F295005

General Info

Members Datasets Scaffolds Average Seq Length
192 162 384 264

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10003159|Ga0065714_100031594
Length 262
Sequence MNIDFTGRHVLVTGSTSGIGFATAKGFLEAGAQVVINGRSASSVEDALQRLGALASRADGFVGDLSNAPGCQALIAKYPRFDIVINNLGIFKLEDFFETPDSEWLRFFETNVMSGVRVSRAYAPGMVERGWGRIVFVSSESGVNIPADMIHYGFTKTAQLSIARGLAKRLAGTGVTVNSVLPGPTLSEGVAQMLQADVERTGDSLEKVAADFVNQHRSTSIIQRAARVEEVANMIIYASSEQASATTGAALRVDGGVVDSIV

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
131 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
145 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
146 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
147 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
148 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
149 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
150 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
151 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
152 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
153 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
154 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
155 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
156 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
157 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
158 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
159 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
160 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
161 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
162 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.1
Metatranscriptomes 0
Isolates 9.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 14.58
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10003159 3300005288 Bacteria 8273
2 SwRhRL2b_contig_831264 2162886007 Bacteria 7212
3 JGI24751J29686_10000021 3300002459 Bacteria 104690
4 Ga0065704_10000760 3300005289 Bacteria 14436
5 Ga0065707_10082022 3300005295 Bacteria 24379
6 Ga0070658_10664736 3300005327 Bacteria 904
7 Ga0070670_100000006 3300005331 Bacteria 319420
8 Ga0070670_100159738 3300005331 Bacteria 1953
9 Ga0070682_100272221 3300005337 Bacteria 1231
10 Ga0070668_100427156 3300005347 Bacteria 1135
11 Ga0070675_100726208 3300005354 Bacteria 905
12 Ga0070700_100311111 3300005441 Bacteria 1153
13 Ga0070708_100075937 3300005445 Bacteria 3033
14 Ga0070678_100050004 3300005456 Bacteria 3021
15 Ga0070707_100001619 3300005468 Bacteria 21827
16 Ga0070699_100046584 3300005518 Bacteria 3751
17 Ga0070679_100176705 3300005530 Bacteria 2107
18 Ga0070686_100000248 3300005544 Bacteria 36833
19 Ga0070695_100130426 3300005545 Bacteria 1732
20 Ga0068855_100011579 3300005563 Bacteria 10652
21 Ga0068859_100011338 3300005617 Bacteria 8969
22 Ga0068864_100000014 3300005618 Bacteria 308927
23 Ga0068861_100000858 3300005719 Bacteria 18407
24 Ga0068861_100008272 3300005719 Bacteria 7158
25 Ga0068861_100019602 3300005719 Bacteria 4831
26 Ga0068861_100041355 3300005719 Bacteria 3452
27 Ga0068858_100088978 3300005842 Bacteria 2873
28 Ga0068858_100521553 3300005842 Bacteria 1149
29 Ga0068860_100322530 3300005843 Bacteria 1516
30 Ga0068862_100078058 3300005844 Bacteria 2868
31 Ga0081539_10018141 3300005985 Bacteria 4900
32 Ga0070717_10000008 3300006028 Bacteria 299056
