F294534

General Info

Members Datasets Scaffolds Average Seq Length
191 129 382 313

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0034792|Ga0495628_0034792_501_1607
Length 368
Sequence MEITPHDTAPDISSWLMCSPSIGEVEDPYSAHFHPGRLGRQPDGVLPVEGLQMSRAFDHRPAMAGEVVSLFAPVPSGVIVDATVGGGGHAQAILDAHPRLTVLGIDRDPAAVAAASEVLAPYGDRAIVRRARFDRLGEVVDDVGAAPISGVLFDLGVSSTQLDDAARGFSYRHDAPLDMRMDPGEGRTAADVVNGLPQAELARLLAANGEGRFARRIAAAIVSARPLETTGQLADVARDAIPAPARRRGGHPAKRVFQAVRIEVNAELDLLDRALDVAIDLLVPGGRCLVLSYHSGEDRLVKGRFAEAVTGGCTCLPGLPCVCGARPRGRLVGRGARRPAPAEVEANPRAGSARLRALERLDNDRLGS

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
6 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
25 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
26 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
45 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
46 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
49 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
58 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
59 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
60 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
121 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2738543010 Bacillus sp. YR335 Isolate Unclassified
128 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
129 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.24
Metatranscriptomes 4.19
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 5.76
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0034792 3300046516 Bacteria 4051
2 Ga0070675_100157991 3300005354 Bacteria 1948
3 Ga0070671_100004501 3300005355 Bacteria 11033
4 Ga0070706_100006343 3300005467 Bacteria 11172
5 Ga0068863_100214058 3300005841 Unclassified 1856
6 Ga0068858_100041237 3300005842 Bacteria 4281
7 Ga0081455_10046726 3300005937 Bacteria 3753
8 Ga0081538_10000310 3300005981 Bacteria 56224
9 Ga0081538_10004385 3300005981 Bacteria 13031
10 Ga0081538_10014035 3300005981 Bacteria 6298
11 Ga0081540_1005088 3300005983 Bacteria 9863
12 Ga0075363_100006974 3300006048 Bacteria 5166
13 Ga0075428_100236691 3300006844 Bacteria 1970
14 Ga0075428_100266523 3300006844 Bacteria 1844
15 Ga0075430_100000746 3300006846 Bacteria 25012
16 Ga0075430_100007015 3300006846 Bacteria 9498
17 Ga0075430_100043405 3300006846 Bacteria 3800
18 Ga0075430_100067373 3300006846 Bacteria 3006
19 Ga0075430_100087566 3300006846 Bacteria 2606
20 Ga0075431_100037096 3300006847 Bacteria 5022
21 Ga0075431_100149064 3300006847 Bacteria 2409
22 Ga0075431_100291481 3300006847 Bacteria 1651
23 Ga0075431_100424527 3300006847 Bacteria 1328
24 Ga0075429_100000821 3300006880 Bacteria 24358
25 Ga0075429_100031212 3300006880 Bacteria 4631
26 Ga0075429_100438612 3300006880 Bacteria 1144
27 Ga0075435_100158780 3300007076 Bacteria 1904
28 Ga0111539_10009697 3300009094 Bacteria 12153
29 Ga0111539_10353536 3300009094 Bacteria 1710
30 Ga0114129_10000753 3300009147 Bacteria 41209
31 Ga0114129_10298151 3300009147 Bacteria 2150
32 Ga0105243_10099751 3300009148 Bacteria 2408
33 Ga0105242_10009241 3300009176 Bacteria 7563
34 Ga0105249_10395134 3300009553 Bacteria 1412
35 Ga0105239_10198671 3300010375 Bacteria 2246
36 Ga0157372_10155985 3300013307 Bacteria 2637
37 Ga0163163_10226360 3300014325 Unclassified 1919
