F294629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 191 | 138 | 160 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0082434|Ga0496112_0082434_1506_2678 |
| Length | 376 |
| Sequence | MVMFWVTLLAISILLYVLLDGFDLGVGILFGLTRSETRRSAMLSAVAPIWDGNETWLVVTAVILWGAFPVAYAVLLSAFYLPLPMMLAGLILRGVAFEYRNKAERMRWLWNWSFIGGSVAAAPMHGGQYTGGDFGWFSPFAGLCGIGLCLGYTLLGACWLVKKCEGDVRETAYSFIPWLSAGLLVFLVVVFAFALSEHLQVMHRWIDRLHLFIFPVIGALAVTVLAVSVRYRRDELLFPMIVFIFLAAFGTLAISFWPYIIPFVLTITDAASPPSSLAFMFWGEGLFVFPLMLLYTFVSYRVFRGKVVSLPGHYRRRLIGAIAAYSKQFPLRTPVSSKLISQPGSPLLAKGQGSCEEHSSSLRWQRFSRAILHSRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 7 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 8 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 9 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 10 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 11 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 12 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 13 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 14 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 15 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 16 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 17 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 18 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 19 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 20 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 21 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 22 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 23 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 24 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 25 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 26 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 27 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 73 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 75 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 76 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 78 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 79 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 80 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 81 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 82 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 83 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 84 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 85 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 86 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 113 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 114 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 115 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 116 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 117 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 118 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 119 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 120 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 121 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 122 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 123 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 126 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 127 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 128 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 129 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 130 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 131 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 132 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 133 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 134 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 135 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 136 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 137 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 138 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.25 |
