 3300031247 Bacteria 2312
126 Ga0265339_10067329 3300031249 Bacteria 1915
127 Ga0265331_10002705 3300031250 Bacteria 11813
128 Ga0307513_10049795 3300031456 Bacteria 4535
129 Ga0265313_10000838 3300031595 Bacteria 30978
130 Ga0265314_10014340 3300031711 Bacteria 6350
131 Ga0265342_10009442 3300031712 Bacteria 6874
132 Ga0373939_0015384 3300035114 Unclassified 2001
133 Ga0373925_0004756 3300037068 Bacteria 10228
134 Ga0400483_018691 3300039062 Bacteria 1354
135 Ga0400483_247393 3300039062 Bacteria 2154
136 Ga0436360_1042384 3300039438 Bacteria 6594
137 Ga0436361_0720255 3300039447 Bacteria 1632
138 Ga0450893_0004253 3300042532 Bacteria 2279
139 Ga0495629_0054994 3300046459 Bacteria 2783
140 Ga0495629_0072935 3300046459 Unclassified 2397
141 Ga0495629_0089093 3300046459 Bacteria 2153
142 Ga0495638_0002105 3300046460 Bacteria 16833
143 Ga0495638_0013476 3300046460 Bacteria 5565
144 Ga0495580_0003064 3300046472 Bacteria 14316
145 Ga0495622_0003513 3300046557 Bacteria 7379
146 Ga0495669_0007739 3300046684 Bacteria 4510
147 Ga0495649_0005557 3300046694 Bacteria 7983
148 Ga0495602_0172918 3300048088 Unclassified 1675
149 Ga0496112_0039226 3300048915 Bacteria 4627
150 Ga0496115_0028043 3300048918 Bacteria 4410
151 Ga0496126_0072040 3300048929 Bacteria 3075
152 Ga0501033_0167910 3300049570 Bacteria 1577
153 Ga0501038_0264220 3300049574 Bacteria 1359
154 Ga0501071_0113632 3300049587 Bacteria 2003
155 Ga0501072_0212351 3300049588 Bacteria 1542
156 Ga0501076_0035550 3300049592 Bacteria 3897
157 Ga0501035_0000027 3300049822 Bacteria 180157
158 Ga0501035_0176726 3300049822 Bacteria 1841
159 nmdc:mga00v17_105420_c1 3300050491 Bacteria 1784
160 nmdc:mga0k408_292_c1 3300050493 Bacteria 27278
161 nmdc:mga05p37_1069_c1 3300050507 Bacteria 31339
162 nmdc:mga05p37_436162_c1 3300050507 Bacteria 1521
163 nmdc:mga09592_42459_c1 3300050508 Bacteria 3824
164 nmdc:mga09592_55449_c1 3300050508 Bacteria 3349
165 nmdc:mga08y16_122471_c1 3300050511 Bacteria 2706
166 nmdc:mga08y16_172839_c1 3300050511 Bacteria 2244
167 nmdc:mga08y16_43490_c1 3300050511 Bacteria 4707
168 nmdc:mga08y16_482_c1 3300050511 Bacteria 36840
169 nmdc:mga08y16_96576_c1 3300050511 Bacteria 3077
170 nmdc:mga0n895_506_c1 3300050512 Bacteria 26453
171 nmdc:mga0n895_79195_c1 3300050512 Bacteria 3272
172 nmdc:mga0rr50_67084_c1 3300050513 Bacteria 2725
173 nmdc:mga08x19_1755_c1 3300050514 Bacteria 13369
174 nmdc:mga0a205_177_c1 3300050515 Bacteria 43308
175 nmdc:mga0a205_96665_c1 3300050515 Bacteria 2852
176 Ga0500651_0044664 3300053093 Bacteria 2789
177 Ga0500588_0016899 3300053146 Bacteria 1895
178 Ga0500590_000103 3300053148 Bacteria 22489
179 Ga0500616_0000030 3300053153 Bacteria 415224
180 Ga0500627_0044657 3300053158 Bacteria 1914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_018691 Ga0400483_018691_279_1325 322
2 3300053093 Ga0500651_0044664 Ga0500651_0044664_1720_2769 342
3 3300006852 Ga0075433_10228636 Ga0075433_102286361 363
4 3300050515 nmdc:mga0a205_96665_c1 nmdc:mga0a205_96665_c1_286_1521 363
5 3300050507 nmdc:mga05p37_436162_c1 nmdc:mga05p37_436162_c1_21_1256 364
6 3300049822 Ga0501035_0176726 Ga0501035_0176726_507_1808 367
7 3300046684 Ga0495669_0007739 Ga0495669_0007739_3097_4344 370
8 3300039062 Ga0400483_247393 Ga0400483_247393_431_1630 374
9 3300026041 Ga0207639_10223702 Ga0207639_102237022 377
10 3300005467 Ga0070706_100142222 Ga0070706_1001422223 378
11 3300005468 Ga0070707_100074245 Ga0070707_1000742454 378
12 3300005471 Ga0070698_100018866 Ga0070698_1000188666 378
13 3300025910 Ga0207684_10011703 Ga0207684_100117037 378