38 Ga0213874_10013468 3300021377 Bacteria 2120
39 Ga0228598_1001423 3300024227 Bacteria 5270
40 Ga0207710_10032986 3300025900 Unclassified 2270
41 Ga0207687_10002146 3300025927 Bacteria 13448
42 Ga0207644_10002404 3300025931 Bacteria 12061
43 Ga0207706_10293255 3300025933 Bacteria 1418
44 Ga0207661_10096421 3300025944 Bacteria 2475
45 Ga0207661_10156251 3300025944 Bacteria 1976
46 Ga0207712_10248179 3300025961 Bacteria 1437
47 Ga0207641_10099848 3300026088 Unclassified 2555
48 Ga0207675_100657686 3300026118 Bacteria 1054
49 Ga0207683_10066934 3300026121 Unclassified 3168
50 Ga0207428_10129112 3300027907 Bacteria 1935
51 Ga0316576_10024189 3300031727 Bacteria 4240
52 Ga0316578_10025805 3300031728 Bacteria 3308
53 Ga0307405_10094593 3300031731 Bacteria 1988
54 Ga0307407_10058145 3300031903 Bacteria 2247
55 Ga0307416_100015873 3300032002 Bacteria 5217
56 Ga0307414_10053604 3300032004 Bacteria 2814
57 Ga0307411_10126437 3300032005 Bacteria 1860
58 Ga0307415_100080570 3300032126 Bacteria 2323
59 Ga0307415_100124912 3300032126 Bacteria 1937
60 Ga0373928_0000601 3300035084 Bacteria 7082
61 Ga0373932_0000212 3300035112 Bacteria 17140
62 Ga0373931_0000001 3300035691 Bacteria 634029
63 Ga0373931_0000095 3300035691 Bacteria 40736
64 Ga0316584_0013702 3300036712 Bacteria 5747
65 Ga0373925_0261966 3300037068 Bacteria 1389
66 Ga0400485_12229 3300038735 Bacteria 7924
67 Ga0400486_27491 3300038742 Bacteria 1046
68 Ga0400483_037102 3300039062 Bacteria 5015
69 Ga0400483_052561 3300039062 Bacteria 38169
70 Ga0400483_172037 3300039062 Bacteria 19502
71 Ga0400483_220748 3300039062 Bacteria 39057
72 Ga0400483_230901 3300039062 Bacteria 33494
73 Ga0436365_0344747 3300039437 Bacteria 1844
74 Ga0436360_1306632 3300039438 Bacteria 4596
75 Ga0436361_1068100 3300039447 Bacteria 4720
76 Ga0436363_0248555 3300039450 Bacteria 4095
77 Ga0436362_0820099 3300039453 Bacteria 2224
78 Ga0439450_000607 3300042008 Bacteria 4752
79 Ga0439444_0002229 3300042437 Bacteria 2624
80 Ga0439464_0000963 3300042439 Bacteria 6517
81 Ga0439440_0001190 3300042993 Bacteria 4666
82 Ga0466966_0009659 3300044684 Bacteria 6386
83 Ga0453684_0056453 3300044712 Bacteria 5094
84 Ga0466959_0159012 3300045049 Bacteria 1589
85 Ga0466958_0238522 3300045836 Bacteria 1162
86 Ga0466967_0009469 3300045976 Bacteria 7229
87 Ga0495580_0149764 3300046472 Bacteria 1617
88 Ga0495618_0034280 3300046514 Bacteria 3183
89 Ga0495634_0005985 3300046642 Bacteria 9291
90 Ga0495658_0050945 3300046683 Bacteria 2344
91 Ga0495613_0000229 3300046689 Bacteria 53757
92 Ga0495613_0085416 3300046689 Bacteria 2290
93 Ga0495589_0133531 3300046794 Bacteria 1191
94 Ga0496104_0216306 3300048907 Bacteria 1828
95 Ga0496108_0176738 3300048911 Bacteria 1848
96 Ga0496108_0192535 3300048911 Bacteria 1768
97 Ga0496109_0206668 3300048912 Bacteria 1846
98 Ga0496110_0023118 3300048913 Bacteria 5286
99 Ga0496110_0207491 3300048913 Bacteria 1781
100 Ga0496110_0310498 3300048913 Bacteria 1436
101 Ga0496111_0136289 3300048914 Unclassified 1818
102 Ga0496114_0107561 3300048917 Bacteria 2387
103 Ga0496115_0062594 3300048918 Bacteria 3002
104 Ga0496115_0070842 3300048918 Bacteria 2827
105 Ga0501343_001790 3300049132 Bacteria 1483
106 Ga0501305_001300 3300049161 Bacteria 2405
107 Ga0501312_000164 3300049528 Bacteria 4402