| Metatranscriptomes | 0.52 |
| Isolates | 16.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.14 |
| Nodule | 10.99 |
| Rhizoplane | 2.09 |
| Rhizosphere | 56.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1007810 | 3300002070 | Bacteria | 1351 |
| 2 | JGI25152J39213_1000162 | 3300002773 | Bacteria | 45604 |
| 3 | JGI25152J39213_1000525 | 3300002773 | Bacteria | 21286 |
| 4 | rootL2_10279950 | 3300003322 | Bacteria | 3969 |
| 5 | JGI25404J52841_10000421 | 3300003659 | Bacteria | 5930 |
| 6 | JGI25404J52841_10001838 | 3300003659 | Bacteria | 3865 |
| 7 | Ga0065165_1015146 | 3300005262 | Unclassified | 2955 |
| 8 | Ga0070668_100038832 | 3300005347 | Bacteria | 3641 |
| 9 | Ga0070713_100020927 | 3300005436 | Bacteria | 5022 |
| 10 | Ga0070710_10145872 | 3300005437 | Bacteria | 1455 |
| 11 | Ga0070711_100070237 | 3300005439 | Bacteria | 2465 |
| 12 | Ga0070708_100070354 | 3300005445 | Bacteria | 3147 |
| 13 | Ga0070708_100089850 | 3300005445 | Bacteria | 2795 |
| 14 | Ga0070707_100120047 | 3300005468 | Bacteria | 2552 |
| 15 | Ga0070699_100090510 | 3300005518 | Bacteria | 2674 |
| 16 | Ga0081540_1000727 | 3300005983 | Bacteria | 30338 |
| 17 | Ga0081540_1000787 | 3300005983 | Bacteria | 29106 |
| 18 | Ga0081540_1003949 | 3300005983 | Bacteria | 11520 |
| 19 | Ga0081540_1005161 | 3300005983 | Bacteria | 9776 |
| 20 | Ga0081540_1115806 | 3300005983 | Bacteria | 1123 |
| 21 | Ga0070717_10005879 | 3300006028 | Bacteria | 8985 |
| 22 | Ga0070717_10010317 | 3300006028 | Bacteria | 7047 |
| 23 | Ga0070717_10302249 | 3300006028 | Bacteria | 1423 |
| 24 | Ga0075365_10000174 | 3300006038 | Bacteria | 20745 |
| 25 | Ga0075368_10008327 | 3300006042 | Bacteria | 3687 |
| 26 | Ga0070712_100019356 | 3300006175 | Bacteria | 4440 |
| 27 | Ga0070712_100277067 | 3300006175 | Bacteria | 1350 |
| 28 | Ga0075367_10000006 | 3300006178 | Bacteria | 46123 |
| 29 | Ga0075369_10000312 | 3300006186 | Bacteria | 14432 |
| 30 | Ga0075366_10073361 | 3300006195 | Bacteria | 2040 |
| 31 | Ga0075370_10000752 | 3300006353 | Bacteria | 12968 |
| 32 | Ga0099794_10000964 | 3300007265 | Bacteria | 9706 |
| 33 | Ga0099794_10001127 | 3300007265 | Bacteria | 9158 |
| 34 | Ga0099794_10002781 | 3300007265 | Bacteria | 6539 |
| 35 | Ga0099795_10000508 | 3300007788 | Bacteria | 7324 |
| 36 | Ga0099795_10041506 | 3300007788 | Bacteria | 1638 |
| 37 | Ga0099795_10042455 | 3300007788 | Bacteria | 1623 |
| 38 | Ga0105245_10477596 | 3300009098 | Bacteria | 1259 |
| 39 | Ga0114129_11048261 | 3300009147 | Bacteria | 1024 |
| 40 | Ga0105243_10011528 | 3300009148 | Bacteria | 6688 |
| 41 | Ga0105238_10287949 | 3300009551 | Bacteria | 1625 |
| 42 | Ga0099796_10000344 | 3300010159 | Bacteria | 7515 |
| 43 | Ga0099796_10014080 | 3300010159 | Bacteria | 2301 |
| 44 | Ga0099796_10016645 | 3300010159 | Bacteria | 2175 |
| 45 | Ga0099796_10046530 | 3300010159 | Bacteria | 1489 |
| 46 | Ga0157375_10599621 | 3300013308 | Bacteria | 1261 |
| 47 | Ga0213873_10000466 | 3300021358 | Bacteria | 6490 |
| 48 | Ga0213872_10015293 | 3300021361 | Bacteria | 3571 |
| 49 | Ga0213872_10032323 | 3300021361 | Bacteria | 2398 |
| 50 | Ga0213872_10057971 | 3300021361 | Bacteria | 1753 |
| 51 | Ga0213872_10077305 | 3300021361 | Bacteria | 1496 |
| 52 | Ga0213872_10114566 | 3300021361 | Bacteria | 1195 |