14 3300025922 Ga0207646_10001206 Ga0207646_1000120628 378
15 3300025922 Ga0207646_10161717 Ga0207646_101617173 379
16 3300005336 Ga0070680_100054142 Ga0070680_1000541423 380
17 3300005578 Ga0068854_100025453 Ga0068854_1000254533 380
18 3300005614 Ga0068856_100315887 Ga0068856_1003158871 380
19 3300005616 Ga0068852_100038181 Ga0068852_1000381814 380
20 3300009551 Ga0105238_10216307 Ga0105238_102163072 380
21 3300025912 Ga0207707_10060222 Ga0207707_100602223 380
22 3300025913 Ga0207695_10065368 Ga0207695_100653685 380
23 3300025981 Ga0207640_10178629 Ga0207640_101786291 380
24 3300026078 Ga0207702_10233662 Ga0207702_102336622 380
25 3300053146 Ga0500588_0016899 Ga0500588_0016899_339_1592 381
26 3300049822 Ga0501035_0000027 Ga0501035_0000027_1592_2902 383
27 3300048915 Ga0496112_0039226 Ga0496112_0039226_2710_3885 384
28 3300025910 Ga0207684_10070037 Ga0207684_100700373 386
29 3300048929 Ga0496126_0072040 Ga0496126_0072040_115_1347 386
30 3300005618 Ga0068864_100233396 Ga0068864_1002333961 387
31 iso_pu_bacteria 2852643534 2852646115 387
32 3300009093 Ga0105240_10268010 Ga0105240_102680102 388
33 3300013307 Ga0157372_10047385 Ga0157372_100473852 388
34 3300050491 nmdc:mga00v17_105420_c1 nmdc:mga00v17_105420_c1_534_1754 388
35 3300039447 Ga0436361_0720255 Ga0436361_0720255_215_1471 389
36 3300005618 Ga0068864_100199639 Ga0068864_1001996392 390
37 3300026095 Ga0207676_10168607 Ga0207676_101686072 390
38 3300009147 Ga0114129_10392437 Ga0114129_103924372 391
39 3300005445 Ga0070708_100000957 Ga0070708_10000095718 395
40 3300005458 Ga0070681_10004299 Ga0070681_100042993 395
41 3300005467 Ga0070706_100009097 Ga0070706_1000090977 395
42 3300005468 Ga0070707_100280512 Ga0070707_1002805122 395
43 3300005471 Ga0070698_100000012 Ga0070698_10000001263 395
44 3300005518 Ga0070699_100094344 Ga0070699_1000943441 395
45 3300005530 Ga0070679_100222312 Ga0070679_1002223123 395
46 3300009551 Ga0105238_10283928 Ga0105238_102839282 395
47 3300025910 Ga0207684_10002954 Ga0207684_100029542 395
48 3300025912 Ga0207707_10004142 Ga0207707_100041423 395
49 3300025922 Ga0207646_10000287 Ga0207646_1000028724 395
50 3300027512 Ga0209179_1001915 Ga0209179_10019153 395
51 3300037068 Ga0373925_0004756 Ga0373925_0004756_2124_3353 395
52 3300046459 Ga0495629_0072935 Ga0495629_0072935_72_1301 395
53 3300046472 Ga0495580_0003064 Ga0495580_0003064_6615_7844 395
54 iso_pu_bacteria 2852632344 2852634118 395
55 3300005337 Ga0070682_100125325 Ga0070682_1001253252 396
56 3300005347 Ga0070668_100218822 Ga0070668_1002188222 396
57 3300005365 Ga0070688_100015508 Ga0070688_1000155084 396
58 3300005441 Ga0070700_100054155 Ga0070700_1000541553 396
59 3300005468 Ga0070707_100358014 Ga0070707_1003580141 396
60 3300005518 Ga0070699_100085051 Ga0070699_1000850512 396
61 3300005536 Ga0070697_100071863 Ga0070697_1000718632 396
62 3300005536 Ga0070697_100166862 Ga0070697_1001668623 396
63 3300005543 Ga0070672_100082483 Ga0070672_1000824832 396
64 3300005543 Ga0070672_100104086 Ga0070672_1001040862 396
65 3300005543 Ga0070672_100123131 Ga0070672_1001231312 396
66 3300005617 Ga0068859_100027436 Ga0068859_1000274365 396
67 3300005719 Ga0068861_100021447 Ga0068861_1000214475 396
68 3300005843 Ga0068860_100305257 Ga0068860_1003052572 396
69 3300005844 Ga0068862_100060917 Ga0068862_1000609171 396
70 3300005937 Ga0081455_10033812 Ga0081455_100338123 396
71 3300006051 Ga0075364_10086139 Ga0075364_100861393 396
72 3300006175 Ga0070712_100221922 Ga0070712_1002219222 396
73 3300006177 Ga0075362_10031403 Ga0075362_100314033 396
74 3300006178 Ga0075367_10075565 Ga0075367_100755651 396
