F294711

General Info

Members Datasets Scaffolds Average Seq Length
191 135 382 135

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0561508|Ga0501047_0561508_13_462
Length 149
Sequence VAVYLPILNLTGSKPMPAADVFFDTNVLLYLLSADSRKADIAERLLSDGGIISVQVLNEFAAVASHKLKMKWAEITEILVPIKALCTVTDLSLATHEQALLIAERYGFSIYDSLIVSAAIAAGCKKLYSEDLQHGQRINRSLIIDNPFK

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.52
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 0
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0561508 3300049581 Bacteria 965
2 JGI25406J46586_10017574 3300003203 Bacteria 2954
3 Ga0070683_101996846 3300005329 Bacteria 557
4 Ga0070680_100181394 3300005336 Bacteria 1773
5 Ga0070669_100079827 3300005353 Bacteria 2434
6 Ga0070669_100314402 3300005353 Bacteria 1263
7 Ga0070675_100338354 3300005354 Bacteria 1333
8 Ga0070675_100585555 3300005354 Bacteria 1011
9 Ga0070671_100157221 3300005355 Bacteria 1921
10 Ga0070674_100594787 3300005356 Bacteria 934
11 Ga0070673_100408214 3300005364 Bacteria 1216
12 Ga0070667_100024229 3300005367 Bacteria 5041
13 Ga0070667_100949176 3300005367 Unclassified 801
14 Ga0070678_100564851 3300005456 Bacteria 1012
15 Ga0070678_101530017 3300005456 Bacteria 625
16 Ga0070681_10253378 3300005458 Bacteria 1672
17 Ga0070684_100972944 3300005535 Bacteria 796
18 Ga0070684_101133004 3300005535 Unclassified 735
19 Ga0070693_100532476 3300005547 Bacteria 838
20 Ga0070665_100084496 3300005548 Bacteria 3180
21 Ga0068855_100067275 3300005563 Bacteria 4175
22 Ga0068855_100106245 3300005563 Unclassified 3227
23 Ga0068855_100384478 3300005563 Bacteria 1540
24 Ga0068856_100749220 3300005614 Bacteria 997
25 Ga0068856_101224533 3300005614 Unclassified 767
26 Ga0068856_101524768 3300005614 Unclassified 682
27 Ga0068859_100029735 3300005617 Bacteria 5481
28 Ga0068859_101618238 3300005617 Unclassified 715
29 Ga0068864_100083027 3300005618 Bacteria 2813
30 Ga0068864_100595855 3300005618 Bacteria 1072
31 Ga0068864_100945418 3300005618 Bacteria 853
32 Ga0068861_100022727 3300005719 Bacteria 4522
33 Ga0068861_100818048 3300005719 Unclassified 876
34 Ga0068863_100435273 3300005841 Bacteria 1286
35 Ga0068860_100016951 3300005843 Bacteria 7101
36 Ga0068862_100057617 3300005844 Bacteria 3333
37 Ga0081455_10233944 3300005937 Bacteria 1354
38 Ga0081455_10954631 3300005937 Bacteria 532
39 Ga0081539_10002783 3300005985 Bacteria 23498
40 Ga0068871_100828500 3300006358 Unclassified 854
41 Ga0068871_102078435 3300006358 Bacteria 541
42 Ga0075428_100508742 3300006844 Bacteria 1288
43 Ga0075430_100146300 3300006846 Bacteria 1968
44 Ga0075430_100310761 3300006846 Bacteria 1303
45 Ga0075430_101300347 3300006846 Bacteria 598
46 Ga0075431_100438470 3300006847 Bacteria 1303
47 Ga0075431_100752100 3300006847 Bacteria 950
48 Ga0075433_10521305 3300006852 Bacteria 1045
49 Ga0075433_10577393 3300006852 Unclassified 987
50 Ga0075433_10943681 3300006852 Bacteria 752
51 Ga0075434_102069792 3300006871 Bacteria 574
52 Ga0075429_100009135 3300006880 Bacteria 8605
53 Ga0075429_100067290 3300006880 Bacteria 3117
54 Ga0075436_100152759 3300006914 Bacteria 1625
