F294629

General Info

Members Datasets Scaffolds Average Seq Length
191 138 160 320

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0082434|Ga0496112_0082434_1506_2678
Length 376
Sequence MVMFWVTLLAISILLYVLLDGFDLGVGILFGLTRSETRRSAMLSAVAPIWDGNETWLVVTAVILWGAFPVAYAVLLSAFYLPLPMMLAGLILRGVAFEYRNKAERMRWLWNWSFIGGSVAAAPMHGGQYTGGDFGWFSPFAGLCGIGLCLGYTLLGACWLVKKCEGDVRETAYSFIPWLSAGLLVFLVVVFAFALSEHLQVMHRWIDRLHLFIFPVIGALAVTVLAVSVRYRRDELLFPMIVFIFLAAFGTLAISFWPYIIPFVLTITDAASPPSSLAFMFWGEGLFVFPLMLLYTFVSYRVFRGKVVSLPGHYRRRLIGAIAAYSKQFPLRTPVSSKLISQPGSPLLAKGQGSCEEHSSSLRWQRFSRAILHSRR

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
7 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
10 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
11 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
12 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
13 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
14 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
15 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
16 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
17 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
18 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
19 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
20 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
21 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
22 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
23 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
24 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
25 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
26 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
135 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
136 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
137 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
138 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.25
Metatranscriptomes 0.52
Isolates 16.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.14
Nodule 10.99
Rhizoplane 2.09
Rhizosphere 56.02
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1007810 3300002070 Bacteria 1351
2 JGI25152J39213_1000162 3300002773 Bacteria 45604
3 JGI25152J39213_1000525 3300002773 Bacteria 21286
4 rootL2_10279950 3300003322 Bacteria 3969
5 JGI25404J52841_10000421 3300003659 Bacteria 5930
6 JGI25404J52841_10001838 3300003659 Bacteria 3865
7 Ga0065165_1015146 3300005262 Unclassified 2955
8 Ga0070668_100038832 3300005347 Bacteria 3641
9 Ga0070713_100020927 3300005436 Bacteria 5022
10 Ga0070710_10145872 3300005437 Bacteria 1455
11 Ga0070711_100070237 3300005439 Bacteria 2465
12 Ga0070708_100070354 3300005445 Bacteria 3147
13 Ga0070708_100089850 3300005445 Bacteria 2795
14 Ga0070707_100120047 3300005468 Bacteria 2552
15 Ga0070699_100090510 3300005518 Bacteria 2674
16 Ga0081540_1000727 3300005983 Bacteria 30338
17 Ga0081540_1000787 3300005983 Bacteria 29106
18 Ga0081540_1003949 3300005983 Bacteria 11520
19 Ga0081540_1005161 3300005983 Bacteria 9776
20 Ga0081540_1115806 3300005983 Bacteria 1123
21 Ga0070717_10005879 3300006028 Bacteria 8985
22 Ga0070717_10010317 3300006028 Bacteria 7047
23 Ga0070717_10302249 3300006028 Bacteria 1423