75 3300006195 Ga0075366_10103568 Ga0075366_101035682 396
76 3300006844 Ga0075428_100028230 Ga0075428_1000282303 396
77 3300006844 Ga0075428_100076509 Ga0075428_1000765094 396
78 3300006847 Ga0075431_100338623 Ga0075431_1003386232 396
79 3300006880 Ga0075429_100067810 Ga0075429_1000678102 396
80 3300006880 Ga0075429_100102918 Ga0075429_1001029183 396
81 3300006931 Ga0097620_100027436 Ga0097620_1000274365 396
82 3300009094 Ga0111539_10001245 Ga0111539_100012456 396
83 3300009094 Ga0111539_10028973 Ga0111539_100289734 396
84 3300009094 Ga0111539_10036281 Ga0111539_100362817 396
85 3300013104 Ga0157370_10006620 Ga0157370_100066203 396
86 3300013104 Ga0157370_10054663 Ga0157370_100546634 396
87 3300013306 Ga0163162_10323834 Ga0163162_103238341 396
88 3300014325 Ga0163163_10003531 Ga0163163_100035311 396
89 3300014326 Ga0157380_10170443 Ga0157380_101704432 396
90 3300014745 Ga0157377_10072225 Ga0157377_100722253 396
91 3300025906 Ga0207699_10035687 Ga0207699_100356872 396
92 3300025928 Ga0207700_10092503 Ga0207700_100925033 396
93 3300025929 Ga0207664_10079335 Ga0207664_100793353 396
94 3300025936 Ga0207670_10019793 Ga0207670_100197933 396
95 3300025936 Ga0207670_10074571 Ga0207670_100745713 396
96 3300025940 Ga0207691_10067983 Ga0207691_100679833 396
97 3300025942 Ga0207689_10101209 Ga0207689_101012092 396
98 3300026116 Ga0207674_10246024 Ga0207674_102460241 396
99 3300026121 Ga0207683_10009278 Ga0207683_100092782 396
100 3300027907 Ga0207428_10000412 Ga0207428_1000041230 396
101 3300027907 Ga0207428_10064154 Ga0207428_100641542 396
102 3300028381 Ga0268264_10232714 Ga0268264_102327141 396
103 3300030760 Ga0265762_1001993 Ga0265762_10019933 396
104 3300031456 Ga0307513_10049795 Ga0307513_100497953 396
105 3300046694 Ga0495649_0005557 Ga0495649_0005557_2213_3445 396
106 3300048918 Ga0496115_0028043 Ga0496115_0028043_802_2034 396
107 3300049570 Ga0501033_0167910 Ga0501033_0167910_57_1277 396
108 3300049574 Ga0501038_0264220 Ga0501038_0264220_62_1282 396
109 3300049587 Ga0501071_0113632 Ga0501071_0113632_567_1787 396
110 3300049588 Ga0501072_0212351 Ga0501072_0212351_223_1443 396
111 3300049592 Ga0501076_0035550 Ga0501076_0035550_153_1373 396
112 3300050493 nmdc:mga0k408_292_c1 nmdc:mga0k408_292_c1_18276_19496 396
113 3300050508 nmdc:mga09592_42459_c1 nmdc:mga09592_42459_c1_1709_2929 396
114 3300050508 nmdc:mga09592_55449_c1 nmdc:mga09592_55449_c1_1098_2318 396
115 3300050511 nmdc:mga08y16_122471_c1 nmdc:mga08y16_122471_c1_319_1539 396
116 3300050511 nmdc:mga08y16_43490_c1 nmdc:mga08y16_43490_c1_2362_3582 396
117 3300050511 nmdc:mga08y16_482_c1 nmdc:mga08y16_482_c1_21317_22537 396
118 3300050511 nmdc:mga08y16_96576_c1 nmdc:mga08y16_96576_c1_142_1362 396
119 iso_pu_bacteria 2849660919 2849665697 397
120 3300005333 Ga0070677_10072980 Ga0070677_100729801 398
121 3300031247 Ga0265340_10039950 Ga0265340_100399502 398
122 3300031249 Ga0265339_10067329 Ga0265339_100673291 398
123 3300031250 Ga0265331_10002705 Ga0265331_1000270515 398
124 3300031595 Ga0265313_10000838 Ga0265313_1000083817 398
125 3300031711 Ga0265314_10014340 Ga0265314_100143402 398
126 3300031712 Ga0265342_10009442 Ga0265342_100094429 398
127 3300039438 Ga0436360_1042384 Ga0436360_1042384_40_1275 398
128 iso_pu_bacteria 2821268502 2821270653 398
129 3300005617 Ga0068859_100025506 Ga0068859_1000255068 399
130 3300005844 Ga0068862_100031395 Ga0068862_1000313955 399
131 3300006852 Ga0075433_10012820 Ga0075433_100128202 399
132 3300006871 Ga0075434_100015808 Ga0075434_1000158084 399
133 3300006914 Ga0075436_100003221 Ga0075436_1000032217 399