55 Ga0097620_100029735 3300006931 Bacteria 5481
56 Ga0097620_101618252 3300006931 Unclassified 715
57 Ga0075435_100041753 3300007076 Bacteria 3667
58 Ga0075435_100271503 3300007076 Unclassified 1447
59 Ga0099794_10120031 3300007265 Unclassified 1322
60 Ga0105240_10018552 3300009093 Bacteria 9338
61 Ga0111539_10153595 3300009094 Bacteria 2694
62 Ga0105245_10771106 3300009098 Unclassified 998
63 Ga0114129_10798226 3300009147 Bacteria 1204
64 Ga0114129_11039772 3300009147 Bacteria 1029
65 Ga0105243_10122118 3300009148 Bacteria 2198
66 Ga0105241_10241600 3300009174 Bacteria 1527
67 Ga0105248_10083562 3300009177 Bacteria 3592
68 Ga0105238_10338139 3300009551 Viruses 1493
69 Ga0105238_10594224 3300009551 Bacteria 1114
70 Ga0105238_11855085 3300009551 Bacteria 635
71 Ga0099796_10328929 3300010159 Unclassified 654
72 Ga0157369_10002224 3300013105 Bacteria 23356
73 Ga0157369_10887152 3300013105 Bacteria 915
74 Ga0157378_10260640 3300013297 Bacteria 1663
75 Ga0163162_10628734 3300013306 Bacteria 1198
76 Ga0157372_10008934 3300013307 Bacteria 10648
77 Ga0157372_10048425 3300013307 Bacteria 4725
78 Ga0157372_10689147 3300013307 Bacteria 1189
79 Ga0157375_10839336 3300013308 Bacteria 1066
80 Ga0163163_10011278 3300014325 Bacteria 8100
81 Ga0157380_12681543 3300014326 Unclassified 565
82 Ga0157377_10270144 3300014745 Unclassified 1110
83 Ga0157377_11207025 3300014745 Unclassified 586
84 Ga0157379_11386381 3300014968 Bacteria 681
85 Ga0213876_10000665 3300021384 Bacteria 24591
86 Ga0213875_10230249 3300021388 Bacteria 873
87 Ga0207680_10000436 3300025903 Bacteria 19743
88 Ga0207654_10449354 3300025911 Bacteria 904
89 Ga0207695_10028689 3300025913 Bacteria 6161
90 Ga0207657_10649154 3300025919 Bacteria 821
91 Ga0207652_10071363 3300025921 Bacteria 3017
92 Ga0207681_10321753 3300025923 Bacteria 1230
93 Ga0207694_10526560 3300025924 Bacteria 991
94 Ga0207694_11213799 3300025924 Bacteria 638
95 Ga0207659_10244485 3300025926 Bacteria 1453
96 Ga0207659_10911637 3300025926 Bacteria 756
97 Ga0207644_10111530 3300025931 Bacteria 2069
98 Ga0207644_10255746 3300025931 Unclassified 1399
99 Ga0207706_10633921 3300025933 Bacteria 916
100 Ga0207661_10248785 3300025944 Bacteria 1579
101 Ga0207667_10052206 3300025949 Bacteria 4308
102 Ga0207667_10133428 3300025949 Unclassified 2558
103 Ga0207667_11013432 3300025949 Unclassified 817
104 Ga0207658_10345394 3300025986 Bacteria 1294
105 Ga0207658_11457752 3300025986 Unclassified 626
106 Ga0207639_11285397 3300026041 Unclassified 687
107 Ga0207702_10431086 3300026078 Bacteria 1276
108 Ga0207702_10845972 3300026078 Bacteria 905
109 Ga0207648_10176137 3300026089 Bacteria 1892
110 Ga0207676_10147427 3300026095 Bacteria 2022
111 Ga0207676_11182988 3300026095 Unclassified 757
112 Ga0207675_100017209 3300026118 Bacteria 6751
113 Ga0207683_10640730 3300026121 Bacteria 984
114 Ga0207683_11286482 3300026121 Bacteria 677
115 Ga0207428_10013330 3300027907 Bacteria 7187
116 Ga0268266_10175075 3300028379 Bacteria 1950
117 Ga0268265_10310652 3300028380 Bacteria 1423
118 Ga0268264_10043258 3300028381 Bacteria 3731
119 Ga0265338_10016002 3300028800 Bacteria 8196