108 Ga0501313_003860 3300049529 Bacteria 1513
109 Ga0501315_009022 3300049531 Bacteria 1171
110 Ga0501317_001639 3300049533 Bacteria 1973
111 Ga0501326_00562 3300049542 Bacteria 1504
112 Ga0501335_002494 3300049551 Bacteria 1498
113 Ga0501033_0000080 3300049570 Bacteria 90690
114 Ga0501033_0144360 3300049570 Bacteria 1720
115 Ga0501034_0006317 3300049571 Bacteria 12757
116 Ga0501034_0104668 3300049571 Bacteria 2823
117 Ga0501034_0301545 3300049571 Bacteria 1539
118 Ga0501036_0104319 3300049572 Bacteria 2397
119 Ga0501036_0203217 3300049572 Bacteria 1666
120 Ga0501038_0017004 3300049574 Bacteria 6582
121 Ga0501039_0002055 3300049575 Bacteria 14915
122 Ga0501039_0016981 3300049575 Bacteria 5579
123 Ga0501039_0025303 3300049575 Bacteria 4560
124 Ga0501039_0237750 3300049575 Bacteria 1432
125 Ga0501040_0009930 3300049576 Bacteria 6213
126 Ga0501040_0106773 3300049576 Bacteria 1956
127 Ga0501040_0180480 3300049576 Bacteria 1496
128 Ga0501041_0006461 3300049577 Bacteria 6863
129 Ga0501041_0076085 3300049577 Bacteria 2065
130 Ga0501043_0166412 3300049579 Bacteria 1722
131 Ga0501043_0167985 3300049579 Bacteria 1712
132 Ga0501046_0051171 3300049580 Bacteria 3260
133 Ga0501046_0230350 3300049580 Bacteria 1369
134 Ga0501047_0224298 3300049581 Bacteria 1735
135 Ga0501048_0009982 3300049582 Bacteria 7110
136 Ga0501067_0214762 3300049583 Bacteria 1071
137 Ga0501070_0213596 3300049586 Bacteria 1583
138 Ga0501071_0004336 3300049587 Bacteria 8994
139 Ga0501071_0023486 3300049587 Bacteria 4307
140 Ga0501072_0027896 3300049588 Bacteria 4406
141 Ga0501072_0040863 3300049588 Bacteria 3642
142 Ga0501074_0072447 3300049590 Bacteria 2475
143 Ga0501074_0125347 3300049590 Bacteria 1837
144 Ga0501075_0010352 3300049591 Bacteria 6553
145 Ga0501075_0401064 3300049591 Bacteria 1045
146 Ga0501076_0010797 3300049592 Bacteria 6790
147 Ga0501076_0345610 3300049592 Bacteria 1221
148 Ga0501077_0006571 3300049593 Bacteria 7139
149 Ga0501079_0014411 3300049741 Bacteria 6027
150 Ga0501079_0027776 3300049741 Bacteria 4340
151 Ga0501079_0057265 3300049741 Bacteria 3007
152 Ga0501080_0241702 3300049742 Bacteria 1648
153 Ga0501081_0209222 3300049743 Bacteria 1416
154 Ga0501035_0083506 3300049822 Bacteria 2818
155 Ga0501044_0000404 3300049823 Bacteria 53275
156 Ga0501044_0258033 3300049823 Bacteria 1682
157 Ga0501045_0000646 3300049824 Bacteria 22070
158 Ga0501045_0037866 3300049824 Bacteria 3507
159 nmdc:mga03n38_14022_c1 3300050490 Bacteria 3062
160 nmdc:mga0yw44_91785_c1 3300050492 Bacteria 1921
161 nmdc:mga05p37_1360_c1 3300050507 Bacteria 28441
162 nmdc:mga05p37_272505_c1 3300050507 Bacteria 2021
163 nmdc:mga05p37_32497_c1 3300050507 Bacteria 6382
164 nmdc:mga05p37_415613_c1 3300050507 Bacteria 1567
165 nmdc:mga09592_164312_c1 3300050508 Bacteria 1918
166 nmdc:mga09592_264270_c1 3300050508 Bacteria 1493
167 nmdc:mga09592_70193_c1 3300050508 Bacteria 2972
168 nmdc:mga0qj67_1454_c1 3300050509 Bacteria 16595
169 nmdc:mga0qj67_378352_c1 3300050509 Bacteria 1144
170 nmdc:mga06r32_135351_c1 3300050510 Bacteria 2439
171 nmdc:mga06r32_176553_c1 3300050510 Bacteria 2121
172 nmdc:mga06r32_205490_c1 3300050510 Bacteria 1958
173 nmdc:mga06r32_363142_c1 3300050510 Bacteria 1432
174 nmdc:mga06r32_420708_c1 3300050510 Bacteria 1317
175 nmdc:mga06r32_4673_c1 3300050510 Bacteria 12292