134 3300006931 Ga0097620_100025506 Ga0097620_1000255068 399
135 3300009147 Ga0114129_10001537 Ga0114129_1000153720 399
136 3300009553 Ga0105249_10003745 Ga0105249_100037453 399
137 3300025961 Ga0207712_10040022 Ga0207712_100400222 399
138 3300028380 Ga0268265_10177977 Ga0268265_101779771 399
139 3300035114 Ga0373939_0015384 Ga0373939_0015384_66_1307 399
140 3300046459 Ga0495629_0089093 Ga0495629_0089093_244_1488 399
141 3300046460 Ga0495638_0002105 Ga0495638_0002105_9480_10712 399
142 3300050507 nmdc:mga05p37_1069_c1 nmdc:mga05p37_1069_c1_885_2111 399
143 3300050512 nmdc:mga0n895_506_c1 nmdc:mga0n895_506_c1_21109_22335 399
144 3300050513 nmdc:mga0rr50_67084_c1 nmdc:mga0rr50_67084_c1_553_1779 399
145 3300050514 nmdc:mga08x19_1755_c1 nmdc:mga08x19_1755_c1_8307_9533 399
146 3300050515 nmdc:mga0a205_177_c1 nmdc:mga0a205_177_c1_3342_4568 399
147 3300053158 Ga0500627_0044657 Ga0500627_0044657_452_1684 399
148 iso_pu_bacteria 2808606447 2809228495 399
149 3300005339 Ga0070660_100240801 Ga0070660_1002408011 400
150 3300005530 Ga0070679_100195093 Ga0070679_1001950932 400
151 3300006852 Ga0075433_10033294 Ga0075433_100332942 400
152 3300006871 Ga0075434_100011953 Ga0075434_10001195311 400
153 3300009094 Ga0111539_10042720 Ga0111539_100427202 400
154 3300009147 Ga0114129_10154162 Ga0114129_101541621 400
155 3300025921 Ga0207652_10022900 Ga0207652_100229003 400
156 3300050512 nmdc:mga0n895_79195_c1 nmdc:mga0n895_79195_c1_959_2203 400
157 3300005289 Ga0065704_10000988 Ga0065704_100009887 401
158 3300005290 Ga0065712_10068035 Ga0065712_100680353 401
159 3300005295 Ga0065707_10082242 Ga0065707_100822422 401
160 3300005353 Ga0070669_100009031 Ga0070669_1000090315 401
161 3300005471 Ga0070698_100012121 Ga0070698_1000121217 401
162 3300005548 Ga0070665_100006732 Ga0070665_1000067327 401
163 3300005617 Ga0068859_100005861 Ga0068859_1000058618 401
164 3300028379 Ga0268266_10117279 Ga0268266_101172792 401
165 3300042532 Ga0450893_0004253 Ga0450893_0004253_747_1991 401
166 3300046459 Ga0495629_0054994 Ga0495629_0054994_997_2247 401
167 3300046460 Ga0495638_0013476 Ga0495638_0013476_435_1682 401
168 3300046557 Ga0495622_0003513 Ga0495622_0003513_5747_6997 401
169 3300048088 Ga0495602_0172918 Ga0495602_0172918_272_1522 401
170 3300053148 Ga0500590_000103 Ga0500590_000103_17395_18645 401
171 3300005983 Ga0081540_1011701 Ga0081540_10117015 402
172 iso_pu_bacteria 2585427608 2585898848 402
173 iso_pu_bacteria 2643221676 2644422932 402
174 iso_pu_bacteria 2852387548 2852391089 402
175 iso_pu_bacteria 2889049205 2889051506 402
176 iso_pu_bacteria 8046767195 8046773317 402
177 iso_pu_bacteria 8057575449 8057577494 402
178 3300005441 Ga0070700_100069635 Ga0070700_1000696352 403
179 3300050511 nmdc:mga08y16_172839_c1 nmdc:mga08y16_172839_c1_83_1360 403
180 3300053153 Ga0500616_0000030 Ga0500616_0000030_107862_109205 403
181 3300005441 Ga0070700_100153108 Ga0070700_1001531081 404
182 3300005617 Ga0068859_100425135 Ga0068859_1004251352 404
183 3300009094 Ga0111539_10399771 Ga0111539_103997712 404
184 iso_pu_bacteria 8024486573 8024487901 405
185 3300005719 Ga0068861_100028792 Ga0068861_1000287923 406
186 3300026118 Ga0207675_100043066 Ga0207675_1000430662 406
187 3300028556 Ga0265337_1001388 Ga0265337_100138811 407
188 3300003761 Ga0055535_1000102 Ga0055535_100010243 415
189 3300003762 Ga0055542_1000147 Ga0055542_100014775 415
190 3300025228 Ga0209672_100582 Ga0209672_10058214 415
191 3300025242 Ga0209258_100111 Ga0209258_10011174 415
192 3300025254 Ga0209148_1000099 Ga0209148_1000099140 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20239