120 Ga0265762_1072091 3300030760 Bacteria 727
121 Ga0265332_10191418 3300031238 Bacteria 851
122 Ga0265328_10062069 3300031239 Bacteria 1372
123 Ga0265320_10293886 3300031240 Unclassified 719
124 Ga0265339_10003633 3300031249 Bacteria 10765
125 Ga0265339_10044272 3300031249 Bacteria 2456
126 Ga0265339_10113712 3300031249 Bacteria 1398
127 Ga0265327_10078003 3300031251 Bacteria 1642
128 Ga0265327_10193197 3300031251 Bacteria 925
129 Ga0265316_10060217 3300031344 Bacteria 2951
130 Ga0265313_10161140 3300031595 Unclassified 953
131 Ga0265314_10024046 3300031711 Bacteria 4628
132 Ga0316576_10975147 3300031727 Bacteria 605
133 Ga0307516_10000405 3300031730 Bacteria 56495
134 Ga0307414_10199857 3300032004 Bacteria 1625
135 Ga0307411_10699481 3300032005 Bacteria 883
136 Ga0373928_0234550 3300035084 Bacteria 541
137 Ga0316574_0144959 3300035398 Bacteria 1530
138 Ga0316574_0290414 3300035398 Bacteria 1041
139 Ga0316584_0177734 3300036712 Unclassified 1576
140 Ga0395899_0188863 3300037312 Bacteria 1442
141 Ga0395900_0711029 3300037418 Bacteria 937
142 Ga0395898_0000051 3300037466 Bacteria 281872
143 Ga0395898_0518240 3300037466 Bacteria 1133
144 Ga0436364_0342628 3300037853 Bacteria 1225
145 Ga0436364_0527121 3300037853 Unclassified 604
146 Ga0436364_1314290 3300037853 Bacteria 4843
147 Ga0395901_0283839 3300038443 Bacteria 1719
148 Ga0400484_33215 3300038725 Bacteria 3345
149 Ga0400489_06279 3300039093 Bacteria 1581
150 Ga0436365_0973964 3300039437 Bacteria 3596
151 Ga0436365_1800862 3300039437 Bacteria 31376
152 Ga0436361_0850941 3300039447 Bacteria 924
153 Ga0436363_1160640 3300039450 Bacteria 6225
154 Ga0495640_0869357 3300046533 Unclassified 535
155 Ga0501039_0543553 3300049575 Bacteria 912
156 Ga0501040_0088399 3300049576 Bacteria 2152
157 Ga0501041_0032829 3300049577 Bacteria 3138
158 Ga0501042_0931444 3300049578 Unclassified 633
159 Ga0501046_0131873 3300049580 Bacteria 1895
160 Ga0501067_0007332 3300049583 Bacteria 6127
161 Ga0501068_0295950 3300049584 Bacteria 1036
162 Ga0501072_0481401 3300049588 Bacteria 982
163 Ga0501075_0507684 3300049591 Bacteria 920
164 Ga0501079_0228167 3300049741 Bacteria 1455
165 Ga0501079_0328259 3300049741 Bacteria 1198
166 Ga0501079_1245876 3300049741 Bacteria 586
167 Ga0501080_0400415 3300049742 Bacteria 1235
168 Ga0501083_0810276 3300049744 Bacteria 609
169 Ga0501035_0138207 3300049822 Bacteria 2120
170 Ga0501045_0175608 3300049824 Bacteria 1596
171 nmdc:mga09592_24810_c1 3300050508 Bacteria 4958
172 nmdc:mga09592_27683_c1 3300050508 Bacteria 2783
173 nmdc:mga0qj67_1587418_c1 3300050509 Bacteria 502
174 nmdc:mga0qj67_192858_c1 3300050509 Bacteria 1656
175 nmdc:mga0qj67_559453_c1 3300050509 Unclassified 917
176 nmdc:mga06r32_121150_c1 3300050510 Bacteria 2581
177 nmdc:mga06r32_1820998_c1 3300050510 Unclassified 544
178 nmdc:mga06r32_679448_c1 3300050510 Bacteria 996
179 nmdc:mga08y16_11265_c1 3300050511 Bacteria 9393
180 nmdc:mga0rr50_460012_c1 3300050513 Unclassified 1079
181 nmdc:mga08x19_145275_c1 3300050514 Bacteria 1604
182 nmdc:mga0a205_428192_c1 3300050515 Bacteria 1185
183 Ga0500607_013923 3300053121 Bacteria 4687