33 Ga0075362_10138119 3300006177 Bacteria 1163
34 Ga0075367_10003495 3300006178 Bacteria 7500
35 Ga0075370_10057540 3300006353 Bacteria 2210
36 Ga0075430_100126204 3300006846 Bacteria 2133
37 Ga0075431_100286902 3300006847 Bacteria 1666
38 Ga0075429_100083985 3300006880 Bacteria 2775
39 Ga0097620_100011338 3300006931 Bacteria 8969
40 Ga0099795_10005264 3300007788 Bacteria 3425
41 Ga0105240_10013393 3300009093 Bacteria 11262
42 Ga0111539_10001156 3300009094 Bacteria 34931
43 Ga0105241_10052198 3300009174 Bacteria 3121
44 Ga0105238_10005285 3300009551 Bacteria 12765
45 Ga0105249_10013196 3300009553 Bacteria 7291
46 Ga0099796_10000684 3300010159 Bacteria 5966
47 Ga0163162_10361922 3300013306 Unclassified 1584
48 Ga0163162_10745039 3300013306 Bacteria 1099
49 Ga0157380_10041887 3300014326 Bacteria 3576
50 Ga0213876_10010940 3300021384 Bacteria 4860
51 Ga0207682_10060869 3300025893 Bacteria 1580
52 Ga0207654_10090962 3300025911 Bacteria 1860
53 Ga0207695_10018886 3300025913 Bacteria 7954
54 Ga0207646_10030765 3300025922 Bacteria 4864
55 Ga0207650_10000023 3300025925 Bacteria 308148
56 Ga0207650_10132364 3300025925 Bacteria 1953
57 Ga0207659_10617732 3300025926 Bacteria 925
58 Ga0207700_10547044 3300025928 Bacteria 1027
59 Ga0207644_10535313 3300025931 Bacteria 969
60 Ga0207691_10053295 3300025940 Bacteria 3693
61 Ga0207667_10012576 3300025949 Bacteria 9738
62 Ga0207667_10085955 3300025949 Bacteria 3255
63 Ga0207651_10036064 3300025960 Bacteria 3224
64 Ga0207712_10205392 3300025961 Bacteria 1565
65 Ga0207678_10427677 3300026067 Bacteria 1149
66 Ga0207708_10481741 3300026075 Bacteria 1037
67 Ga0207676_10000017 3300026095 Bacteria 308709
68 Ga0207675_100000691 3300026118 Bacteria 33312
69 Ga0207675_100007666 3300026118 Bacteria 10191
70 Ga0207675_100031170 3300026118 Bacteria 4965
71 Ga0207675_100045688 3300026118 Bacteria 4092
72 Ga0207683_10254675 3300026121 Bacteria 1602
73 Ga0209179_1005219 3300027512 Bacteria 2018
74 Ga0207428_10000183 3300027907 Bacteria 87828
75 Ga0268266_10005825 3300028379 Bacteria 11403
76 Ga0268265_10202930 3300028380 Bacteria 1721
77 Ga0268264_10465795 3300028381 Bacteria 1227
78 Ga0265334_10001508 3300028573 Bacteria 11251
79 Ga0265318_10022357 3300028577 Bacteria 2529
80 Ga0265338_10075724 3300028800 Bacteria 2854
81 Ga0265320_10152506 3300031240 Bacteria 1043
82 Ga0265325_10047373 3300031241 Bacteria 2225
83 Ga0307509_10382513 3300031507 Bacteria 1120
84 Ga0307408_100008847 3300031548 Bacteria 6649
85 Ga0265314_10033823 3300031711 Bacteria 3741
86 Ga0316576_10058051 3300031727 Bacteria 2830
87 Ga0316578_10044247 3300031728 Bacteria 2589
88 Ga0307407_10323589 3300031903 Bacteria 1083
89 Ga0307412_10022656 3300031911 Bacteria 3855
90 Ga0307416_100074924 3300032002 Bacteria 2830
91 Ga0307414_10407939 3300032004 Bacteria 1182
92 Ga0316583_10065373 3300032133 Bacteria 1273
93 Ga0373939_0004262 3300035114 Bacteria 3378
94 Ga0316584_0085042 3300036712 Bacteria 2368
95 Ga0395899_0050202 3300037312 Bacteria 3098
96 Ga0395900_0023901 3300037418 Bacteria 6254
97 Ga0395898_0019703 3300037466 Bacteria 6861
98 Ga0395905_0043383 3300037471 Bacteria 4219
99 Ga0316581_0076403 3300037588 Bacteria 1029
100 Ga0436364_0039089 3300037853 Bacteria 4023
101 Ga0436364_1269067 3300037853 Bacteria 40068