24 Ga0075365_10000174 3300006038 Bacteria 20745
25 Ga0075368_10008327 3300006042 Bacteria 3687
26 Ga0070712_100019356 3300006175 Bacteria 4440
27 Ga0070712_100277067 3300006175 Bacteria 1350
28 Ga0075367_10000006 3300006178 Bacteria 46123
29 Ga0075369_10000312 3300006186 Bacteria 14432
30 Ga0075366_10073361 3300006195 Bacteria 2040
31 Ga0075370_10000752 3300006353 Bacteria 12968
32 Ga0099794_10000964 3300007265 Bacteria 9706
33 Ga0099794_10001127 3300007265 Bacteria 9158
34 Ga0099794_10002781 3300007265 Bacteria 6539
35 Ga0099795_10000508 3300007788 Bacteria 7324
36 Ga0099795_10041506 3300007788 Bacteria 1638
37 Ga0099795_10042455 3300007788 Bacteria 1623
38 Ga0105245_10477596 3300009098 Bacteria 1259
39 Ga0114129_11048261 3300009147 Bacteria 1024
40 Ga0105243_10011528 3300009148 Bacteria 6688
41 Ga0105238_10287949 3300009551 Bacteria 1625
42 Ga0099796_10000344 3300010159 Bacteria 7515
43 Ga0099796_10014080 3300010159 Bacteria 2301
44 Ga0099796_10016645 3300010159 Bacteria 2175
45 Ga0099796_10046530 3300010159 Bacteria 1489
46 Ga0157375_10599621 3300013308 Bacteria 1261
47 Ga0213873_10000466 3300021358 Bacteria 6490
48 Ga0213872_10015293 3300021361 Bacteria 3571
49 Ga0213872_10032323 3300021361 Bacteria 2398
50 Ga0213872_10057971 3300021361 Bacteria 1753
51 Ga0213872_10077305 3300021361 Bacteria 1496
52 Ga0213872_10114566 3300021361 Bacteria 1195
53 Ga0209129_1000153 3300025258 Bacteria 110699
54 Ga0209129_1000746 3300025258 Bacteria 20764
55 Ga0209673_1004512 3300025273 Bacteria 7416
56 Ga0209758_1000153 3300025297 Bacteria 161668
57 Ga0209256_1009001 3300025299 Bacteria 4474
58 Ga0207426_1000390 3300025302 Bacteria 74933
59 Ga0209051_1003796 3300025303 Bacteria 9670
60 Ga0207693_10087245 3300025915 Bacteria 2445
61 Ga0207693_10158613 3300025915 Bacteria 1780
62 Ga0207693_10340148 3300025915 Bacteria 1174
63 Ga0207663_10288201 3300025916 Bacteria 1222
64 Ga0207646_10065969 3300025922 Bacteria 3231
65 Ga0207664_10157805 3300025929 Bacteria 1932
66 Ga0207709_10005422 3300025935 Bacteria 7251
67 Ga0207668_10064859 3300025972 Bacteria 2583
68 Ga0207678_10358279 3300026067 Bacteria 1259
69 Ga0209179_1001238 3300027512 Bacteria 3048
70 Ga0209179_1002685 3300027512 Bacteria 2448
71 Ga0209179_1012548 3300027512 Bacteria 1524
72 Ga0209588_1003004 3300027671 Bacteria 4647
73 Ga0209588_1034324 3300027671 Bacteria 1629
74 Ga0307511_10102276 3300030521 Bacteria 1873
75 Ga0265762_1007612 3300030760 Bacteria 1929
76 Ga0265325_10041633 3300031241 Bacteria 2406
77 Ga0307509_10000308 3300031507 Bacteria 80262
78 Ga0307509_10184764 3300031507 Bacteria 1944
79 Ga0265314_10067812 3300031711 Bacteria 2401
80 Ga0307406_10049254 3300031901 Bacteria 2665
81 Ga0307409_100002326 3300031995 Bacteria 9871
82 Ga0307510_10087443 3300033180 Bacteria 2982
83 Ga0307510_10142119 3300033180 Bacteria 2041
84 Ga0436364_0806324 3300037853 Bacteria 6767
85 Ga0436365_0715084 3300039437 Bacteria 2999
86 Ga0436360_0043534 3300039438 Bacteria 1713
87 Ga0436360_0247009 3300039438 Bacteria 2521
88 Ga0436360_0472580 3300039438 Bacteria 3213
89 Ga0436361_0112810 3300039447 Bacteria 5374
90 Ga0436361_0421961 3300039447 Bacteria 3660
91 Ga0436361_0427065 3300039447 Bacteria 2599