184 Ga0500559_0081653 3300053136 Bacteria 1470
185 Ga0500636_0000673 3300053177 Bacteria 18364
186 Ga0500637_0077340 3300053178 Bacteria 1919
187 Ga0501084_0146535 3300054114 Bacteria 1989
188 Ga0501084_0836527 3300054114 Bacteria 775
189 Ga0501082_0493075 3300060353 Bacteria 1071
190 Ga0501082_1097354 3300060353 Bacteria 696
191 2821450825 2821443989 Bacteria 7658172
192 Ga0501047_0561508
193 JGI25406J46586_10017574
194 Ga0070683_101996846
195 Ga0070680_100181394
196 Ga0070669_100079827
197 Ga0070669_100314402
198 Ga0070675_100338354
199 Ga0070675_100585555
200 Ga0070671_100157221
201 Ga0070674_100594787
202 Ga0070673_100408214
203 Ga0070667_100024229
204 Ga0070667_100949176
205 Ga0070678_100564851
206 Ga0070678_101530017
207 Ga0070681_10253378
208 Ga0070684_100972944
209 Ga0070684_101133004
210 Ga0070693_100532476
211 Ga0070665_100084496
212 Ga0068855_100067275
213 Ga0068855_100106245
214 Ga0068855_100384478
215 Ga0068856_100749220
216 Ga0068856_101224533
217 Ga0068856_101524768
218 Ga0068859_100029735
219 Ga0068859_101618238
220 Ga0068864_100083027
221 Ga0068864_100595855
222 Ga0068864_100945418
223 Ga0068861_100022727
224 Ga0068861_100818048
225 Ga0068863_100435273
226 Ga0068860_100016951
227 Ga0068862_100057617
228 Ga0081455_10233944
229 Ga0081455_10954631
230 Ga0081539_10002783
231 Ga0068871_100828500
232 Ga0068871_102078435
233 Ga0075428_100508742
234 Ga0075430_100146300
235 Ga0075430_100310761
236 Ga0075430_101300347
237 Ga0075431_100438470
238 Ga0075431_100752100
239 Ga0075433_10521305
240 Ga0075433_10577393
241 Ga0075433_10943681
242 Ga0075434_102069792
243 Ga0075429_100009135
244 Ga0075429_100067290
245 Ga0075436_100152759
246 Ga0097620_100029735
247 Ga0097620_101618252
248 Ga0075435_100041753
249 Ga0075435_100271503
250 Ga0099794_10120031
251 Ga0105240_10018552
252 Ga0111539_10153595
253 Ga0105245_10771106
254 Ga0114129_10798226
255 Ga0114129_11039772
256 Ga0105243_10122118
257 Ga0105241_10241600
258 Ga0105248_10083562
259 Ga0105238_10338139
260 Ga0105238_10594224
261 Ga0105238_11855085
262 Ga0099796_10328929
263 Ga0157369_10002224
264 Ga0157369_10887152
265 Ga0157378_10260640
266 Ga0163162_10628734
267 Ga0157372_10008934
268 Ga0157372_10048425
269 Ga0157372_10689147
270 Ga0157375_10839336
271 Ga0163163_10011278
272 Ga0157380_12681543
273 Ga0157377_10270144
274 Ga0157377_11207025
275 Ga0157379_11386381
276 Ga0213876_10000665
277 Ga0213875_10230249
278 Ga0207680_10000436
279 Ga0207654_10449354
280 Ga0207695_10028689
281 Ga0207657_10649154
282 Ga0207652_10071363
283 Ga0207681_10321753
284 Ga0207694_10526560
285 Ga0207694_11213799
286 Ga0207659_10244485
287 Ga0207659_10911637
288 Ga0207644_10111530
289 Ga0207644_10255746
290 Ga0207706_10633921
291 Ga0207661_10248785
292 Ga0207667_10052206
293 Ga0207667_10133428
294 Ga0207667_11013432
295 Ga0207658_10345394
296 Ga0207658_11457752
297 Ga0207639_11285397
298 Ga0207702_10431086
299 Ga0207702_10845972
300 Ga0207648_10176137
301 Ga0207676_10147427
302 Ga0207676_11182988
303 Ga0207675_100017209
304 Ga0207683_10640730
305 Ga0207683_11286482
306 Ga0207428_10013330