DUF6596

Family of unknown function (DUF6596)

183

284

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

15

82

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.8635 323 409
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.8577 323 409
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.8292 299 391
6hpg-assembly4.cif.gz_D arabidopsis om64 tpr domain 0.8202 289 410
2kcv-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8199 323 407
ID Description Score Start End Superfamily
af_Q9UNE7_24_139_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8569 289 391 1.25.40.10
af_Q8NEE8_336_416_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.849 332 415 1.25.40.10
af_Q55DX2_466_577_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8481 325 415 1.25.40.10
af_Q0JL44_1_135_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8467 289 413 1.25.40.10
af_F1QE50_437_553_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8466 312 409 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A441UZE5-F1-model_v4 RNA polymerase subunit sigma-70 0.9772 251 410
AF-A0A434RA23-F1-model_v4 RNA polymerase subunit sigma-70 0.9767 253 409
AF-A0A3S1MXC8-F1-model_v4 RNA polymerase subunit sigma-70 0.9732 219 409
AF-A0A434D706-F1-model_v4 RNA polymerase subunit sigma-70 0.9661 206 409
AF-A0A0F8YN00-F1-model_v4 Bacterial transcriptional activator domain-containing protein 0.9654 307 407

Feature Viewer

pLDDT pTM Quality
87.03 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map