92 Ga0436361_0535255 3300039447 Bacteria 11934
93 Ga0436361_0574553 3300039447 Bacteria 1845
94 Ga0436361_0599598 3300039447 Bacteria 26109
95 Ga0436361_1162295 3300039447 Bacteria 2776
96 Ga0436363_0082670 3300039450 Bacteria 2304
97 Ga0436363_0198659 3300039450 Bacteria 7739
98 Ga0436363_1703453 3300039450 Bacteria 1490
99 Ga0436362_0834780 3300039453 Bacteria 1131
100 Ga0436362_0977686 3300039453 Bacteria 2815
101 Ga0495638_0062950 3300046460 Bacteria 2288
102 Ga0495605_0004869 3300046474 Bacteria 7847
103 Ga0495605_0040004 3300046474 Bacteria 2345
104 Ga0495606_0002015 3300046507 Bacteria 24938
105 Ga0495631_0027620 3300046518 Bacteria 2595
106 Ga0495632_0031725 3300046519 Bacteria 2728
107 Ga0495637_0051917 3300046520 Bacteria 1714
108 Ga0495643_0070919 3300046522 Bacteria 1829
109 Ga0495644_0059275 3300046523 Bacteria 1439
110 Ga0495648_0005167 3300046524 Bacteria 10922
111 Ga0495648_0061197 3300046524 Bacteria 2237
112 Ga0495663_0061121 3300046525 Bacteria 1185
113 Ga0495598_0004590 3300046537 Bacteria 3003
114 Ga0495609_0013468 3300046538 Bacteria 3860
115 Ga0495668_0052775 3300046616 Bacteria 2249
116 Ga0495611_0010171 3300046648 Bacteria 3980
117 Ga0495625_0005401 3300046660 Bacteria 11677
118 Ga0495659_0004592 3300046664 Bacteria 4345
119 Ga0495661_0065806 3300046665 Bacteria 2135
120 Ga0495669_0012648 3300046684 Bacteria 3593
121 Ga0495670_0011293 3300046691 Bacteria 4391
122 Ga0495671_0068750 3300046692 Bacteria 1741
123 Ga0495672_0022846 3300047320 Bacteria 4058
124 Ga0495672_0032560 3300047320 Bacteria 3241
125 Ga0495672_0131696 3300047320 Bacteria 1315
126 Ga0495683_0011634 3300047323 Bacteria 4631
127 Ga0495677_0041795 3300047445 Bacteria 1678
128 Ga0495673_0007087 3300047469 Bacteria 6496
129 Ga0495673_0021243 3300047469 Bacteria 3211
130 Ga0495686_0248353 3300047472 Bacteria 1001
131 Ga0496109_0300581 3300048912 Bacteria 1513
132 Ga0496110_0040958 3300048913 Bacteria 4039
133 Ga0496112_0082434 3300048915 Bacteria 3181
134 Ga0496115_0176278 3300048918 Bacteria 1768
135 Ga0496117_0113224 3300048920 Bacteria 1685
136 Ga0496118_0017888 3300048921 Bacteria 6430
137 Ga0496118_0211703 3300048921 Bacteria 1137
138 Ga0496119_0041305 3300048922 Bacteria 2939
139 Ga0496121_0000178 3300048924 Bacteria 141429
140 Ga0496121_0004762 3300048924 Bacteria 17911
141 Ga0496121_0009421 3300048924 Bacteria 11226
142 Ga0496121_0062895 3300048924 Bacteria 3037
143 Ga0496122_0049567 3300048925 Bacteria 3213
144 Ga0496123_0137688 3300048926 Bacteria 1341
145 Ga0496124_0009765 3300048927 Bacteria 9820
146 Ga0496126_0004671 3300048929 Bacteria 16196
147 Ga0496126_0011473 3300048929 Bacteria 9167
148 Ga0495682_0001374 3300049460 Bacteria 13319
149 Ga0495682_0048766 3300049460 Bacteria 1543
150 nmdc:mga00v17_19629_c2 3300050491 Bacteria 2080
151 nmdc:mga0yw44_38_c1 3300050492 Bacteria 46328
152 nmdc:mga0yw44_45867_c1 3300050492 Bacteria 2622
153 nmdc:mga0k408_34003_c1 3300050493 Bacteria 2917
154 nmdc:mga06z11_38_c1 3300050494 Bacteria 54827
155 nmdc:mga04h51_3862_c1 3300050495 Bacteria 3682
156 nmdc:mga07m45_915_c1 3300050496 Bacteria 12899
157 nmdc:mga0sz30_163_c1 3300050516 Bacteria 24506
158 Ga0500595_001432 3300053119 Bacteria 12792