307 Ga0268266_10175075
308 Ga0268265_10310652
309 Ga0268264_10043258
310 Ga0265338_10016002
311 Ga0265762_1072091
312 Ga0265332_10191418
313 Ga0265328_10062069
314 Ga0265320_10293886
315 Ga0265339_10003633
316 Ga0265339_10044272
317 Ga0265339_10113712
318 Ga0265327_10078003
319 Ga0265327_10193197
320 Ga0265316_10060217
321 Ga0265313_10161140
322 Ga0265314_10024046
323 Ga0316576_10975147
324 Ga0307516_10000405
325 Ga0307414_10199857
326 Ga0307411_10699481
327 Ga0373928_0234550
328 Ga0316574_0144959
329 Ga0316574_0290414
330 Ga0316584_0177734
331 Ga0395899_0188863
332 Ga0395900_0711029
333 Ga0395898_0000051
334 Ga0395898_0518240
335 Ga0436364_0342628
336 Ga0436364_0527121
337 Ga0436364_1314290
338 Ga0395901_0283839
339 Ga0400484_33215
340 Ga0400489_06279
341 Ga0436365_0973964
342 Ga0436365_1800862
343 Ga0436361_0850941
344 Ga0436363_1160640
345 Ga0495640_0869357
346 Ga0501039_0543553
347 Ga0501040_0088399
348 Ga0501041_0032829
349 Ga0501042_0931444
350 Ga0501046_0131873
351 Ga0501067_0007332
352 Ga0501068_0295950
353 Ga0501072_0481401
354 Ga0501075_0507684
355 Ga0501079_0228167
356 Ga0501079_0328259
357 Ga0501079_1245876
358 Ga0501080_0400415
359 Ga0501083_0810276
360 Ga0501035_0138207
361 Ga0501045_0175608
362 nmdc:mga09592_24810_c1
363 nmdc:mga09592_27683_c1
364 nmdc:mga0qj67_1587418_c1
365 nmdc:mga0qj67_192858_c1
366 nmdc:mga0qj67_559453_c1
367 nmdc:mga06r32_121150_c1
368 nmdc:mga06r32_1820998_c1
369 nmdc:mga06r32_679448_c1
370 nmdc:mga08y16_11265_c1
371 nmdc:mga0rr50_460012_c1
372 nmdc:mga08x19_145275_c1
373 nmdc:mga0a205_428192_c1
374 Ga0500607_013923
375 Ga0500559_0081653
376 Ga0500636_0000673
377 Ga0500637_0077340
378 Ga0501084_0146535
379 Ga0501084_0836527
380 Ga0501082_0493075
381 Ga0501082_1097354
382 2821450825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

21

137

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8349 5 131
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.8188 5 118
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8103 5 131
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7756 5 129
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.7655 5 130
ID Description Score Start End Superfamily
af_Q57813_28_119_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8968 35 68 1.10.150.130
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8274 5 115 3.40.50.1010
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.825 6 114 3.40.50.1010
af_P9WF49_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8065 5 115 3.40.50.1010
af_O50411_2_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7983 5 115 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7W5KVF2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9918 5 131 GO:0000287
GO:0004540
GO:0090729
AF-Q6N456-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9894 3 131 GO:0000287
GO:0004540
GO:0090729
AF-A0A7W1DMA4-F1-model_v4 PIN domain-containing protein 0.989 76 130
AF-A0A2S6MZM0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9857 5 132 GO:0000287
GO:0004540
GO:0090729
AF-A0A0N1EZ58-F1-model_v4 PIN domain-containing protein 0.9854 2 132

Map