| 53 | Ga0209129_1000153 | 3300025258 | Bacteria | 110699 |
| 54 | Ga0209129_1000746 | 3300025258 | Bacteria | 20764 |
| 55 | Ga0209673_1004512 | 3300025273 | Bacteria | 7416 |
| 56 | Ga0209758_1000153 | 3300025297 | Bacteria | 161668 |
| 57 | Ga0209256_1009001 | 3300025299 | Bacteria | 4474 |
| 58 | Ga0207426_1000390 | 3300025302 | Bacteria | 74933 |
| 59 | Ga0209051_1003796 | 3300025303 | Bacteria | 9670 |
| 60 | Ga0207693_10087245 | 3300025915 | Bacteria | 2445 |
| 61 | Ga0207693_10158613 | 3300025915 | Bacteria | 1780 |
| 62 | Ga0207693_10340148 | 3300025915 | Bacteria | 1174 |
| 63 | Ga0207663_10288201 | 3300025916 | Bacteria | 1222 |
| 64 | Ga0207646_10065969 | 3300025922 | Bacteria | 3231 |
| 65 | Ga0207664_10157805 | 3300025929 | Bacteria | 1932 |
| 66 | Ga0207709_10005422 | 3300025935 | Bacteria | 7251 |
| 67 | Ga0207668_10064859 | 3300025972 | Bacteria | 2583 |
| 68 | Ga0207678_10358279 | 3300026067 | Bacteria | 1259 |
| 69 | Ga0209179_1001238 | 3300027512 | Bacteria | 3048 |
| 70 | Ga0209179_1002685 | 3300027512 | Bacteria | 2448 |
| 71 | Ga0209179_1012548 | 3300027512 | Bacteria | 1524 |
| 72 | Ga0209588_1003004 | 3300027671 | Bacteria | 4647 |
| 73 | Ga0209588_1034324 | 3300027671 | Bacteria | 1629 |
| 74 | Ga0307511_10102276 | 3300030521 | Bacteria | 1873 |
| 75 | Ga0265762_1007612 | 3300030760 | Bacteria | 1929 |
| 76 | Ga0265325_10041633 | 3300031241 | Bacteria | 2406 |
| 77 | Ga0307509_10000308 | 3300031507 | Bacteria | 80262 |
| 78 | Ga0307509_10184764 | 3300031507 | Bacteria | 1944 |
| 79 | Ga0265314_10067812 | 3300031711 | Bacteria | 2401 |
| 80 | Ga0307406_10049254 | 3300031901 | Bacteria | 2665 |
| 81 | Ga0307409_100002326 | 3300031995 | Bacteria | 9871 |
| 82 | Ga0307510_10087443 | 3300033180 | Bacteria | 2982 |
| 83 | Ga0307510_10142119 | 3300033180 | Bacteria | 2041 |
| 84 | Ga0436364_0806324 | 3300037853 | Bacteria | 6767 |
| 85 | Ga0436365_0715084 | 3300039437 | Bacteria | 2999 |
| 86 | Ga0436360_0043534 | 3300039438 | Bacteria | 1713 |
| 87 | Ga0436360_0247009 | 3300039438 | Bacteria | 2521 |
| 88 | Ga0436360_0472580 | 3300039438 | Bacteria | 3213 |
| 89 | Ga0436361_0112810 | 3300039447 | Bacteria | 5374 |
| 90 | Ga0436361_0421961 | 3300039447 | Bacteria | 3660 |
| 91 | Ga0436361_0427065 | 3300039447 | Bacteria | 2599 |
| 92 | Ga0436361_0535255 | 3300039447 | Bacteria | 11934 |
| 93 | Ga0436361_0574553 | 3300039447 | Bacteria | 1845 |
| 94 | Ga0436361_0599598 | 3300039447 | Bacteria | 26109 |
| 95 | Ga0436361_1162295 | 3300039447 | Bacteria | 2776 |
| 96 | Ga0436363_0082670 | 3300039450 | Bacteria | 2304 |
| 97 | Ga0436363_0198659 | 3300039450 | Bacteria | 7739 |
| 98 | Ga0436363_1703453 | 3300039450 | Bacteria | 1490 |
| 99 | Ga0436362_0834780 | 3300039453 | Bacteria | 1131 |
| 100 | Ga0436362_0977686 | 3300039453 | Bacteria | 2815 |
| 101 | Ga0495638_0062950 | 3300046460 | Bacteria | 2288 |
| 102 | Ga0495605_0004869 | 3300046474 | Bacteria | 7847 |
| 103 | Ga0495605_0040004 | 3300046474 | Bacteria | 2345 |
| 104 | Ga0495606_0002015 | 3300046507 | Bacteria | 24938 |
| 105 | Ga0495631_0027620 | 3300046518 | Bacteria | 2595 |
| 106 | Ga0495632_0031725 | 3300046519 | Bacteria | 2728 |
| 107 | Ga0495637_0051917 | 3300046520 | Bacteria | 1714 |
| 108 | Ga0495643_0070919 | 3300046522 | Bacteria | 1829 |
| 109 | Ga0495644_0059275 | 3300046523 | Bacteria | 1439 |
| 110 | Ga0495648_0005167 | 3300046524 | Bacteria | 10922 |
| 111 | Ga0495648_0061197 | 3300046524 | Bacteria | 2237 |
| 112 | Ga0495663_0061121 | 3300046525 | Bacteria | 1185 |
| 113 | Ga0495598_0004590 | 3300046537 | Bacteria | 3003 |