176 nmdc:mga06r32_89017_c1 3300050510 Bacteria 3013
177 nmdc:mga08y16_116155_c1 3300050511 Bacteria 2786
178 Ga0495601_0236613 3300053077 Bacteria 1192
179 Ga0495612_0052034 3300053078 Bacteria 1684
180 Ga0495612_0062611 3300053078 Bacteria 1542
181 Ga0500566_0011121 3300053094 Bacteria 5302
182 Ga0500568_0038770 3300053139 Bacteria 1927
183 Ga0500616_0000994 3300053153 Bacteria 30646
184 Ga0501084_0010444 3300054114 Bacteria 7678
185 Ga0501084_0013979 3300054114 Bacteria 6644
186 Ga0501082_0072776 3300060353 Bacteria 2960
187 Ga0530510_0009471 3300061734 Bacteria 6829
188 Ga0530510_0086481 3300061734 Bacteria 2284
189 2739231365 2738543010 Bacteria 5583595
190 2858438850 2858438669 Bacteria 2058402
191 2928520502 2928519762 Bacteria 1953908
192 Ga0495628_0034792
193 Ga0070675_100157991
194 Ga0070671_100004501
195 Ga0070706_100006343
196 Ga0068863_100214058
197 Ga0068858_100041237
198 Ga0081455_10046726
199 Ga0081538_10000310
200 Ga0081538_10004385
201 Ga0081538_10014035
202 Ga0081540_1005088
203 Ga0075363_100006974
204 Ga0075428_100236691
205 Ga0075428_100266523
206 Ga0075430_100000746
207 Ga0075430_100007015
208 Ga0075430_100043405
209 Ga0075430_100067373
210 Ga0075430_100087566
211 Ga0075431_100037096
212 Ga0075431_100149064
213 Ga0075431_100291481
214 Ga0075431_100424527
215 Ga0075429_100000821
216 Ga0075429_100031212
217 Ga0075429_100438612
218 Ga0075435_100158780
219 Ga0111539_10009697
220 Ga0111539_10353536
221 Ga0114129_10000753
222 Ga0114129_10298151
223 Ga0105243_10099751
224 Ga0105242_10009241
225 Ga0105249_10395134
226 Ga0105239_10198671
227 Ga0157372_10155985
228 Ga0163163_10226360
229 Ga0213874_10013468
230 Ga0228598_1001423
231 Ga0207710_10032986
232 Ga0207687_10002146
233 Ga0207644_10002404
234 Ga0207706_10293255
235 Ga0207661_10096421
236 Ga0207661_10156251
237 Ga0207712_10248179
238 Ga0207641_10099848
239 Ga0207675_100657686
240 Ga0207683_10066934
241 Ga0207428_10129112
242 Ga0316576_10024189
243 Ga0316578_10025805
244 Ga0307405_10094593
245 Ga0307407_10058145
246 Ga0307416_100015873
247 Ga0307414_10053604
248 Ga0307411_10126437
249 Ga0307415_100080570
250 Ga0307415_100124912
251 Ga0373928_0000601
252 Ga0373932_0000212
253 Ga0373931_0000001
254 Ga0373931_0000095
255 Ga0316584_0013702
256 Ga0373925_0261966
257 Ga0400485_12229
258 Ga0400486_27491
259 Ga0400483_037102
260 Ga0400483_052561
261 Ga0400483_172037
262 Ga0400483_220748
263 Ga0400483_230901
264 Ga0436365_0344747
265 Ga0436360_1306632
266 Ga0436361_1068100
267 Ga0436363_0248555
268 Ga0436362_0820099
269 Ga0439450_000607
270 Ga0439444_0002229
271 Ga0439464_0000963
272 Ga0439440_0001190
273 Ga0466966_0009659
274 Ga0453684_0056453
275 Ga0466959_0159012
276 Ga0466958_0238522
277 Ga0466967_0009469
278 Ga0495580_0149764
279 Ga0495618_0034280
280 Ga0495634_0005985
281 Ga0495658_0050945
282 Ga0495613_0000229
283 Ga0495613_0085416
284 Ga0495589_0133531
285 Ga0496104_0216306
286 Ga0496108_0176738
287 Ga0496108_0192535
288 Ga0496109_0206668
289 Ga0496110_0023118
290 Ga0496110_0207491
291 Ga0496110_0310498
292 Ga0496111_0136289
293 Ga0496114_0107561
294 Ga0496115_0062594
295 Ga0496115_0070842
296 Ga0501343_001790
297 Ga0501305_001300
298 Ga0501312_000164
299 Ga0501313_003860
300 Ga0501315_009022
301 Ga0501317_001639
302 Ga0501326_00562