102 Ga0395901_0131718 3300038443 Bacteria 2627
103 Ga0436365_1444529 3300039437 Bacteria 6797
104 Ga0451853_0995344 3300041512 Bacteria 3596
105 Ga0495638_0039699 3300046460 Bacteria 2987
106 Ga0495642_0049878 3300046528 Bacteria 1720
107 Ga0495625_0007680 3300046660 Bacteria 9339
108 Ga0495670_0196078 3300046691 Bacteria 1068
109 Ga0495686_0000655 3300047472 Bacteria 47295
110 Ga0496100_0102509 3300048903 Bacteria 1975
111 Ga0496101_0059526 3300048904 Bacteria 2769
112 Ga0496104_0049917 3300048907 Bacteria 3946
113 Ga0496105_0174427 3300048908 Bacteria 1761
114 Ga0496106_0393260 3300048909 Bacteria 1114
115 Ga0496109_0349835 3300048912 Bacteria 1396
116 Ga0496110_0026919 3300048913 Bacteria 4925
117 Ga0496111_0079178 3300048914 Bacteria 2397
118 Ga0496111_0126792 3300048914 Bacteria 1887
119 Ga0496112_0082584 3300048915 Bacteria 3177
120 Ga0496113_0215682 3300048916 Bacteria 1528
121 Ga0496114_0125027 3300048917 Bacteria 2216
122 Ga0496114_0199090 3300048917 Bacteria 1754
123 Ga0496115_0031014 3300048918 Bacteria 4211
124 Ga0496115_0138887 3300048918 Bacteria 2004
125 Ga0496125_0116223 3300048928 Bacteria 1921
126 Ga0501031_0096565 3300049568 Bacteria 1928
127 Ga0501032_0037028 3300049569 Bacteria 3328
128 Ga0501033_0007591 3300049570 Bacteria 8433
129 Ga0501033_0039744 3300049570 Bacteria 3514
130 Ga0501034_0001701 3300049571 Bacteria 28339
131 Ga0501034_0016399 3300049571 Bacteria 7605
132 Ga0501036_0009985 3300049572 Bacteria 7818
133 Ga0501036_0100442 3300049572 Bacteria 2447
134 Ga0501036_0130859 3300049572 Bacteria 2119
135 Ga0501037_0002415 3300049573 Bacteria 13503
136 Ga0501037_0007858 3300049573 Bacteria 7813
137 Ga0501038_0001659 3300049574 Bacteria 20640
138 Ga0501038_0048902 3300049574 Bacteria 3658
139 Ga0501039_0031492 3300049575 Bacteria 4089
140 Ga0501039_0080695 3300049575 Bacteria 2532
141 Ga0501042_0025398 3300049578 Bacteria 4161
142 Ga0501043_0025278 3300049579 Bacteria 4659
143 Ga0501046_0001106 3300049580 Bacteria 26399
144 Ga0501048_0021707 3300049582 Bacteria 4698
145 Ga0501067_0002707 3300049583 Bacteria 9777
146 Ga0501068_0039567 3300049584 Bacteria 2827
147 Ga0501068_0265356 3300049584 Bacteria 1096
148 Ga0501068_0335983 3300049584 Bacteria 970
149 Ga0501070_0012263 3300049586 Bacteria 7233
150 Ga0501070_0029881 3300049586 Bacteria 4565
151 Ga0501073_0007391 3300049589 Bacteria 8167
152 Ga0501074_0002138 3300049590 Bacteria 13664
153 Ga0501074_0006792 3300049590 Bacteria 8260
154 Ga0501076_0461912 3300049592 Bacteria 1045
155 Ga0501079_0029852 3300049741 Bacteria 4188
156 Ga0501241_000347 3300049758 Bacteria 10205
157 Ga0501269_006809 3300049766 Bacteria 1379
158 Ga0501035_0016544 3300049822 Bacteria 6799
159 Ga0501035_0085917 3300049822 Bacteria 2772
160 Ga0501044_0022770 3300049823 Bacteria 6671
161 Ga0501045_0069108 3300049824 Bacteria 2596
162 nmdc:mga0k408_149_c1 3300050493 Bacteria 35639
163 nmdc:mga07m45_108153_c1 3300050496 Bacteria 1600
164 nmdc:mga08y16_10732_c1 3300050511 Bacteria 9613
165 Ga0500583_0010753 3300053092 Bacteria 3413
166 Ga0500641_0105184 3300053096 Bacteria 1212
167 Ga0500588_0147601 3300053146 Bacteria 849
168 Ga0500616_0000016 3300053153 Bacteria 627087
169 Ga0500616_0006312 3300053153 Bacteria 7785
170 Ga0500616_0016045 3300053153 Bacteria 4273