| 114 | Ga0495609_0013468 | 3300046538 | Bacteria | 3860 |
| 115 | Ga0495668_0052775 | 3300046616 | Bacteria | 2249 |
| 116 | Ga0495611_0010171 | 3300046648 | Bacteria | 3980 |
| 117 | Ga0495625_0005401 | 3300046660 | Bacteria | 11677 |
| 118 | Ga0495659_0004592 | 3300046664 | Bacteria | 4345 |
| 119 | Ga0495661_0065806 | 3300046665 | Bacteria | 2135 |
| 120 | Ga0495669_0012648 | 3300046684 | Bacteria | 3593 |
| 121 | Ga0495670_0011293 | 3300046691 | Bacteria | 4391 |
| 122 | Ga0495671_0068750 | 3300046692 | Bacteria | 1741 |
| 123 | Ga0495672_0022846 | 3300047320 | Bacteria | 4058 |
| 124 | Ga0495672_0032560 | 3300047320 | Bacteria | 3241 |
| 125 | Ga0495672_0131696 | 3300047320 | Bacteria | 1315 |
| 126 | Ga0495683_0011634 | 3300047323 | Bacteria | 4631 |
| 127 | Ga0495677_0041795 | 3300047445 | Bacteria | 1678 |
| 128 | Ga0495673_0007087 | 3300047469 | Bacteria | 6496 |
| 129 | Ga0495673_0021243 | 3300047469 | Bacteria | 3211 |
| 130 | Ga0495686_0248353 | 3300047472 | Bacteria | 1001 |
| 131 | Ga0496109_0300581 | 3300048912 | Bacteria | 1513 |
| 132 | Ga0496110_0040958 | 3300048913 | Bacteria | 4039 |
| 133 | Ga0496112_0082434 | 3300048915 | Bacteria | 3181 |
| 134 | Ga0496115_0176278 | 3300048918 | Bacteria | 1768 |
| 135 | Ga0496117_0113224 | 3300048920 | Bacteria | 1685 |
| 136 | Ga0496118_0017888 | 3300048921 | Bacteria | 6430 |
| 137 | Ga0496118_0211703 | 3300048921 | Bacteria | 1137 |
| 138 | Ga0496119_0041305 | 3300048922 | Bacteria | 2939 |
| 139 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 140 | Ga0496121_0004762 | 3300048924 | Bacteria | 17911 |
| 141 | Ga0496121_0009421 | 3300048924 | Bacteria | 11226 |
| 142 | Ga0496121_0062895 | 3300048924 | Bacteria | 3037 |
| 143 | Ga0496122_0049567 | 3300048925 | Bacteria | 3213 |
| 144 | Ga0496123_0137688 | 3300048926 | Bacteria | 1341 |
| 145 | Ga0496124_0009765 | 3300048927 | Bacteria | 9820 |
| 146 | Ga0496126_0004671 | 3300048929 | Bacteria | 16196 |
| 147 | Ga0496126_0011473 | 3300048929 | Bacteria | 9167 |
| 148 | Ga0495682_0001374 | 3300049460 | Bacteria | 13319 |
| 149 | Ga0495682_0048766 | 3300049460 | Bacteria | 1543 |
| 150 | nmdc:mga00v17_19629_c2 | 3300050491 | Bacteria | 2080 |
| 151 | nmdc:mga0yw44_38_c1 | 3300050492 | Bacteria | 46328 |
| 152 | nmdc:mga0yw44_45867_c1 | 3300050492 | Bacteria | 2622 |
| 153 | nmdc:mga0k408_34003_c1 | 3300050493 | Bacteria | 2917 |
| 154 | nmdc:mga06z11_38_c1 | 3300050494 | Bacteria | 54827 |
| 155 | nmdc:mga04h51_3862_c1 | 3300050495 | Bacteria | 3682 |
| 156 | nmdc:mga07m45_915_c1 | 3300050496 | Bacteria | 12899 |
| 157 | nmdc:mga0sz30_163_c1 | 3300050516 | Bacteria | 24506 |
| 158 | Ga0500595_001432 | 3300053119 | Bacteria | 12792 |
| 159 | Ga0500577_0096658 | 3300053142 | Bacteria | 1202 |
| 160 | Ga0500645_003324 | 3300053730 | Bacteria | 6603 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_11048261 | Ga0114129_110482611 | 268 |
| 2 | 3300047472 | Ga0495686_0248353 | Ga0495686_0248353_64_930 | 271 |
| 3 | 3300009098 | Ga0105245_10477596 | Ga0105245_104775962 | 288 |
| 4 | 3300047320 | Ga0495672_0131696 | Ga0495672_0131696_419_1285 | 288 |
| 5 | 3300048921 | Ga0496118_0211703 | Ga0496118_0211703_23_889 | 288 |
| 6 | 3300050491 | nmdc:mga00v17_19629_c2 | nmdc:mga00v17_19629_c2_1095_2003 | 301 |
| 7 | 3300006028 | Ga0070717_10302249 | Ga0070717_103022492 | 303 |
| 8 | 3300005983 | Ga0081540_1003949 | Ga0081540_10039496 | 304 |
| 9 | 3300039450 | Ga0436363_1703453 | Ga0436363_1703453_201_1181 | 304 |
| 10 | 3300047320 | Ga0495672_0032560 | Ga0495672_0032560_165_1151 | 304 |