159 Ga0500577_0096658 3300053142 Bacteria 1202
160 Ga0500645_003324 3300053730 Bacteria 6603

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11048261 Ga0114129_110482611 268
2 3300047472 Ga0495686_0248353 Ga0495686_0248353_64_930 271
3 3300009098 Ga0105245_10477596 Ga0105245_104775962 288
4 3300047320 Ga0495672_0131696 Ga0495672_0131696_419_1285 288
5 3300048921 Ga0496118_0211703 Ga0496118_0211703_23_889 288
6 3300050491 nmdc:mga00v17_19629_c2 nmdc:mga00v17_19629_c2_1095_2003 301
7 3300006028 Ga0070717_10302249 Ga0070717_103022492 303
8 3300005983 Ga0081540_1003949 Ga0081540_10039496 304
9 3300039450 Ga0436363_1703453 Ga0436363_1703453_201_1181 304
10 3300047320 Ga0495672_0032560 Ga0495672_0032560_165_1151 304
11 3300006175 Ga0070712_100019356 Ga0070712_1000193563 305
12 3300025915 Ga0207693_10158613 Ga0207693_101586131 305
13 3300039438 Ga0436360_0247009 Ga0436360_0247009_527_1516 305
14 3300005439 Ga0070711_100070237 Ga0070711_1000702374 307
15 3300039450 Ga0436363_0082670 Ga0436363_0082670_104_1132 307
16 3300039438 Ga0436360_0043534 Ga0436360_0043534_278_1264 308
17 3300005518 Ga0070699_100090510 Ga0070699_1000905102 309
18 3300025922 Ga0207646_10065969 Ga0207646_100659693 309
19 3300005445 Ga0070708_100089850 Ga0070708_1000898502 310
20 3300026067 Ga0207678_10358279 Ga0207678_103582792 310
21 3300005445 Ga0070708_100070354 Ga0070708_1000703542 311
22 3300005468 Ga0070707_100120047 Ga0070707_1001200473 311
23 3300003659 JGI25404J52841_10001838 JGI25404J52841_100018383 312
24 3300005983 Ga0081540_1005161 Ga0081540_10051619 312
25 3300006028 Ga0070717_10010317 Ga0070717_100103174 312
26 3300007788 Ga0099795_10000508 Ga0099795_100005083 312
27 3300007788 Ga0099795_10041506 Ga0099795_100415062 312
28 3300007788 Ga0099795_10042455 Ga0099795_100424552 312
29 3300010159 Ga0099796_10000344 Ga0099796_100003447 312
30 3300010159 Ga0099796_10016645 Ga0099796_100166452 312
31 3300021361 Ga0213872_10077305 Ga0213872_100773052 312
32 3300027512 Ga0209179_1001238 Ga0209179_10012383 312
33 3300039437 Ga0436365_0715084 Ga0436365_0715084_1122_2102 312
34 3300039447 Ga0436361_0535255 Ga0436361_0535255_3976_4962 312
35 3300048924 Ga0496121_0004762 Ga0496121_0004762_6243_7229 312
36 3300050492 nmdc:mga0yw44_45867_c1 nmdc:mga0yw44_45867_c1_924_1904 312
37 3300053119 Ga0500595_001432 Ga0500595_001432_11221_12207 312
38 3300003322 rootL2_10279950 rootL2_102799504 313
39 3300027512 Ga0209179_1012548 Ga0209179_10125481 313
40 3300046474 Ga0495605_0040004 Ga0495605_0040004_1162_2148 313
41 3300030760 Ga0265762_1007612 Ga0265762_10076122 314
42 3300037853 Ga0436364_0806324 Ga0436364_0806324_2374_3360 314
43 3300039450 Ga0436363_0198659 Ga0436363_0198659_4079_5071 314
44 3300048912 Ga0496109_0300581 Ga0496109_0300581_160_1146 314
45 3300048913 Ga0496110_0040958 Ga0496110_0040958_1729_2715 314
46 3300048915 Ga0496112_0082434 Ga0496112_0082434_1506_2678 314
47 3300007265 Ga0099794_10000964 Ga0099794_100009643 315
48 3300010159 Ga0099796_10014080 Ga0099796_100140802 315
49 3300027671 Ga0209588_1003004 Ga0209588_10030042 315
50 3300013308 Ga0157375_10599621 Ga0157375_105996212 316
51 3300048925 Ga0496122_0049567 Ga0496122_0049567_234_1220 316
52 3300048929 Ga0496126_0004671 Ga0496126_0004671_1591_2577 316
53 3300005437 Ga0070710_10145872 Ga0070710_101458722 317
54 3300025915 Ga0207693_10340148 Ga0207693_103401481 317
55 3300025916 Ga0207663_10288201 Ga0207663_102882012 317
56 3300027512 Ga0209179_1002685 Ga0209179_10026853 317
57 3300031507 Ga0307509_10184764 Ga0307509_101847642 317
58 3300031995 Ga0307409_100002326 Ga0307409_1000023262 317
59 3300046460 Ga0495638_0062950 Ga0495638_0062950_808_1797 317
60 3300046474 Ga0495605_0004869 Ga0495605_0004869_2516_3505 317
61 3300046518 Ga0495631_0027620 Ga0495631_0027620_629_1618 317
62 3300046519 Ga0495632_0031725 Ga0495632_0031725_1268_2257 317
63 3300046523 Ga0495644_0059275 Ga0495644_0059275_205_1194 317
64 3300046525 Ga0495663_0061121 Ga0495663_0061121_100_1089 317
65 3300046537 Ga0495598_0004590 Ga0495598_0004590_1363_2352 317
66 3300046538 Ga0495609_0013468 Ga0495609_0013468_2614_3603 317
67 3300046616 Ga0495668_0052775 Ga0495668_0052775_472_1461 317
68 3300046648 Ga0495611_0010171 Ga0495611_0010171_523_1512 317
69 3300046664 Ga0495659_0004592 Ga0495659_0004592_2210_3199 317
70 3300046665 Ga0495661_0065806 Ga0495661_0065806_105_1094 317
71 3300046684 Ga0495669_0012648 Ga0495669_0012648_751_1740 317
72 3300046691 Ga0495670_0011293 Ga0495670_0011293_1144_2133 317
73 3300046692 Ga0495671_0068750 Ga0495671_0068750_89_1078 317
74 3300047323 Ga0495683_0011634 Ga0495683_0011634_2872_3861 317
75 3300048924 Ga0496121_0000178 Ga0496121_0000178_107296_108282 317
76 3300049460 Ga0495682_0048766 Ga0495682_0048766_367_1356 317
77 3300002773 JGI25152J39213_1000525 JGI25152J39213_100052522 318
78 3300005262 Ga0065165_1015146 Ga0065165_10151462 318
79 3300006028 Ga0070717_10005879 Ga0070717_100058795 318
80 3300009551 Ga0105238_10287949 Ga0105238_102879492 318
81 3300021361 Ga0213872_10015293 Ga0213872_100152935 318
82 3300025258 Ga0209129_1000153 Ga0209129_10001534 318
83 3300025273 Ga0209673_1004512 Ga0209673_10045125 318
84 3300025297 Ga0209758_1000153 Ga0209758_100015359 318
85 3300025302 Ga0207426_1000390 Ga0207426_100039069 318
86 3300025303 Ga0209051_1003796 Ga0209051_10037963 318
87 3300031711 Ga0265314_10067812 Ga0265314_100678123 318
88 3300039447 Ga0436361_0112810 Ga0436361_0112810_1674_2660 318
89 3300009148 Ga0105243_10011528 Ga0105243_100115285 320
90 3300025935 Ga0207709_10005422 Ga0207709_100054225 320
91 3300030521 Ga0307511_10102276 Ga0307511_101022762 320
92 3300031507 Ga0307509_10000308 Ga0307509_1000030890 320
93 3300006175 Ga0070712_100277067 Ga0070712_1002770672 321
94 3300047469 Ga0495673_0007087 Ga0495673_0007087_3816_4802 321
95 3300025915 Ga0207693_10087245 Ga0207693_100872452 322
96 3300025929 Ga0207664_10157805 Ga0207664_101578052 322
97 iso_pu_bacteria 2874628541 2874632504 323
98 iso_pu_bacteria 2935908558 2935916262 323
99 iso_pu_bacteria 2935916978 2935923589 323
100 iso_pu_bacteria 2935926038 2935933749 323
101 iso_pu_bacteria 2935934488 2935942234 323
102 iso_pu_bacteria 2935942939 2935950680 323
103 iso_pu_bacteria 2935951376 2935959141 323
104 iso_pu_bacteria 2935959822 2935961606 323
105 iso_pu_bacteria 2935967501 2935975197 323
106 iso_pu_bacteria 2989771324 2989775137 323
107 iso_pu_bacteria 8016630954 8016631106 323
108 iso_pu_bacteria 8016630954 8016638433 323
109 iso_pu_bacteria 8019619141 8019625859 323
110 iso_pu_bacteria 8019687851 8019691550 323
111 iso_pu_bacteria 2513237094 2513642506 324
112 iso_pu_bacteria 2513237098 2513671541 324
113 iso_pu_bacteria 2524023205 2524442561 324
114 iso_pu_bacteria 2524023210 2524464848 324
115 iso_pu_bacteria 2524023228 2524533848 324
116 iso_pu_bacteria 2582581294 2585204816 324
117 iso_pu_bacteria 2595698237 2596374816 324
118 iso_pu_bacteria 2744054633 2745075526 324
119 iso_pu_bacteria 2881665667 2881672319 324
120 iso_pu_bacteria 2885383462 2885385569 324
121 iso_pu_bacteria 2903768456 2903773863 324
122 iso_pu_bacteria 2906626472 2906634779 324
123 iso_pu_bacteria 2928125067 2928125526 324
124 iso_pu_bacteria 2932801729 2932801824 324
125 iso_pu_bacteria 2932818245 2932826072 324
126 iso_pu_bacteria 8019555841 8019559254 324
127 iso_pu_bacteria 8019565922 8019566043 324
128 3300039453 Ga0436362_0834780 Ga0436362_0834780_60_1040 326
129 3300039453 Ga0436362_0977686 Ga0436362_0977686_1516_2496 326
130 3300002773 JGI25152J39213_1000162 JGI25152J39213_100016237 327
131 3300007265 Ga0099794_10001127 Ga0099794_100011272 327
132 3300007265 Ga0099794_10002781 Ga0099794_100027812 327
133 3300010159 Ga0099796_10046530 Ga0099796_100465302 327
134 3300025258 Ga0209129_1000746 Ga0209129_10007468 327
135 3300025299 Ga0209256_1009001 Ga0209256_10090012 327
136 3300027671 Ga0209588_1034324 Ga0209588_10343242 327
137 3300031241 Ga0265325_10041633 Ga0265325_100416332 327
138 3300031901 Ga0307406_10049254 Ga0307406_100492541 327
139 3300039447 Ga0436361_0599598 Ga0436361_0599598_10347_11330 327
140 3300046522 Ga0495643_0070919 Ga0495643_0070919_653_1639 327
141 3300046524 Ga0495648_0061197 Ga0495648_0061197_383_1369 327
142 3300048926 Ga0496123_0137688 Ga0496123_0137688_138_1121 327
143 3300048927 Ga0496124_0009765 Ga0496124_0009765_305_1288 327
144 3300053142 Ga0500577_0096658 Ga0500577_0096658_10_996 327
145 3300053730 Ga0500645_003324 Ga0500645_003324_3538_4524 327
146 3300005347 Ga0070668_100038832 Ga0070668_1000388322 328
147 3300005436 Ga0070713_100020927 Ga0070713_1000209273 328
148 3300005983 Ga0081540_1115806 Ga0081540_11158061 328
149 3300006038 Ga0075365_10000174 Ga0075365_1000017417 328
150 3300006042 Ga0075368_10008327 Ga0075368_100083274 328
151 3300006178 Ga0075367_10000006 Ga0075367_1000000629 328
152 3300006186 Ga0075369_10000312 Ga0075369_1000031211 328
153 3300006195 Ga0075366_10073361 Ga0075366_100733612 328
154 3300006353 Ga0075370_10000752 Ga0075370_100007524 328
155 3300021358 Ga0213873_10000466 Ga0213873_100004662 328
156 3300021361 Ga0213872_10032323 Ga0213872_100323232 328
157 3300021361 Ga0213872_10057971 Ga0213872_100579711 328
158 3300021361 Ga0213872_10114566 Ga0213872_101145662 328
159 3300025972 Ga0207668_10064859 Ga0207668_100648592 328
160 3300033180 Ga0307510_10087443 Ga0307510_100874433 328
161 3300033180 Ga0307510_10142119 Ga0307510_101421192 328
162 3300039438 Ga0436360_0472580 Ga0436360_0472580_1296_2282 328
163 3300039447 Ga0436361_0421961 Ga0436361_0421961_315_1301 328
164 3300039447 Ga0436361_0427065 Ga0436361_0427065_1044_2036 328
165 3300039447 Ga0436361_0574553 Ga0436361_0574553_50_1036 328
166 3300039447 Ga0436361_1162295 Ga0436361_1162295_370_1356 328
167 3300046507 Ga0495606_0002015 Ga0495606_0002015_12901_13890 328
168 3300046524 Ga0495648_0005167 Ga0495648_0005167_6448_7437 328
169 3300046660 Ga0495625_0005401 Ga0495625_0005401_6438_7427 328
170 3300047320 Ga0495672_0022846 Ga0495672_0022846_516_1505 328
171 3300047469 Ga0495673_0021243 Ga0495673_0021243_1210_2199 328
172 3300048918 Ga0496115_0176278 Ga0496115_0176278_284_1270 328
173 3300048920 Ga0496117_0113224 Ga0496117_0113224_363_1352 328
174 3300048921 Ga0496118_0017888 Ga0496118_0017888_1993_2982 328
175 3300048922 Ga0496119_0041305 Ga0496119_0041305_422_1411 328
176 3300048924 Ga0496121_0009421 Ga0496121_0009421_9052_10041 328
177 3300048924 Ga0496121_0062895 Ga0496121_0062895_501_1487 328
178 3300048929 Ga0496126_0011473 Ga0496126_0011473_422_1408 328
179 3300049460 Ga0495682_0001374 Ga0495682_0001374_212_1201 328
180 3300050492 nmdc:mga0yw44_38_c1 nmdc:mga0yw44_38_c1_9429_10418 328
181 3300050493 nmdc:mga0k408_34003_c1 nmdc:mga0k408_34003_c1_1016_2005 328
182 3300050494 nmdc:mga06z11_38_c1 nmdc:mga06z11_38_c1_30937_31926 328
183 3300050495 nmdc:mga04h51_3862_c1 nmdc:mga04h51_3862_c1_2677_3666 328
184 3300050496 nmdc:mga07m45_915_c1 nmdc:mga07m45_915_c1_2770_3759 328
185 3300050516 nmdc:mga0sz30_163_c1 nmdc:mga0sz30_163_c1_5796_6785 328
186 3300002070 JGI24750J21931_1007810 JGI24750J21931_10078102 329
187 3300003659 JGI25404J52841_10000421 JGI25404J52841_100004212 329
188 3300005983 Ga0081540_1000727 Ga0081540_100072715 329
189 3300005983 Ga0081540_1000787 Ga0081540_10007872 329
190 3300046520 Ga0495637_0051917 Ga0495637_0051917_117_1106 329
191 3300047445 Ga0495677_0041795 Ga0495677_0041795_435_1424 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

1

303

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.8944 3 319
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.8929 5 324
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.8903 3 319
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8868 2 324
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.879 2 324
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6092 12 265 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5737 12 265 1.20.1630.10
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4624 132 314 1.20.120.1770
af_I1JRZ9_200_386_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4513 9 208 1.20.120.1770
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.4387 83 263 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A7V8NPS7-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9855 2 317 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A1I1N7A9-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein 0.9805 1 324 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A1I6VWP0-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein 0.9792 1 324 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A381G7B8-F1-model_v4 deleted 0.9767 1 195
AF-A0A356JEV4-F1-model_v4 deleted 0.9766 1 189

Feature Viewer

pLDDT pTM Quality
83.89 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map