171 Ga0501084_0199119 3300054114 Bacteria 1690
172 Ga0501084_0209138 3300054114 Bacteria 1646
173 Ga0501082_0023004 3300060353 Bacteria 5373
174 2511821989 2511231156 Bacteria 6845832
175 2599767838 2599185248 Bacteria 6696816
176 2599887846 2599185289 Bacteria 6778765
177 2599899463 2599185291 Bacteria 6775623
178 2599933205 2599185300 Bacteria 6062622
179 2599962113 2599185305 Bacteria 6748700
180 2599966378 2599185306 Bacteria 6637356
181 2599977227 2599185308 Bacteria 6621546
182 2600007207 2599185313 Bacteria 6658188
183 2600011340 2599185314 Bacteria 6621749
184 2600019485 2599185315 Bacteria 6771107
185 2600053995 2599185321 Bacteria 6764560
186 2600072017 2599185324 Bacteria 6590677
187 2644282909 2643221650 Bacteria 7029547
188 2671091967 2667528170 Bacteria 6786960
189 2718633854 2718217725 Bacteria 5758958
190 2825654755 2825651385 Bacteria 6715909
191 2913036849 2913036834 Bacteria 6704877
192 2919487268 2919481497 Bacteria 6907839
193 Ga0065714_10003159
194 SwRhRL2b_contig_831264
195 JGI24751J29686_10000021
196 Ga0065704_10000760
197 Ga0065707_10082022
198 Ga0070658_10664736
199 Ga0070670_100000006
200 Ga0070670_100159738
201 Ga0070682_100272221
202 Ga0070668_100427156
203 Ga0070675_100726208
204 Ga0070700_100311111
205 Ga0070708_100075937
206 Ga0070678_100050004
207 Ga0070707_100001619
208 Ga0070699_100046584
209 Ga0070679_100176705
210 Ga0070686_100000248
211 Ga0070695_100130426
212 Ga0068855_100011579
213 Ga0068859_100011338
214 Ga0068864_100000014
215 Ga0068861_100000858
216 Ga0068861_100008272
217 Ga0068861_100019602
218 Ga0068861_100041355
219 Ga0068858_100088978
220 Ga0068858_100521553
221 Ga0068860_100322530
222 Ga0068862_100078058
223 Ga0081539_10018141
224 Ga0070717_10000008
225 Ga0075362_10138119
226 Ga0075367_10003495
227 Ga0075370_10057540
228 Ga0075430_100126204
229 Ga0075431_100286902
230 Ga0075429_100083985
231 Ga0097620_100011338
232 Ga0099795_10005264
233 Ga0105240_10013393
234 Ga0111539_10001156
235 Ga0105241_10052198
236 Ga0105238_10005285
237 Ga0105249_10013196
238 Ga0099796_10000684
239 Ga0163162_10361922
240 Ga0163162_10745039
241 Ga0157380_10041887
242 Ga0213876_10010940
243 Ga0207682_10060869
244 Ga0207654_10090962
245 Ga0207695_10018886
246 Ga0207646_10030765
247 Ga0207650_10000023
248 Ga0207650_10132364
249 Ga0207659_10617732
250 Ga0207700_10547044
251 Ga0207644_10535313
252 Ga0207691_10053295
253 Ga0207667_10012576
254 Ga0207667_10085955
255 Ga0207651_10036064
256 Ga0207712_10205392
257 Ga0207678_10427677
258 Ga0207708_10481741
259 Ga0207676_10000017
260 Ga0207675_100000691
261 Ga0207675_100007666
262 Ga0207675_100031170
263 Ga0207675_100045688
264 Ga0207683_10254675
265 Ga0209179_1005219
266 Ga0207428_10000183
267 Ga0268266_10005825
268 Ga0268265_10202930
269 Ga0268264_10465795
270 Ga0265334_10001508
271 Ga0265318_10022357
272 Ga0265338_10075724
273 Ga0265320_10152506
274 Ga0265325_10047373
275 Ga0307509_10382513
276 Ga0307408_100008847
277 Ga0265314_10033823
278 Ga0316576_10058051
279 Ga0316578_10044247
280 Ga0307407_10323589
281 Ga0307412_10022656
282 Ga0307416_100074924
283 Ga0307414_10407939
284 Ga0316583_10065373
285 Ga0373939_0004262
286 Ga0316584_0085042
287 Ga0395899_0050202
288 Ga0395900_0023901
289 Ga0395898_0019703
290 Ga0395905_0043383
291 Ga0316581_0076403
292 Ga0436364_0039089