| 11 | 3300006175 | Ga0070712_100019356 | Ga0070712_1000193563 | 305 |
| 12 | 3300025915 | Ga0207693_10158613 | Ga0207693_101586131 | 305 |
| 13 | 3300039438 | Ga0436360_0247009 | Ga0436360_0247009_527_1516 | 305 |
| 14 | 3300005439 | Ga0070711_100070237 | Ga0070711_1000702374 | 307 |
| 15 | 3300039450 | Ga0436363_0082670 | Ga0436363_0082670_104_1132 | 307 |
| 16 | 3300039438 | Ga0436360_0043534 | Ga0436360_0043534_278_1264 | 308 |
| 17 | 3300005518 | Ga0070699_100090510 | Ga0070699_1000905102 | 309 |
| 18 | 3300025922 | Ga0207646_10065969 | Ga0207646_100659693 | 309 |
| 19 | 3300005445 | Ga0070708_100089850 | Ga0070708_1000898502 | 310 |
| 20 | 3300026067 | Ga0207678_10358279 | Ga0207678_103582792 | 310 |
| 21 | 3300005445 | Ga0070708_100070354 | Ga0070708_1000703542 | 311 |
| 22 | 3300005468 | Ga0070707_100120047 | Ga0070707_1001200473 | 311 |
| 23 | 3300003659 | JGI25404J52841_10001838 | JGI25404J52841_100018383 | 312 |
| 24 | 3300005983 | Ga0081540_1005161 | Ga0081540_10051619 | 312 |
| 25 | 3300006028 | Ga0070717_10010317 | Ga0070717_100103174 | 312 |
| 26 | 3300007788 | Ga0099795_10000508 | Ga0099795_100005083 | 312 |
| 27 | 3300007788 | Ga0099795_10041506 | Ga0099795_100415062 | 312 |
| 28 | 3300007788 | Ga0099795_10042455 | Ga0099795_100424552 | 312 |
| 29 | 3300010159 | Ga0099796_10000344 | Ga0099796_100003447 | 312 |
| 30 | 3300010159 | Ga0099796_10016645 | Ga0099796_100166452 | 312 |
| 31 | 3300021361 | Ga0213872_10077305 | Ga0213872_100773052 | 312 |
| 32 | 3300027512 | Ga0209179_1001238 | Ga0209179_10012383 | 312 |
| 33 | 3300039437 | Ga0436365_0715084 | Ga0436365_0715084_1122_2102 | 312 |
| 34 | 3300039447 | Ga0436361_0535255 | Ga0436361_0535255_3976_4962 | 312 |
| 35 | 3300048924 | Ga0496121_0004762 | Ga0496121_0004762_6243_7229 | 312 |
| 36 | 3300050492 | nmdc:mga0yw44_45867_c1 | nmdc:mga0yw44_45867_c1_924_1904 | 312 |
| 37 | 3300053119 | Ga0500595_001432 | Ga0500595_001432_11221_12207 | 312 |
| 38 | 3300003322 | rootL2_10279950 | rootL2_102799504 | 313 |
| 39 | 3300027512 | Ga0209179_1012548 | Ga0209179_10125481 | 313 |
| 40 | 3300046474 | Ga0495605_0040004 | Ga0495605_0040004_1162_2148 | 313 |
| 41 | 3300030760 | Ga0265762_1007612 | Ga0265762_10076122 | 314 |
| 42 | 3300037853 | Ga0436364_0806324 | Ga0436364_0806324_2374_3360 | 314 |
| 43 | 3300039450 | Ga0436363_0198659 | Ga0436363_0198659_4079_5071 | 314 |
| 44 | 3300048912 | Ga0496109_0300581 | Ga0496109_0300581_160_1146 | 314 |
| 45 | 3300048913 | Ga0496110_0040958 | Ga0496110_0040958_1729_2715 | 314 |
| 46 | 3300048915 | Ga0496112_0082434 | Ga0496112_0082434_1506_2678 | 314 |
| 47 | 3300007265 | Ga0099794_10000964 | Ga0099794_100009643 | 315 |
| 48 | 3300010159 | Ga0099796_10014080 | Ga0099796_100140802 | 315 |
| 49 | 3300027671 | Ga0209588_1003004 | Ga0209588_10030042 | 315 |
| 50 | 3300013308 | Ga0157375_10599621 | Ga0157375_105996212 | 316 |
| 51 | 3300048925 | Ga0496122_0049567 | Ga0496122_0049567_234_1220 | 316 |
| 52 | 3300048929 | Ga0496126_0004671 | Ga0496126_0004671_1591_2577 | 316 |
| 53 | 3300005437 | Ga0070710_10145872 | Ga0070710_101458722 | 317 |
| 54 | 3300025915 | Ga0207693_10340148 | Ga0207693_103401481 | 317 |
| 55 | 3300025916 | Ga0207663_10288201 | Ga0207663_102882012 | 317 |
| 56 | 3300027512 | Ga0209179_1002685 | Ga0209179_10026853 | 317 |
| 57 | 3300031507 | Ga0307509_10184764 | Ga0307509_101847642 | 317 |
| 58 | 3300031995 | Ga0307409_100002326 | Ga0307409_1000023262 | 317 |
| 59 | 3300046460 | Ga0495638_0062950 | Ga0495638_0062950_808_1797 | 317 |
| 60 | 3300046474 | Ga0495605_0004869 | Ga0495605_0004869_2516_3505 | 317 |