303 Ga0501335_002494
304 Ga0501033_0000080
305 Ga0501033_0144360
306 Ga0501034_0006317
307 Ga0501034_0104668
308 Ga0501034_0301545
309 Ga0501036_0104319
310 Ga0501036_0203217
311 Ga0501038_0017004
312 Ga0501039_0002055
313 Ga0501039_0016981
314 Ga0501039_0025303
315 Ga0501039_0237750
316 Ga0501040_0009930
317 Ga0501040_0106773
318 Ga0501040_0180480
319 Ga0501041_0006461
320 Ga0501041_0076085
321 Ga0501043_0166412
322 Ga0501043_0167985
323 Ga0501046_0051171
324 Ga0501046_0230350
325 Ga0501047_0224298
326 Ga0501048_0009982
327 Ga0501067_0214762
328 Ga0501070_0213596
329 Ga0501071_0004336
330 Ga0501071_0023486
331 Ga0501072_0027896
332 Ga0501072_0040863
333 Ga0501074_0072447
334 Ga0501074_0125347
335 Ga0501075_0010352
336 Ga0501075_0401064
337 Ga0501076_0010797
338 Ga0501076_0345610
339 Ga0501077_0006571
340 Ga0501079_0014411
341 Ga0501079_0027776
342 Ga0501079_0057265
343 Ga0501080_0241702
344 Ga0501081_0209222
345 Ga0501035_0083506
346 Ga0501044_0000404
347 Ga0501044_0258033
348 Ga0501045_0000646
349 Ga0501045_0037866
350 nmdc:mga03n38_14022_c1
351 nmdc:mga0yw44_91785_c1
352 nmdc:mga05p37_1360_c1
353 nmdc:mga05p37_272505_c1
354 nmdc:mga05p37_32497_c1
355 nmdc:mga05p37_415613_c1
356 nmdc:mga09592_164312_c1
357 nmdc:mga09592_264270_c1
358 nmdc:mga09592_70193_c1
359 nmdc:mga0qj67_1454_c1
360 nmdc:mga0qj67_378352_c1
361 nmdc:mga06r32_135351_c1
362 nmdc:mga06r32_176553_c1
363 nmdc:mga06r32_205490_c1
364 nmdc:mga06r32_363142_c1
365 nmdc:mga06r32_420708_c1
366 nmdc:mga06r32_4673_c1
367 nmdc:mga06r32_89017_c1
368 nmdc:mga08y16_116155_c1
369 Ga0495601_0236613
370 Ga0495612_0052034
371 Ga0495612_0062611
372 Ga0500566_0011121
373 Ga0500568_0038770
374 Ga0500616_0000994
375 Ga0501084_0010444
376 Ga0501084_0013979
377 Ga0501082_0072776
378 Ga0530510_0009471
379 Ga0530510_0086481
380 2739231365
381 2858438850
382 2928520502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

56

361

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9113 6 297
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9082 6 297
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9044 6 295
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9012 6 295
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8869 6 298
ID Description Score Start End Superfamily
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 6 298 3.40.50.150
af_Q9VGY5_27_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9231 6 153 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9169 6 298 3.40.50.150
af_P9WJP1_66_380_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9167 8 297 3.40.50.150
3tkaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8952 8 299 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A662EAD5-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9771 10 241 GO:0005737
GO:0070475
GO:0071424
AF-A0A355DH40-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9616 1 261 GO:0005737
GO:0070475
GO:0071424
AF-A0A6L6EQ99-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9585 2 299 GO:0005737
GO:0070475
GO:0071424
AF-A0A357F3Z6-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9568 2 136 GO:0005737
GO:0070475
GO:0071424
AF-A0A2W5Z7G6-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.954 6 153 GO:0005737
GO:0070475
GO:0071424

Map