293 Ga0436364_1269067
294 Ga0395901_0131718
295 Ga0436365_1444529
296 Ga0451853_0995344
297 Ga0495638_0039699
298 Ga0495642_0049878
299 Ga0495625_0007680
300 Ga0495670_0196078
301 Ga0495686_0000655
302 Ga0496100_0102509
303 Ga0496101_0059526
304 Ga0496104_0049917
305 Ga0496105_0174427
306 Ga0496106_0393260
307 Ga0496109_0349835
308 Ga0496110_0026919
309 Ga0496111_0079178
310 Ga0496111_0126792
311 Ga0496112_0082584
312 Ga0496113_0215682
313 Ga0496114_0125027
314 Ga0496114_0199090
315 Ga0496115_0031014
316 Ga0496115_0138887
317 Ga0496125_0116223
318 Ga0501031_0096565
319 Ga0501032_0037028
320 Ga0501033_0007591
321 Ga0501033_0039744
322 Ga0501034_0001701
323 Ga0501034_0016399
324 Ga0501036_0009985
325 Ga0501036_0100442
326 Ga0501036_0130859
327 Ga0501037_0002415
328 Ga0501037_0007858
329 Ga0501038_0001659
330 Ga0501038_0048902
331 Ga0501039_0031492
332 Ga0501039_0080695
333 Ga0501042_0025398
334 Ga0501043_0025278
335 Ga0501046_0001106
336 Ga0501048_0021707
337 Ga0501067_0002707
338 Ga0501068_0039567
339 Ga0501068_0265356
340 Ga0501068_0335983
341 Ga0501070_0012263
342 Ga0501070_0029881
343 Ga0501073_0007391
344 Ga0501074_0002138
345 Ga0501074_0006792
346 Ga0501076_0461912
347 Ga0501079_0029852
348 Ga0501241_000347
349 Ga0501269_006809
350 Ga0501035_0016544
351 Ga0501035_0085917
352 Ga0501044_0022770
353 Ga0501045_0069108
354 nmdc:mga0k408_149_c1
355 nmdc:mga07m45_108153_c1
356 nmdc:mga08y16_10732_c1
357 Ga0500583_0010753
358 Ga0500641_0105184
359 Ga0500588_0147601
360 Ga0500616_0000016
361 Ga0500616_0006312
362 Ga0500616_0016045
363 Ga0501084_0199119
364 Ga0501084_0209138
365 Ga0501082_0023004
366 2511821989
367 2599767838
368 2599887846
369 2599899463
370 2599933205
371 2599962113
372 2599966378
373 2599977227
374 2600007207
375 2600011340
376 2600019485
377 2600053995
378 2600072017
379 2644282909
380 2671091967
381 2718633854
382 2825654755
383 2913036849
384 2919487268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

198

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

14

258

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

10

157

0.86

PF08659

KR

KR domain

9

180

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9522 1 255
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9435 1 255
4m8s-assembly1.cif.gz_B crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.9209 4 256
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9209 3 257
5cdy-assembly1.cif.gz_D the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9209 3 256
ID Description Score Start End Superfamily
af_Q869Y3_41_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9337 7 188 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9318 2 179 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 4 158 3.40.50.720
af_Q53GQ0_49_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9273 7 185 3.40.50.720
af_Q17704_43_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 8 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1C3WDI0-F1-model_v4 Short chain dehydrogenase 0.9873 1 164 GO:0016491
AF-A0A356PIE7-F1-model_v4 deleted 0.9833 1 184
AF-A0A2D5RDC0-F1-model_v4 deleted 0.9729 1 188
AF-A0A562U4X0-F1-model_v4 Short subunit dehydrogenase 0.9684 1 186 GO:0016491
AF-A0A356PIE7-F1-model_v4 deleted 0.9677 1 184

Map