| 61 | 3300046518 | Ga0495631_0027620 | Ga0495631_0027620_629_1618 | 317 |
| 62 | 3300046519 | Ga0495632_0031725 | Ga0495632_0031725_1268_2257 | 317 |
| 63 | 3300046523 | Ga0495644_0059275 | Ga0495644_0059275_205_1194 | 317 |
| 64 | 3300046525 | Ga0495663_0061121 | Ga0495663_0061121_100_1089 | 317 |
| 65 | 3300046537 | Ga0495598_0004590 | Ga0495598_0004590_1363_2352 | 317 |
| 66 | 3300046538 | Ga0495609_0013468 | Ga0495609_0013468_2614_3603 | 317 |
| 67 | 3300046616 | Ga0495668_0052775 | Ga0495668_0052775_472_1461 | 317 |
| 68 | 3300046648 | Ga0495611_0010171 | Ga0495611_0010171_523_1512 | 317 |
| 69 | 3300046664 | Ga0495659_0004592 | Ga0495659_0004592_2210_3199 | 317 |
| 70 | 3300046665 | Ga0495661_0065806 | Ga0495661_0065806_105_1094 | 317 |
| 71 | 3300046684 | Ga0495669_0012648 | Ga0495669_0012648_751_1740 | 317 |
| 72 | 3300046691 | Ga0495670_0011293 | Ga0495670_0011293_1144_2133 | 317 |
| 73 | 3300046692 | Ga0495671_0068750 | Ga0495671_0068750_89_1078 | 317 |
| 74 | 3300047323 | Ga0495683_0011634 | Ga0495683_0011634_2872_3861 | 317 |
| 75 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_107296_108282 | 317 |
| 76 | 3300049460 | Ga0495682_0048766 | Ga0495682_0048766_367_1356 | 317 |
| 77 | 3300002773 | JGI25152J39213_1000525 | JGI25152J39213_100052522 | 318 |
| 78 | 3300005262 | Ga0065165_1015146 | Ga0065165_10151462 | 318 |
| 79 | 3300006028 | Ga0070717_10005879 | Ga0070717_100058795 | 318 |
| 80 | 3300009551 | Ga0105238_10287949 | Ga0105238_102879492 | 318 |
| 81 | 3300021361 | Ga0213872_10015293 | Ga0213872_100152935 | 318 |
| 82 | 3300025258 | Ga0209129_1000153 | Ga0209129_10001534 | 318 |
| 83 | 3300025273 | Ga0209673_1004512 | Ga0209673_10045125 | 318 |
| 84 | 3300025297 | Ga0209758_1000153 | Ga0209758_100015359 | 318 |
| 85 | 3300025302 | Ga0207426_1000390 | Ga0207426_100039069 | 318 |
| 86 | 3300025303 | Ga0209051_1003796 | Ga0209051_10037963 | 318 |
| 87 | 3300031711 | Ga0265314_10067812 | Ga0265314_100678123 | 318 |
| 88 | 3300039447 | Ga0436361_0112810 | Ga0436361_0112810_1674_2660 | 318 |
| 89 | 3300009148 | Ga0105243_10011528 | Ga0105243_100115285 | 320 |
| 90 | 3300025935 | Ga0207709_10005422 | Ga0207709_100054225 | 320 |
| 91 | 3300030521 | Ga0307511_10102276 | Ga0307511_101022762 | 320 |
| 92 | 3300031507 | Ga0307509_10000308 | Ga0307509_1000030890 | 320 |
| 93 | 3300006175 | Ga0070712_100277067 | Ga0070712_1002770672 | 321 |
| 94 | 3300047469 | Ga0495673_0007087 | Ga0495673_0007087_3816_4802 | 321 |
| 95 | 3300025915 | Ga0207693_10087245 | Ga0207693_100872452 | 322 |
| 96 | 3300025929 | Ga0207664_10157805 | Ga0207664_101578052 | 322 |
| 97 | iso_pu_bacteria | 2874628541 | 2874632504 | 323 |
| 98 | iso_pu_bacteria | 2935908558 | 2935916262 | 323 |
| 99 | iso_pu_bacteria | 2935916978 | 2935923589 | 323 |
| 100 | iso_pu_bacteria | 2935926038 | 2935933749 | 323 |
| 101 | iso_pu_bacteria | 2935934488 | 2935942234 | 323 |
| 102 | iso_pu_bacteria | 2935942939 | 2935950680 | 323 |
| 103 | iso_pu_bacteria | 2935951376 | 2935959141 | 323 |
| 104 | iso_pu_bacteria | 2935959822 | 2935961606 | 323 |
| 105 | iso_pu_bacteria | 2935967501 | 2935975197 | 323 |
| 106 | iso_pu_bacteria | 2989771324 | 2989775137 | 323 |
| 107 | iso_pu_bacteria | 8016630954 | 8016631106 | 323 |
| 108 | iso_pu_bacteria | 8016630954 | 8016638433 | 323 |
| 109 | iso_pu_bacteria | 8019619141 | 8019625859 | 323 |
| 110 | iso_pu_bacteria | 8019687851 | 8019691550 | 323 |
| 111 | iso_pu_bacteria | 2513237094 | 2513642506 | 324 |
| 112 | iso_pu_bacteria | 2513237098 | 2513671541 | 324 |
| 113 | iso_pu_bacteria | 2524023205 | 2524442561 | 324 |
| 114 | iso_pu_bacteria | 2524023210 | 2524464848 | 324 |
| 115 | iso_pu_bacteria | 2524023228 | 2524533848 | 324 |
| 116 | iso_pu_bacteria | 2582581294 | 2585204816 | 324 |
| 117 | iso_pu_bacteria | 2595698237 | 2596374816 | 324 |
| 118 | iso_pu_bacteria | 2744054633 | 2745075526 | 324 |
| 119 | iso_pu_bacteria | 2881665667 | 2881672319 | 324 |
| 120 | iso_pu_bacteria | 2885383462 | 2885385569 | 324 |
| 121 | iso_pu_bacteria | 2903768456 | 2903773863 | 324 |
| 122 | iso_pu_bacteria | 2906626472 | 2906634779 | 324 |
| 123 | iso_pu_bacteria | 2928125067 | 2928125526 | 324 |
| 124 | iso_pu_bacteria | 2932801729 | 2932801824 | 324 |
| 125 | iso_pu_bacteria | 2932818245 | 2932826072 | 324 |
| 126 | iso_pu_bacteria | 8019555841 | 8019559254 | 324 |
| 127 | iso_pu_bacteria | 8019565922 | 8019566043 | 324 |
| 128 | 3300039453 | Ga0436362_0834780 | Ga0436362_0834780_60_1040 | 326 |
| 129 | 3300039453 | Ga0436362_0977686 | Ga0436362_0977686_1516_2496 | 326 |
| 130 | 3300002773 | JGI25152J39213_1000162 | JGI25152J39213_100016237 | 327 |
| 131 | 3300007265 | Ga0099794_10001127 | Ga0099794_100011272 | 327 |
| 132 | 3300007265 | Ga0099794_10002781 | Ga0099794_100027812 | 327 |
| 133 | 3300010159 | Ga0099796_10046530 | Ga0099796_100465302 | 327 |
| 134 | 3300025258 | Ga0209129_1000746 | Ga0209129_10007468 | 327 |
| 135 | 3300025299 | Ga0209256_1009001 | Ga0209256_10090012 | 327 |
| 136 | 3300027671 | Ga0209588_1034324 | Ga0209588_10343242 | 327 |
| 137 | 3300031241 | Ga0265325_10041633 | Ga0265325_100416332 | 327 |
| 138 | 3300031901 | Ga0307406_10049254 | Ga0307406_100492541 | 327 |
| 139 | 3300039447 | Ga0436361_0599598 | Ga0436361_0599598_10347_11330 | 327 |
| 140 | 3300046522 | Ga0495643_0070919 | Ga0495643_0070919_653_1639 | 327 |
| 141 | 3300046524 | Ga0495648_0061197 | Ga0495648_0061197_383_1369 | 327 |
| 142 | 3300048926 | Ga0496123_0137688 | Ga0496123_0137688_138_1121 | 327 |
| 143 | 3300048927 | Ga0496124_0009765 | Ga0496124_0009765_305_1288 | 327 |
| 144 | 3300053142 | Ga0500577_0096658 | Ga0500577_0096658_10_996 | 327 |
| 145 | 3300053730 | Ga0500645_003324 | Ga0500645_003324_3538_4524 | 327 |
| 146 | 3300005347 | Ga0070668_100038832 | Ga0070668_1000388322 | 328 |
| 147 | 3300005436 | Ga0070713_100020927 | Ga0070713_1000209273 | 328 |
| 148 | 3300005983 | Ga0081540_1115806 | Ga0081540_11158061 | 328 |
| 149 | 3300006038 | Ga0075365_10000174 | Ga0075365_1000017417 | 328 |
| 150 | 3300006042 | Ga0075368_10008327 | Ga0075368_100083274 | 328 |
| 151 | 3300006178 | Ga0075367_10000006 | Ga0075367_1000000629 | 328 |
| 152 | 3300006186 | Ga0075369_10000312 | Ga0075369_1000031211 | 328 |
| 153 | 3300006195 | Ga0075366_10073361 | Ga0075366_100733612 | 328 |
| 154 | 3300006353 | Ga0075370_10000752 | Ga0075370_100007524 | 328 |
| 155 | 3300021358 | Ga0213873_10000466 | Ga0213873_100004662 | 328 |
| 156 | 3300021361 | Ga0213872_10032323 | Ga0213872_100323232 | 328 |
| 157 | 3300021361 | Ga0213872_10057971 | Ga0213872_100579711 | 328 |
| 158 | 3300021361 | Ga0213872_10114566 | Ga0213872_101145662 | 328 |
| 159 | 3300025972 | Ga0207668_10064859 | Ga0207668_100648592 | 328 |
| 160 | 3300033180 | Ga0307510_10087443 | Ga0307510_100874433 | 328 |
| 161 | 3300033180 | Ga0307510_10142119 | Ga0307510_101421192 | 328 |
| 162 | 3300039438 | Ga0436360_0472580 | Ga0436360_0472580_1296_2282 | 328 |
| 163 | 3300039447 | Ga0436361_0421961 | Ga0436361_0421961_315_1301 | 328 |
| 164 | 3300039447 | Ga0436361_0427065 | Ga0436361_0427065_1044_2036 | 328 |
| 165 | 3300039447 | Ga0436361_0574553 | Ga0436361_0574553_50_1036 | 328 |
| 166 | 3300039447 | Ga0436361_1162295 | Ga0436361_1162295_370_1356 | 328 |
| 167 | 3300046507 | Ga0495606_0002015 | Ga0495606_0002015_12901_13890 | 328 |
| 168 | 3300046524 | Ga0495648_0005167 | Ga0495648_0005167_6448_7437 | 328 |
| 169 | 3300046660 | Ga0495625_0005401 | Ga0495625_0005401_6438_7427 | 328 |
| 170 | 3300047320 | Ga0495672_0022846 | Ga0495672_0022846_516_1505 | 328 |
| 171 | 3300047469 | Ga0495673_0021243 | Ga0495673_0021243_1210_2199 | 328 |
| 172 | 3300048918 | Ga0496115_0176278 | Ga0496115_0176278_284_1270 | 328 |
| 173 | 3300048920 | Ga0496117_0113224 | Ga0496117_0113224_363_1352 | 328 |
| 174 | 3300048921 | Ga0496118_0017888 | Ga0496118_0017888_1993_2982 | 328 |
| 175 | 3300048922 | Ga0496119_0041305 | Ga0496119_0041305_422_1411 | 328 |
| 176 | 3300048924 | Ga0496121_0009421 | Ga0496121_0009421_9052_10041 | 328 |
| 177 | 3300048924 | Ga0496121_0062895 | Ga0496121_0062895_501_1487 | 328 |
| 178 | 3300048929 | Ga0496126_0011473 | Ga0496126_0011473_422_1408 | 328 |
| 179 | 3300049460 | Ga0495682_0001374 | Ga0495682_0001374_212_1201 | 328 |
| 180 | 3300050492 | nmdc:mga0yw44_38_c1 | nmdc:mga0yw44_38_c1_9429_10418 | 328 |
| 181 | 3300050493 | nmdc:mga0k408_34003_c1 | nmdc:mga0k408_34003_c1_1016_2005 | 328 |
| 182 | 3300050494 | nmdc:mga06z11_38_c1 | nmdc:mga06z11_38_c1_30937_31926 | 328 |
| 183 | 3300050495 | nmdc:mga04h51_3862_c1 | nmdc:mga04h51_3862_c1_2677_3666 | 328 |
| 184 | 3300050496 | nmdc:mga07m45_915_c1 | nmdc:mga07m45_915_c1_2770_3759 | 328 |
| 185 | 3300050516 | nmdc:mga0sz30_163_c1 | nmdc:mga0sz30_163_c1_5796_6785 | 328 |
| 186 | 3300002070 | JGI24750J21931_1007810 | JGI24750J21931_10078102 | 329 |
| 187 | 3300003659 | JGI25404J52841_10000421 | JGI25404J52841_100004212 | 329 |
| 188 | 3300005983 | Ga0081540_1000727 | Ga0081540_100072715 | 329 |
| 189 | 3300005983 | Ga0081540_1000787 | Ga0081540_10007872 | 329 |
| 190 | 3300046520 | Ga0495637_0051917 | Ga0495637_0051917_117_1106 | 329 |
| 191 | 3300047445 | Ga0495677_0041795 | Ga0495677_0041795_435_1424 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rko-assembly1.cif.gz_B | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.8944 | 3 | 319 |
| 7d5i-assembly1.cif.gz_B | structure of mycobacterium smegmatis bd complex in the apo-form. | 0.8929 | 5 | 324 |
| 7ose-assembly1.cif.gz_B | cytochrome bd-ii type oxidase with bound aurachin d | 0.8903 | 3 | 319 |
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8868 | 2 | 324 |
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.879 | 2 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.6092 | 12 | 265 | 1.20.1630.10 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5737 | 12 | 265 | 1.20.1630.10 |
| af_A0A1D6NFR3_201_388_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.4624 | 132 | 314 | 1.20.120.1770 |
| af_I1JRZ9_200_386_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.4513 | 9 | 208 | 1.20.120.1770 |
| af_A0A0R0H600_74_264_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.4387 | 83 | 263 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8NPS7-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9855 | 2 | 317 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A1I1N7A9-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein | 0.9805 | 1 | 324 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A1I6VWP0-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein | 0.9792 | 1 | 324 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A381G7B8-F1-model_v4 | deleted | 0.9767 | 1 | 195 |
|
| AF-A0A356JEV4-F1-model_v4 | deleted | 0.9766 | 1 | 189 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar